Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase

Overview
NameRibulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase
Smed IDSMED30036007
Length (bp)1010
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase (SMED30036007) t-SNE clustered cells

Violin plots show distribution of expression levels for Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase (SMED30036007) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase (SMED30036007) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase (SMED30036007) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30036007

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30036007SMESG000025369.1 Contig5036GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30036007SMESG000027670.1 Contig5036GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parenchymaSMED30036007SMESG000040577.1 SMESG000027670.1 SMESG000027664.1 dd_Smed_v4_3005_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30036007SMESG000040577.1 SMESG000027670.1 SMESG000027664.1 dd_Smed_v4_3005_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Human
Match: ADD3 (adducin 3 [Source:HGNC Symbol;Acc:HGNC:245])

HSP 1 Score: 63.929 bits (154), Expect = 1.626e-10
Identity = 63/279 (22.58%), Postives = 115/279 (41.22%), Query Frame = 1
Query:  109 LNILYKIGFKENWFNGENIFISMRKASSRVFTINAPK-----EIDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQFDFLEFCREFSE------IFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMK-LGKCIHSENVIVPDIETQKNVLKQFKGSISSTLMLNNPNDNVEWLPGQLEFEALMRDFEYNESSSGYDFK 909
            L  LY++     W +  N +IS+R +  +   I  P+     E   + L  ++I  E VD    N+      F  H  I+++    D +C++ I+++    VS    G+ P+SQES  +   ++  +D+     E  E      + G  C+                      + +L+N G    G+T+EE +   +    AC+ Q++ L      +N+ V D +  K        S    +   N   + +W  G++EFE LMR  +     +GY ++
Sbjct:  141 LASLYRLVDLFGWAHLANTYISVRISKEQDHIIIIPRGLSFSEATASNLVKVNIIGEVVDQGSTNLKIDHTGFSPHAAIYSTRP--DVKCVIHIHTLATAAVSSMKCGILPISQESLLLG--DVAYYDYQGSLEEQEERIQLQKVLGPSCK----------------------VLVLRNHGVVALGETLEEAFHYIFNVQLACEIQVQALAGAGGVDNLHVLDFQKYKAFTYTVAASGGGGV---NMGSHQKWKVGEIEFEGLMRTLDNLGYRTGYAYR 390          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Human
Match: ADD3 (adducin 3 [Source:HGNC Symbol;Acc:HGNC:245])

HSP 1 Score: 63.929 bits (154), Expect = 1.626e-10
Identity = 63/279 (22.58%), Postives = 115/279 (41.22%), Query Frame = 1
Query:  109 LNILYKIGFKENWFNGENIFISMRKASSRVFTINAPK-----EIDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQFDFLEFCREFSE------IFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMK-LGKCIHSENVIVPDIETQKNVLKQFKGSISSTLMLNNPNDNVEWLPGQLEFEALMRDFEYNESSSGYDFK 909
            L  LY++     W +  N +IS+R +  +   I  P+     E   + L  ++I  E VD    N+      F  H  I+++    D +C++ I+++    VS    G+ P+SQES  +   ++  +D+     E  E      + G  C+                      + +L+N G    G+T+EE +   +    AC+ Q++ L      +N+ V D +  K        S    +   N   + +W  G++EFE LMR  +     +GY ++
Sbjct:  141 LASLYRLVDLFGWAHLANTYISVRISKEQDHIIIIPRGLSFSEATASNLVKVNIIGEVVDQGSTNLKIDHTGFSPHAAIYSTRP--DVKCVIHIHTLATAAVSSMKCGILPISQESLLLG--DVAYYDYQGSLEEQEERIQLQKVLGPSCK----------------------VLVLRNHGVVALGETLEEAFHYIFNVQLACEIQVQALAGAGGVDNLHVLDFQKYKAFTYTVAASGGGGV---NMGSHQKWKVGEIEFEGLMRTLDNLGYRTGYAYR 390          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Human
Match: ADD3 (adducin 3 [Source:HGNC Symbol;Acc:HGNC:245])

HSP 1 Score: 63.1586 bits (152), Expect = 2.508e-10
Identity = 62/279 (22.22%), Postives = 116/279 (41.58%), Query Frame = 1
Query:  109 LNILYKIGFKENWFNGENIFISMRKASSRVFTINAPK-----EIDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQFDFLEFCREFSE------IFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMK-LGKCIHSENVIVPDIETQKNVLKQFKGSISSTLMLNNPNDNVEWLPGQLEFEALMRDFEYNESSSGYDFK 909
            L  LY++     W +  N +IS+R +  +   I  P+     E   + L  ++I  E VD    N+      F  H  I+++    D +C++ I+++    VS    G+ P+SQES  +   ++  +D+     E  E      + G  C+                      + +L+N G    G+T+EE +   +    AC+ Q++ L      +N+ V D +  K        S    + + +   + +W  G++EFE LMR  +     +GY ++
Sbjct:  141 LASLYRLVDLFGWAHLANTYISVRISKEQDHIIIIPRGLSFSEATASNLVKVNIIGEVVDQGSTNLKIDHTGFSPHAAIYSTRP--DVKCVIHIHTLATAAVSSMKCGILPISQESLLLG--DVAYYDYQGSLEEQEERIQLQKVLGPSCK----------------------VLVLRNHGVVALGETLEEAFHYIFNVQLACEIQVQALAGAGGVDNLHVLDFQKYKAFTYTVAASGGGGVNMGS---HQKWKVGEIEFEGLMRTLDNLGYRTGYAYR 390          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Human
Match: ADD1 (adducin 1 [Source:HGNC Symbol;Acc:HGNC:243])

HSP 1 Score: 59.3066 bits (142), Expect = 3.556e-9
Identity = 54/230 (23.48%), Postives = 102/230 (44.35%), Query Frame = 1
Query:  220 EIDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQFDFLEFCREFSEIFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMK-LGKCIHSENVIVPDIETQKNVLKQFKGSISSTLMLNNPNDNVEWLPGQLEFEALMR---DFEYNESSSG 897
            E+  + L  +++  + VD    N+    A F +H  I+ +    D +C++ I++     VS    GL P+S E+  +   E+   D+         I     E+++I+           +  K+ + +L+N G    G+++EE ++  +    AC+ Q++ L      +N+++ + E  K    +  GS       + P    +W  G+ EFEALMR   +  Y   SSG
Sbjct:  191 EVTASSLVKINLQGDIVDRGSTNLGVNQAGFTLHSAIYAARP--DVKCVVHIHTPAGAAVSAMKCGLLPISPEALSLG--EVAYHDY-------HGILVDEEEKVLIQ---------KNLGPKSKVLILRNHGLVSVGESVEEAFYYIHNLVVACEIQVRTLASAGGPDNLVLLNPEKYK-AKSRSPGSPVGEGTGSPP----KWQIGEQEFEALMRMLDNLGYRTGSSG 395          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Human
Match: ADD1 (adducin 1 [Source:HGNC Symbol;Acc:HGNC:243])

HSP 1 Score: 59.3066 bits (142), Expect = 4.424e-9
Identity = 52/235 (22.13%), Postives = 105/235 (44.68%), Query Frame = 1
Query:  220 EIDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQFDFLEFCREFSEIFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMK-LGKCIHSENVIVPDIETQKNVLKQFKGSISSTLMLNNPNDNVEWLPGQLEFEALMRDFEYNESSSGYDFKIKSI 921
            E+  + L  +++  + VD    N+    A F +H  I+ +    D +C++ I++     VS    GL P+S E+  +   E+   D+         I     E+++I+           +  K+ + +L+N G    G+++EE ++  +    AC+ Q++ L      +N+++ + E  K    +  GS       + P    +W  G+ EFEALMR  +     +GY ++  ++
Sbjct:  191 EVTASSLVKINLQGDIVDRGSTNLGVNQAGFTLHSAIYAARP--DVKCVVHIHTPAGAAVSAMKCGLLPISPEALSLG--EVAYHDY-------HGILVDEEEKVLIQ---------KNLGPKSKVLILRNHGLVSVGESVEEAFYYIHNLVVACEIQVRTLASAGGPDNLVLLNPEKYK-AKSRSPGSPVGEGTGSPP----KWQIGEQEFEALMRMLDNLGYRTGYPYRYPAL 400          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Celegans
Match: add-2 (Adducin-related protein 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20952])

HSP 1 Score: 72.4034 bits (176), Expect = 2.624e-14
Identity = 52/226 (23.01%), Postives = 99/226 (43.81%), Query Frame = 1
Query:  220 EIDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQFDFLEFCREFSEIFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMKLGKCIHSENVIVPDIETQKNVLKQFKGSISSTLMLNNPNDNVEWLPGQLEFEALMRDFEYNESSSG 897
            E+  + L  +D++   +D    N     A +++H  IHN     + +C++ ++  +V+ VS    GL P+SQES  V   ++   ++     + +E                 + +  + L   N+ +L+N G  V G++IE      Y    AC+TQ++     +++NV  P     K V K            N   ++++W  G+LE++A MR  +     +G
Sbjct:   86 EVSASSLIKVDLDGTVIDGGSTNFGVNQAGYVLHSAIHNGRP--EVKCVVHLHHPSVVAVSAQKCGLLPISQESMIVG--DVGYHEYRGILIDEAE-----------------RALLVRDLGDRNVMILRNHGFVVCGESIEHALSLTYHLIIACETQIRTVPGGNTDNVHFPAQSAIKQVYKVASQGGGGVNRQNGHVNSMQWKKGELEWQAYMRQLDAQGYVTG 290          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Celegans
Match: add-2 (Adducin-related protein 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20952])

HSP 1 Score: 71.2478 bits (173), Expect = 1.905e-13
Identity = 54/219 (24.66%), Postives = 96/219 (43.84%), Query Frame = 1
Query:  220 EIDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQFDFLEFCREFSEIFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMKLGKCIHSENVIVPDIETQKNVLKQFKGSISSTLMLNNPNDNVEWLPGQLEFEALMRDFE 876
            E+  + L  +D++   +D    N     A +++H  IHN     + +C++ ++  +V+ VS    GL P+SQES  V G   +         E+  I     E          + +  + L   N+ +L+N G  V G++IE      Y    AC+TQ++     +++NV  P     K V K            N   ++++W  G+LE++A MR  +
Sbjct:  403 EVSASSLIKVDLDGTVIDGGSTNFGVNQAGYVLHSAIHNGRP--EVKCVVHLHHPSVVAVSAQKCGLLPISQESMIV-GDVGYH--------EYRGILIDEAE----------RALLVRDLGDRNVMILRNHGFVVCGESIEHALSLTYHLIIACETQIRTVPGGNTDNVHFPAQSAIKQVYKVASQGGGGVNRQNGHVNSMQWKKGELEWQAYMRQLD 600          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Celegans
Match: add-2 (Adducin-related protein 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20952])

HSP 1 Score: 71.2478 bits (173), Expect = 1.905e-13
Identity = 54/219 (24.66%), Postives = 96/219 (43.84%), Query Frame = 1
Query:  220 EIDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQFDFLEFCREFSEIFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMKLGKCIHSENVIVPDIETQKNVLKQFKGSISSTLMLNNPNDNVEWLPGQLEFEALMRDFE 876
            E+  + L  +D++   +D    N     A +++H  IHN     + +C++ ++  +V+ VS    GL P+SQES  V G   +         E+  I     E          + +  + L   N+ +L+N G  V G++IE      Y    AC+TQ++     +++NV  P     K V K            N   ++++W  G+LE++A MR  +
Sbjct:  403 EVSASSLIKVDLDGTVIDGGSTNFGVNQAGYVLHSAIHNGRP--EVKCVVHLHHPSVVAVSAQKCGLLPISQESMIV-GDVGYH--------EYRGILIDEAE----------RALLVRDLGDRNVMILRNHGFVVCGESIEHALSLTYHLIIACETQIRTVPGGNTDNVHFPAQSAIKQVYKVASQGGGGVNRQNGHVNSMQWKKGELEWQAYMRQLD 600          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Celegans
Match: add-2 (Adducin-related protein 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20952])

HSP 1 Score: 71.2478 bits (173), Expect = 1.905e-13
Identity = 54/219 (24.66%), Postives = 96/219 (43.84%), Query Frame = 1
Query:  220 EIDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQFDFLEFCREFSEIFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMKLGKCIHSENVIVPDIETQKNVLKQFKGSISSTLMLNNPNDNVEWLPGQLEFEALMRDFE 876
            E+  + L  +D++   +D    N     A +++H  IHN     + +C++ ++  +V+ VS    GL P+SQES  V G   +         E+  I     E          + +  + L   N+ +L+N G  V G++IE      Y    AC+TQ++     +++NV  P     K V K            N   ++++W  G+LE++A MR  +
Sbjct:  403 EVSASSLIKVDLDGTVIDGGSTNFGVNQAGYVLHSAIHNGRP--EVKCVVHLHHPSVVAVSAQKCGLLPISQESMIV-GDVGYH--------EYRGILIDEAE----------RALLVRDLGDRNVMILRNHGFVVCGESIEHALSLTYHLIIACETQIRTVPGGNTDNVHFPAQSAIKQVYKVASQGGGGVNRQNGHVNSMQWKKGELEWQAYMRQLD 600          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Celegans
Match: add-1 (Adducin-related protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9U9K0])

HSP 1 Score: 63.929 bits (154), Expect = 5.285e-11
Identity = 51/203 (25.12%), Postives = 95/203 (46.80%), Query Frame = 1
Query:  307 SFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVN--GSEIFQFDFLEFCREFSEIFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMKLGKCIHSENVIVPDIETQKNVLKQFKGSISSTLMLNNPNDNVEWLPGQLEFEALMRDFEYNESSSGYDFK 909
            +FL+H  I+ +  +   RCIL +++  V  V+    GL P+ +E+  +   G   +Q D  +   +F EI  +                    L   N+  L+N G  V G TIE   F       AC+TQ++  +    +N+I+P+   +K + + F+ S ++  +    N  V+W  G+LE+E+ MR  ++    +G+ ++
Sbjct:  198 AFLLHSAIYKAHPM--VRCILHMHTAIVAAVASMKCGLLPLCKEAMVLGPVGYHDYQ-DIGDDDIQFDEIIAN--------------------LGDKNVLFLRNQGFLVVGDTIEHATFLANNTVIACETQVRAARA-GLDNLIIPE---EKAIQRAFRNSRNTNSLKR--NGTVDWRVGELEWESWMRVLDHANFQTGHVYR 371          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Zebrafish
Match: add3a (adducin 3 (gamma) a [Source:ZFIN;Acc:ZDB-GENE-030131-2721])

HSP 1 Score: 72.7886 bits (177), Expect = 1.129e-13
Identity = 72/285 (25.26%), Postives = 122/285 (42.81%), Query Frame = 1
Query:   76 LSKSDLEFDLNLNILYKIGFKENWFNGENIFISMRKASSRVFTINAPK-----EIDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQFDFLEFCREFSEIFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMKLGKCIHS-ENVIVPDIETQKNVLKQFKGSISSTLMLN-NPNDNVEWLPGQLEFEALMRDFEYNESSSGYDFK 909
            + K + +    L  LY+I    +W +  + +I++R +  +   +  P+     E   + L  ++I  + +D    N+    A F  H  I++     D RCI+ I++     VS    GL P+SQE+  +     + +             GS  E+     L K  G   ++L      +L+N G    G+TIEE +   Y   YAC+ Q+    C    EN+IV D+E       +FK        +  N     +W  G+LEFE+LMR  +     +GY ++
Sbjct:  130 MVKGEKQTRCKLASLYRIVDLFSWAHFASCYITVRVSKEQDHILIIPRGLSFAEASASNLVKVNILGDVIDQGSTNLRIDAAGFSPHAAIYSIRP--DVRCIVHISTPATAAVSSMKCGLLPISQEALILGDIAYYNYQ------------GSLDEQEERVELQKALGPTAKVL------VLRNHGIVALGETIEEAFHYIYGAQYACEIQVNAFSCAGGMENLIVLDLE-------KFKARTQGVAQVGVNMGSQQKWRLGELEFESLMRMLDNLGYRTGYTYR 387          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Zebrafish
Match: add3a (adducin 3 (gamma) a [Source:ZFIN;Acc:ZDB-GENE-030131-2721])

HSP 1 Score: 72.7886 bits (177), Expect = 1.129e-13
Identity = 72/285 (25.26%), Postives = 122/285 (42.81%), Query Frame = 1
Query:   76 LSKSDLEFDLNLNILYKIGFKENWFNGENIFISMRKASSRVFTINAPK-----EIDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQFDFLEFCREFSEIFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMKLGKCIHS-ENVIVPDIETQKNVLKQFKGSISSTLMLN-NPNDNVEWLPGQLEFEALMRDFEYNESSSGYDFK 909
            + K + +    L  LY+I    +W +  + +I++R +  +   +  P+     E   + L  ++I  + +D    N+    A F  H  I++     D RCI+ I++     VS    GL P+SQE+  +     + +             GS  E+     L K  G   ++L      +L+N G    G+TIEE +   Y   YAC+ Q+    C    EN+IV D+E       +FK        +  N     +W  G+LEFE+LMR  +     +GY ++
Sbjct:  130 MVKGEKQTRCKLASLYRIVDLFSWAHFASCYITVRVSKEQDHILIIPRGLSFAEASASNLVKVNILGDVIDQGSTNLRIDAAGFSPHAAIYSIRP--DVRCIVHISTPATAAVSSMKCGLLPISQEALILGDIAYYNYQ------------GSLDEQEERVELQKALGPTAKVL------VLRNHGIVALGETIEEAFHYIYGAQYACEIQVNAFSCAGGMENLIVLDLE-------KFKARTQGVAQVGVNMGSQQKWRLGELEFESLMRMLDNLGYRTGYTYR 387          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Zebrafish
Match: add3a (adducin 3 (gamma) a [Source:ZFIN;Acc:ZDB-GENE-030131-2721])

HSP 1 Score: 72.0182 bits (175), Expect = 1.866e-13
Identity = 72/283 (25.44%), Postives = 121/283 (42.76%), Query Frame = 1
Query:   82 KSDLEFDLNLNILYKIGFKENWFNGENIFISMRKASSRVFTINAPK-----EIDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQFDFLEFCREFSEIFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMKLGKCIHS-ENVIVPDIETQKNVLKQFKGSISSTLMLN-NPNDNVEWLPGQLEFEALMRDFEYNESSSGYDFK 909
            K + +    L  LY+I    +W +  + +I++R +  +   +  P+     E   + L  ++I  + +D    N+    A F  H  I++     D RCI+ I++     VS    GL P+SQE+  +     + +             GS  E+     L K  G   ++L      +L+N G    G+TIEE +   Y   YAC+ Q+    C    EN+IV D+E       +FK        +  N     +W  G+LEFE+LMR  +     +GY ++
Sbjct:  132 KGEKQTRCKLASLYRIVDLFSWAHFASCYITVRVSKEQDHILIIPRGLSFAEASASNLVKVNILGDVIDQGSTNLRIDAAGFSPHAAIYSIRP--DVRCIVHISTPATAAVSSMKCGLLPISQEALILGDIAYYNYQ------------GSLDEQEERVELQKALGPTAKVL------VLRNHGIVALGETIEEAFHYIYGAQYACEIQVNAFSCAGGMENLIVLDLE-------KFKARTQGVAQVGVNMGSQQKWRLGELEFESLMRMLDNLGYRTGYTYR 387          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Zebrafish
Match: add3a (adducin 3 (gamma) a [Source:ZFIN;Acc:ZDB-GENE-030131-2721])

HSP 1 Score: 72.0182 bits (175), Expect = 2.026e-13
Identity = 72/283 (25.44%), Postives = 121/283 (42.76%), Query Frame = 1
Query:   82 KSDLEFDLNLNILYKIGFKENWFNGENIFISMRKASSRVFTINAPK-----EIDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQFDFLEFCREFSEIFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMKLGKCIHS-ENVIVPDIETQKNVLKQFKGSISSTLMLN-NPNDNVEWLPGQLEFEALMRDFEYNESSSGYDFK 909
            K + +    L  LY+I    +W +  + +I++R +  +   +  P+     E   + L  ++I  + +D    N+    A F  H  I++     D RCI+ I++     VS    GL P+SQE+  +     + +             GS  E+     L K  G   ++L      +L+N G    G+TIEE +   Y   YAC+ Q+    C    EN+IV D+E       +FK        +  N     +W  G+LEFE+LMR  +     +GY ++
Sbjct:  132 KGEKQTRCKLASLYRIVDLFSWAHFASCYITVRVSKEQDHILIIPRGLSFAEASASNLVKVNILGDVIDQGSTNLRIDAAGFSPHAAIYSIRP--DVRCIVHISTPATAAVSSMKCGLLPISQEALILGDIAYYNYQ------------GSLDEQEERVELQKALGPTAKVL------VLRNHGIVALGETIEEAFHYIYGAQYACEIQVNAFSCAGGMENLIVLDLE-------KFKARTQGVAQVGVNMGSQQKWRLGELEFESLMRMLDNLGYRTGYTYR 387          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Zebrafish
Match: add3a (adducin 3 (gamma) a [Source:ZFIN;Acc:ZDB-GENE-030131-2721])

HSP 1 Score: 72.0182 bits (175), Expect = 2.026e-13
Identity = 72/283 (25.44%), Postives = 121/283 (42.76%), Query Frame = 1
Query:   82 KSDLEFDLNLNILYKIGFKENWFNGENIFISMRKASSRVFTINAPK-----EIDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQFDFLEFCREFSEIFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMKLGKCIHS-ENVIVPDIETQKNVLKQFKGSISSTLMLN-NPNDNVEWLPGQLEFEALMRDFEYNESSSGYDFK 909
            K + +    L  LY+I    +W +  + +I++R +  +   +  P+     E   + L  ++I  + +D    N+    A F  H  I++     D RCI+ I++     VS    GL P+SQE+  +     + +             GS  E+     L K  G   ++L      +L+N G    G+TIEE +   Y   YAC+ Q+    C    EN+IV D+E       +FK        +  N     +W  G+LEFE+LMR  +     +GY ++
Sbjct:  132 KGEKQTRCKLASLYRIVDLFSWAHFASCYITVRVSKEQDHILIIPRGLSFAEASASNLVKVNILGDVIDQGSTNLRIDAAGFSPHAAIYSIRP--DVRCIVHISTPATAAVSSMKCGLLPISQEALILGDIAYYNYQ------------GSLDEQEERVELQKALGPTAKVL------VLRNHGIVALGETIEEAFHYIYGAQYACEIQVNAFSCAGGMENLIVLDLE-------KFKARTQGVAQVGVNMGSQQKWRLGELEFESLMRMLDNLGYRTGYTYR 387          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Xenopus
Match: add1 (adducin 1 [Source:NCBI gene;Acc:448173])

HSP 1 Score: 66.2402 bits (160), Expect = 2.111e-11
Identity = 56/235 (23.83%), Postives = 104/235 (44.26%), Query Frame = 1
Query:  220 EIDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQFDFLEFCREFSEIFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMK-LGKCIHSENVIVPDIETQKNVLKQFKGSISSTLMLNNPNDNVEWLPGQLEFEALMRDFEYNESSSGYDFKIKSI 921
            E+  + L  +++  E VD    N+    A F +H  I+ +    D +CI+ I+S     VS    GL P+S E+  +   E+   D+         I     E+++I+           +  K+ + +L+N G    G+T+EE ++  +    AC+ Q++ L      +N+++ D    K      K     T   +    + +WL G+ EFEALMR  +     +GY ++  ++
Sbjct:  191 EVTASSLIKVNLQGELVDRGSTNLGVNKAGFTLHSAIYAARP--DVKCIVHIHSPAGAAVSAMKCGLLPLSPEALSLG--EVAYHDY-------HGILVDEEEKVLIQ---------KNLGPKSKVLILRNHGLVTMGETVEEAFYYIHNLMSACEIQVRTLASAGGPDNLVLLDPGKYK------KSRSPETPSGDGSGLHPKWLVGEQEFEALMRMLDNLGYRTGYPYRCPAL 399          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Xenopus
Match: add1 (adducin 1 [Source:NCBI gene;Acc:448173])

HSP 1 Score: 65.855 bits (159), Expect = 2.726e-11
Identity = 56/235 (23.83%), Postives = 104/235 (44.26%), Query Frame = 1
Query:  220 EIDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQFDFLEFCREFSEIFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMK-LGKCIHSENVIVPDIETQKNVLKQFKGSISSTLMLNNPNDNVEWLPGQLEFEALMRDFEYNESSSGYDFKIKSI 921
            E+  + L  +++  E VD    N+    A F +H  I+ +    D +CI+ I+S     VS    GL P+S E+  +   E+   D+         I     E+++I+           +  K+ + +L+N G    G+T+EE ++  +    AC+ Q++ L      +N+++ D    K      K     T   +    + +WL G+ EFEALMR  +     +GY ++  ++
Sbjct:  191 EVTASSLIKVNLQGELVDRGSTNLGVNKAGFTLHSAIYAARP--DVKCIVHIHSPAGAAVSAMKCGLLPLSPEALSLG--EVAYHDY-------HGILVDEEEKVLIQ---------KNLGPKSKVLILRNHGLVTMGETVEEAFYYIHNLMSACEIQVRTLASAGGPDNLVLLDPGKYK------KSRSPETPSGDGSGLHPKWLVGEQEFEALMRMLDNLGYRTGYPYRCPAL 399          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Xenopus
Match: add1 (adducin 1 [Source:NCBI gene;Acc:448173])

HSP 1 Score: 65.855 bits (159), Expect = 3.082e-11
Identity = 56/235 (23.83%), Postives = 104/235 (44.26%), Query Frame = 1
Query:  220 EIDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQFDFLEFCREFSEIFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMK-LGKCIHSENVIVPDIETQKNVLKQFKGSISSTLMLNNPNDNVEWLPGQLEFEALMRDFEYNESSSGYDFKIKSI 921
            E+  + L  +++  E VD    N+    A F +H  I+ +    D +CI+ I+S     VS    GL P+S E+  +   E+   D+         I     E+++I+           +  K+ + +L+N G    G+T+EE ++  +    AC+ Q++ L      +N+++ D    K      K     T   +    + +WL G+ EFEALMR  +     +GY ++  ++
Sbjct:  191 EVTASSLIKVNLQGELVDRGSTNLGVNKAGFTLHSAIYAARP--DVKCIVHIHSPAGAAVSAMKCGLLPLSPEALSLG--EVAYHDY-------HGILVDEEEKVLIQ---------KNLGPKSKVLILRNHGLVTMGETVEEAFYYIHNLMSACEIQVRTLASAGGPDNLVLLDPGKYK------KSRSPETPSGDGSGLHPKWLVGEQEFEALMRMLDNLGYRTGYPYRCPAL 399          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Xenopus
Match: add1 (adducin 1 [Source:NCBI gene;Acc:448173])

HSP 1 Score: 65.4698 bits (158), Expect = 4.475e-11
Identity = 56/235 (23.83%), Postives = 104/235 (44.26%), Query Frame = 1
Query:  220 EIDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQFDFLEFCREFSEIFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMK-LGKCIHSENVIVPDIETQKNVLKQFKGSISSTLMLNNPNDNVEWLPGQLEFEALMRDFEYNESSSGYDFKIKSI 921
            E+  + L  +++  E VD    N+    A F +H  I+ +    D +CI+ I+S     VS    GL P+S E+  +   E+   D+         I     E+++I+           +  K+ + +L+N G    G+T+EE ++  +    AC+ Q++ L      +N+++ D    K      K     T   +    + +WL G+ EFEALMR  +     +GY ++  ++
Sbjct:  191 EVTASSLIKVNLQGELVDRGSTNLGVNKAGFTLHSAIYAARP--DVKCIVHIHSPAGAAVSAMKCGLLPLSPEALSLG--EVAYHDY-------HGILVDEEEKVLIQ---------KNLGPKSKVLILRNHGLVTMGETVEEAFYYIHNLMSACEIQVRTLASAGGPDNLVLLDPGKYK------KSRSPETPSGDGSGLHPKWLVGEQEFEALMRMLDNLGYRTGYPYRCPAL 399          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Xenopus
Match: add1 (adducin 1 [Source:NCBI gene;Acc:448173])

HSP 1 Score: 65.0846 bits (157), Expect = 6.018e-11
Identity = 56/235 (23.83%), Postives = 104/235 (44.26%), Query Frame = 1
Query:  220 EIDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQFDFLEFCREFSEIFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMK-LGKCIHSENVIVPDIETQKNVLKQFKGSISSTLMLNNPNDNVEWLPGQLEFEALMRDFEYNESSSGYDFKIKSI 921
            E+  + L  +++  E VD    N+    A F +H  I+ +    D +CI+ I+S     VS    GL P+S E+  +   E+   D+         I     E+++I+           +  K+ + +L+N G    G+T+EE ++  +    AC+ Q++ L      +N+++ D    K      K     T   +    + +WL G+ EFEALMR  +     +GY ++  ++
Sbjct:  191 EVTASSLIKVNLQGELVDRGSTNLGVNKAGFTLHSAIYAARP--DVKCIVHIHSPAGAAVSAMKCGLLPLSPEALSLG--EVAYHDY-------HGILVDEEEKVLIQ---------KNLGPKSKVLILRNHGLVTMGETVEEAFYYIHNLMSACEIQVRTLASAGGPDNLVLLDPGKYK------KSRSPETPSGDGSGLHPKWLVGEQEFEALMRMLDNLGYRTGYPYRCPAL 399          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Mouse
Match: Add3 (adducin 3 (gamma) [Source:MGI Symbol;Acc:MGI:1351615])

HSP 1 Score: 65.4698 bits (158), Expect = 3.493e-11
Identity = 62/281 (22.06%), Postives = 117/281 (41.64%), Query Frame = 1
Query:  109 LNILYKIGFKENWFNGENIFISMRKASSRVFTINAPK-----EIDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQF----DFLEFCREFSEIFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMK-LGKCIHSENVIVPDIETQKNVLKQFKGSISSTLMLNNPNDNV----EWLPGQLEFEALMRDFEYNESSSGYDFK 909
            L  LY++     W +  N +IS+R +  +   I  P+     E   + L  ++I  E VD    ++      F  H  I+++    D +C++ I+++    VS    G+ P+SQES  +     + +    D  E   E  ++ G  C+                      + +L+N G    G+T+EE +   +    AC+ Q++ +      +N++V D       L+++K       M      N+    +W  G++EFE LMR  +     +GY ++
Sbjct:  141 LASLYRLADLFGWAHLANTYISVRISKEQDHIIIIPRGLSFSEATASTLVKVNIIGEVVDQGSTDLKIDHTGFSPHAAIYSTRP--DVKCVIHIHTLATAAVSSMKCGILPISQESLILGDVAYYDYQGSLDEEEERIELQKVLGPSCK----------------------VLVLRNHGMVALGETLEEAFHYIFNVQMACEIQVQAVAGAGGVDNLLVLD-------LQKYKAFTHGVAMSGGGGVNMASHQKWKVGEIEFEGLMRTLDNLGYRTGYAYR 390          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Mouse
Match: Add3 (adducin 3 (gamma) [Source:MGI Symbol;Acc:MGI:1351615])

HSP 1 Score: 65.4698 bits (158), Expect = 3.493e-11
Identity = 62/281 (22.06%), Postives = 117/281 (41.64%), Query Frame = 1
Query:  109 LNILYKIGFKENWFNGENIFISMRKASSRVFTINAPK-----EIDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQF----DFLEFCREFSEIFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMK-LGKCIHSENVIVPDIETQKNVLKQFKGSISSTLMLNNPNDNV----EWLPGQLEFEALMRDFEYNESSSGYDFK 909
            L  LY++     W +  N +IS+R +  +   I  P+     E   + L  ++I  E VD    ++      F  H  I+++    D +C++ I+++    VS    G+ P+SQES  +     + +    D  E   E  ++ G  C+                      + +L+N G    G+T+EE +   +    AC+ Q++ +      +N++V D       L+++K       M      N+    +W  G++EFE LMR  +     +GY ++
Sbjct:  141 LASLYRLADLFGWAHLANTYISVRISKEQDHIIIIPRGLSFSEATASTLVKVNIIGEVVDQGSTDLKIDHTGFSPHAAIYSTRP--DVKCVIHIHTLATAAVSSMKCGILPISQESLILGDVAYYDYQGSLDEEEERIELQKVLGPSCK----------------------VLVLRNHGMVALGETLEEAFHYIFNVQMACEIQVQAVAGAGGVDNLLVLD-------LQKYKAFTHGVAMSGGGGVNMASHQKWKVGEIEFEGLMRTLDNLGYRTGYAYR 390          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Mouse
Match: Add3 (adducin 3 (gamma) [Source:MGI Symbol;Acc:MGI:1351615])

HSP 1 Score: 65.4698 bits (158), Expect = 3.493e-11
Identity = 62/281 (22.06%), Postives = 117/281 (41.64%), Query Frame = 1
Query:  109 LNILYKIGFKENWFNGENIFISMRKASSRVFTINAPK-----EIDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQF----DFLEFCREFSEIFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMK-LGKCIHSENVIVPDIETQKNVLKQFKGSISSTLMLNNPNDNV----EWLPGQLEFEALMRDFEYNESSSGYDFK 909
            L  LY++     W +  N +IS+R +  +   I  P+     E   + L  ++I  E VD    ++      F  H  I+++    D +C++ I+++    VS    G+ P+SQES  +     + +    D  E   E  ++ G  C+                      + +L+N G    G+T+EE +   +    AC+ Q++ +      +N++V D       L+++K       M      N+    +W  G++EFE LMR  +     +GY ++
Sbjct:  141 LASLYRLADLFGWAHLANTYISVRISKEQDHIIIIPRGLSFSEATASTLVKVNIIGEVVDQGSTDLKIDHTGFSPHAAIYSTRP--DVKCVIHIHTLATAAVSSMKCGILPISQESLILGDVAYYDYQGSLDEEEERIELQKVLGPSCK----------------------VLVLRNHGMVALGETLEEAFHYIFNVQMACEIQVQAVAGAGGVDNLLVLD-------LQKYKAFTHGVAMSGGGGVNMASHQKWKVGEIEFEGLMRTLDNLGYRTGYAYR 390          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Mouse
Match: Add3 (adducin 3 (gamma) [Source:MGI Symbol;Acc:MGI:1351615])

HSP 1 Score: 65.4698 bits (158), Expect = 3.493e-11
Identity = 62/281 (22.06%), Postives = 117/281 (41.64%), Query Frame = 1
Query:  109 LNILYKIGFKENWFNGENIFISMRKASSRVFTINAPK-----EIDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQF----DFLEFCREFSEIFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMK-LGKCIHSENVIVPDIETQKNVLKQFKGSISSTLMLNNPNDNV----EWLPGQLEFEALMRDFEYNESSSGYDFK 909
            L  LY++     W +  N +IS+R +  +   I  P+     E   + L  ++I  E VD    ++      F  H  I+++    D +C++ I+++    VS    G+ P+SQES  +     + +    D  E   E  ++ G  C+                      + +L+N G    G+T+EE +   +    AC+ Q++ +      +N++V D       L+++K       M      N+    +W  G++EFE LMR  +     +GY ++
Sbjct:  141 LASLYRLADLFGWAHLANTYISVRISKEQDHIIIIPRGLSFSEATASTLVKVNIIGEVVDQGSTDLKIDHTGFSPHAAIYSTRP--DVKCVIHIHTLATAAVSSMKCGILPISQESLILGDVAYYDYQGSLDEEEERIELQKVLGPSCK----------------------VLVLRNHGMVALGETLEEAFHYIFNVQMACEIQVQAVAGAGGVDNLLVLD-------LQKYKAFTHGVAMSGGGGVNMASHQKWKVGEIEFEGLMRTLDNLGYRTGYAYR 390          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Mouse
Match: Add3 (adducin 3 (gamma) [Source:MGI Symbol;Acc:MGI:1351615])

HSP 1 Score: 65.4698 bits (158), Expect = 3.493e-11
Identity = 62/281 (22.06%), Postives = 117/281 (41.64%), Query Frame = 1
Query:  109 LNILYKIGFKENWFNGENIFISMRKASSRVFTINAPK-----EIDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQF----DFLEFCREFSEIFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMK-LGKCIHSENVIVPDIETQKNVLKQFKGSISSTLMLNNPNDNV----EWLPGQLEFEALMRDFEYNESSSGYDFK 909
            L  LY++     W +  N +IS+R +  +   I  P+     E   + L  ++I  E VD    ++      F  H  I+++    D +C++ I+++    VS    G+ P+SQES  +     + +    D  E   E  ++ G  C+                      + +L+N G    G+T+EE +   +    AC+ Q++ +      +N++V D       L+++K       M      N+    +W  G++EFE LMR  +     +GY ++
Sbjct:  141 LASLYRLADLFGWAHLANTYISVRISKEQDHIIIIPRGLSFSEATASTLVKVNIIGEVVDQGSTDLKIDHTGFSPHAAIYSTRP--DVKCVIHIHTLATAAVSSMKCGILPISQESLILGDVAYYDYQGSLDEEEERIELQKVLGPSCK----------------------VLVLRNHGMVALGETLEEAFHYIFNVQMACEIQVQAVAGAGGVDNLLVLD-------LQKYKAFTHGVAMSGGGGVNMASHQKWKVGEIEFEGLMRTLDNLGYRTGYAYR 390          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. UniProt/SwissProt
Match: sp|Q20952|ADD2_CAEEL (Adducin-related protein 2 OS=Caenorhabditis elegans OX=6239 GN=add-2 PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 2.423e-12
Identity = 54/219 (24.66%), Postives = 96/219 (43.84%), Query Frame = 1
Query:  220 EIDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQFDFLEFCREFSEIFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMKLGKCIHSENVIVPDIETQKNVLKQFKGSISSTLMLNNPNDNVEWLPGQLEFEALMRDFE 876
            E+  + L  +D++   +D    N     A +++H  IHN     + +C++ ++  +V+ VS    GL P+SQES  V G   +         E+  I     E          + +  + L   N+ +L+N G  V G++IE      Y    AC+TQ++     +++NV  P     K V K            N   ++++W  G+LE++A MR  +
Sbjct:  403 EVSASSLIKVDLDGTVIDGGSTNFGVNQAGYVLHSAIHNGRP--EVKCVVHLHHPSVVAVSAQKCGLLPISQESMIV-GDVGYH--------EYRGILIDEAE----------RALLVRDLGDRNVMILRNHGFVVCGESIEHALSLTYHLIIACETQIRTVPGGNTDNVHFPAQSAIKQVYKVASQGGGGVNRQNGHVNSMQWKKGELEWQAYMRQLD 600          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. UniProt/SwissProt
Match: sp|Q62847|ADDG_RAT (Gamma-adducin OS=Rattus norvegicus OX=10116 GN=Add3 PE=1 SV=2)

HSP 1 Score: 66.6254 bits (161), Expect = 8.511e-11
Identity = 62/281 (22.06%), Postives = 118/281 (41.99%), Query Frame = 1
Query:  109 LNILYKIGFKENWFNGENIFISMRKASSRVFTINAPK-----EIDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQF----DFLEFCREFSEIFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMK-LGKCIHSENVIVPDIETQKNVLKQFKGSISSTLMLNNPNDNV----EWLPGQLEFEALMRDFEYNESSSGYDFK 909
            L  LY++     W +  N +IS+R +  +   I  P+     E   + L  ++I  E VD    N+    + F  H  I+++    D +C++ I+++    VS    G+ P+SQES  +     + +    D  E   E  ++ G  C+                      + +L+N G    G+T+EE +   +    AC+ Q++ +      +N+++ D       L+++K       M      N+    +W  G++EFE LMR  +     +GY ++
Sbjct:  141 LASLYRLADLFGWAHLANTYISVRVSKEQDHIIIIPRGLPFSEATASALVKVNIIGEVVDQGSTNLKIDHSGFSPHAAIYSTRP--DVKCVIHIHTLATAAVSSMKCGILPISQESLILGDVAYYDYQGSLDEEEERIELQKVLGPSCK----------------------VLVLRNHGVVALGETLEEAFHYIFNVQMACEIQVQAVAGAGGVDNLLILD-------LQKYKAFTHGVAMTGGGGVNMGSHQKWKVGEIEFEGLMRTLDNLGYRTGYAYR 390          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. UniProt/SwissProt
Match: sp|Q9QYB5|ADDG_MOUSE (Gamma-adducin OS=Mus musculus OX=10090 GN=Add3 PE=1 SV=2)

HSP 1 Score: 64.6994 bits (156), Expect = 4.396e-10
Identity = 62/281 (22.06%), Postives = 117/281 (41.64%), Query Frame = 1
Query:  109 LNILYKIGFKENWFNGENIFISMRKASSRVFTINAPK-----EIDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQF----DFLEFCREFSEIFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMK-LGKCIHSENVIVPDIETQKNVLKQFKGSISSTLMLNNPNDNV----EWLPGQLEFEALMRDFEYNESSSGYDFK 909
            L  LY++     W +  N +IS+R +  +   I  P+     E   + L  ++I  E VD    ++      F  H  I+++    D +C++ I+++    VS    G+ P+SQES  +     + +    D  E   E  ++ G  C+                      + +L+N G    G+T+EE +   +    AC+ Q++ +      +N++V D       L+++K       M      N+    +W  G++EFE LMR  +     +GY ++
Sbjct:  141 LASLYRLADLFGWAHLANTYISVRISKEQDHIIIIPRGLSFSEATASTLVKVNIIGEVVDQGSTDLKIDHTGFSPHAAIYSTRP--DVKCVIHIHTLATAAVSSMKCGILPISQESLILGDVAYYDYQGSLDEEEERIELQKVLGPSCK----------------------VLVLRNHGMVALGETLEEAFHYIFNVQMACEIQVQAVAGAGGVDNLLVLD-------LQKYKAFTHGVAMSGGGGVNMASHQKWKVGEIEFEGLMRTLDNLGYRTGYAYR 390          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. UniProt/SwissProt
Match: sp|Q9U9K0|ADD1_CAEEL (Adducin-related protein 1 OS=Caenorhabditis elegans OX=6239 GN=add-1 PE=2 SV=2)

HSP 1 Score: 63.5438 bits (153), Expect = 1.039e-9
Identity = 51/203 (25.12%), Postives = 95/203 (46.80%), Query Frame = 1
Query:  307 SFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVN--GSEIFQFDFLEFCREFSEIFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMKLGKCIHSENVIVPDIETQKNVLKQFKGSISSTLMLNNPNDNVEWLPGQLEFEALMRDFEYNESSSGYDFK 909
            +FL+H  I+ +  +   RCIL +++  V  V+    GL P+ +E+  +   G   +Q D  +   +F EI  +                    L   N+  L+N G  V G TIE   F       AC+TQ++  +    +N+I+P+   +K + + F+ S ++  +    N  V+W  G+LE+E+ MR  ++    +G+ ++
Sbjct:  198 AFLLHSAIYKAHPM--VRCILHMHTAIVAAVASMKCGLLPLCKEAMVLGPVGYHDYQ-DIGDDDIQFDEIIAN--------------------LGDKNVLFLRNQGFLVVGDTIEHATFLANNTVIACETQVRAARA-GLDNLIIPE---EKAIQRAFRNSRNTNSLKR--NGTVDWRVGELEWESWMRVLDHANFQTGHVYR 371          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. UniProt/SwissProt
Match: sp|Q9UEY8|ADDG_HUMAN (Gamma-adducin OS=Homo sapiens OX=9606 GN=ADD3 PE=1 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 1.204e-9
Identity = 62/279 (22.22%), Postives = 116/279 (41.58%), Query Frame = 1
Query:  109 LNILYKIGFKENWFNGENIFISMRKASSRVFTINAPK-----EIDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQFDFLEFCREFSE------IFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMK-LGKCIHSENVIVPDIETQKNVLKQFKGSISSTLMLNNPNDNVEWLPGQLEFEALMRDFEYNESSSGYDFK 909
            L  LY++     W +  N +IS+R +  +   I  P+     E   + L  ++I  E VD    N+      F  H  I+++    D +C++ I+++    VS    G+ P+SQES  +   ++  +D+     E  E      + G  C+                      + +L+N G    G+T+EE +   +    AC+ Q++ L      +N+ V D +  K        S    + + +   + +W  G++EFE LMR  +     +GY ++
Sbjct:  141 LASLYRLVDLFGWAHLANTYISVRISKEQDHIIIIPRGLSFSEATASNLVKVNIIGEVVDQGSTNLKIDHTGFSPHAAIYSTRP--DVKCVIHIHTLATAAVSSMKCGILPISQESLLLG--DVAYYDYQGSLEEQEERIQLQKVLGPSCK----------------------VLVLRNHGVVALGETLEEAFHYIFNVQLACEIQVQALAGAGGVDNLHVLDFQKYKAFTYTVAASGGGGVNMGS---HQKWKVGEIEFEGLMRTLDNLGYRTGYAYR 390          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. TrEMBL
Match: A0A1S8WUF2 (Class II Aldolase and Adducin domain protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_06178 PE=4 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 3.317e-17
Identity = 57/210 (27.14%), Postives = 103/210 (49.05%), Query Frame = 1
Query:  310 FLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQFDFLEFCREFSEIFGSHCEEMIIKCLFKYQGIFNQILSKNN---IFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMKLGKCIHSENVIVPDIETQKNVLKQFKGSISSTLMLNNPNDNV---EWLPGQLEFEALMRDFEYNESSSGYDFKIKSI 921
            +++H  +H  ++  D RCI+ +N+   I VS T+ GL P+SQE+  +  + ++    L       +           +C  + Q I   + +++    + ++KN G    G+TIEE WF  +    AC+ Q++L   I  + +I+P  E Q+     + G   S + L  P +NV    W  G+LEFEA+MR  +     +G+ +++  I
Sbjct:  204 WMLHAAVH--EARPDVRCIIHLNTPATIAVSCTNSGLLPISQEAMILGETAVYDPSGLALTNGQGDSSEDPTARRERRCSEERQAIAAILKAQSQDCMLLMIKNHGLLAMGQTIEEAWFVAFTAIVACEAQLRLA-SISPDELILPVKEAQQAA--HYVGRAPSAVQL-RPGENVGSSGWRRGELEFEAMMRRLDAAGYHTGHVYRLAQI 407          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. TrEMBL
Match: G7Y430 (Protein hu-li tai shao OS=Clonorchis sinensis OX=79923 GN=CLF_100716 PE=4 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 4.327e-17
Identity = 57/210 (27.14%), Postives = 103/210 (49.05%), Query Frame = 1
Query:  310 FLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQFDFLEFCREFSEIFGSHCEEMIIKCLFKYQGIFNQILSKNN---IFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMKLGKCIHSENVIVPDIETQKNVLKQFKGSISSTLMLNNPNDNV---EWLPGQLEFEALMRDFEYNESSSGYDFKIKSI 921
            +++H  +H  ++  D RCI+ +N+   I VS T+ GL P+SQE+  +  + ++    L       +           +C  + Q I   + +++    + ++KN G    G+TIEE WF  +    AC+ Q++L   I  + +I+P  E Q+     + G   S + L  P +NV    W  G+LEFEA+MR  +     +G+ +++  I
Sbjct:  113 WMLHAAVH--EARPDVRCIIHLNTPATIAVSCTNSGLLPISQEAMILGETAVYDPSGLAMTNGQGDSSEDPTARRERRCSEERQAIAAILKAQSQDCMLLMIKNHGLLAMGQTIEEAWFVAFTAIVACEAQLRLA-SISPDELILPVKEAQQAA--HYVGRAPSAVQL-RPGENVGSSGWRRGELEFEAMMRRLDAAGYHTGHVYRLAQI 316          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. TrEMBL
Match: A0A419PIF1 (Protein hu-li tai shao (Fragment) OS=Clonorchis sinensis OX=79923 GN=hts PE=4 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 4.812e-17
Identity = 57/210 (27.14%), Postives = 103/210 (49.05%), Query Frame = 1
Query:  310 FLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQFDFLEFCREFSEIFGSHCEEMIIKCLFKYQGIFNQILSKNN---IFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMKLGKCIHSENVIVPDIETQKNVLKQFKGSISSTLMLNNPNDNV---EWLPGQLEFEALMRDFEYNESSSGYDFKIKSI 921
            +++H  +H  ++  D RCI+ +N+   I VS T+ GL P+SQE+  +  + ++    L       +           +C  + Q I   + +++    + ++KN G    G+TIEE WF  +    AC+ Q++L   I  + +I+P  E Q+     + G   S + L  P +NV    W  G+LEFEA+MR  +     +G+ +++  I
Sbjct:  176 WMLHAAVH--EARPDVRCIIHLNTPATIAVSCTNSGLLPISQEAMILGETAVYDPSGLAMTNGQGDSSEDPTARRERRCSEERQAIAAILKAQSQDCMLLMIKNHGLLAMGQTIEEAWFVAFTAIVACEAQLRLAS-ISPDELILPVKEAQQAA--HYVGRAPSAVQL-RPGENVGSSGWRRGELEFEAMMRRLDAAGYHTGHVYRLAQI 379          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. TrEMBL
Match: A0A564YZ88 (Aldolase_II domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS11079 PE=4 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 4.921e-17
Identity = 54/234 (23.08%), Postives = 110/234 (47.01%), Query Frame = 1
Query:  220 EIDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQFDFLEFCREFSEIFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMKLGKCIHSENVIVPDIETQKNVLKQFKGSISSTLMLNNPNDNVEWLPGQLEFEALMRDFEYNESSSGYDFKIKSI 921
            EI  + L  +DI    +D     +      +++H  +H  +++   RC++ +N+   I +S    GL P+SQE+  + G+  +    ++   +  E   +     I +CL    G   +IL      +++  G    GK++EE W   Y+   AC+ Q++L  C+ S+ +++P   T   +    +  +++T        +  W PG+LEFEA+MR  +     +G+ +++  +
Sbjct:  171 EITASSLLKVDIKGTIIDGGSNGLGIDKQGWMLHAAVH--EALPVIRCVIQLNTPPTIAISCMKSGLPPISQEAMMLGGAATYDPSSIDQHLQGEERNAAETA-AIAECLRSTAGGDPRIL------IIRKYGILAMGKSVEEAWMAAYLAVSACEAQLRLA-CVGSDELVMP---TAGEIGNNHQAMMNATTGGQGSTTDRNWRPGELEFEAMMRRLDAAGYHTGHFYRVGQV 391          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. TrEMBL
Match: A0A423TVY7 (Protein hu-li tai shao OS=Penaeus vannamei OX=6689 GN=C7M84_000625 PE=4 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 6.099e-17
Identity = 69/246 (28.05%), Postives = 105/246 (42.68%), Query Frame = 1
Query:  220 EIDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQFDFLEFCREFSEIFGSHCEEMIIKCLFKYQGIF-----NQILSK-----NNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMKLGKCIHSENVIVPDIETQK--NVLKQFKGSISSTLMLNNP----NDNVEWLPGQLEFEALMRDFEYNESSSGYDFK 909
            E+    L  +D+    VD    N    VA F++H  IH +    D +C++ ++   V+ VS    GL P+SQE+  +   E+   D                          YQGIF      + L++     N I LL+N G    G+T+EE W+N Y    AC+TQM++        V+V D   Q    V ++  G + S      P        +W  G+LEFEALMR  +     +GY ++
Sbjct:  178 EVTAASLVKVDMQGNVVDGGATNFGVNVAGFMLHSAIHAARP--DLKCVIHLHHPAVVAVSALKQGLMPLSQEALLIG--EVSYHD--------------------------YQGIFVNAEEKEKLARNLGPVNKILLLRNHGVVCCGETVEEAWYNTYHTVLACETQMRMAPLGLDNLVVVTDEARQAAYEVARRGGGGVDSK-QEGGPAAQGQKERKWKVGELEFEALMRSLDNAGLRTGYIYR 392          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Cavefish
Match: add3a (adducin 3 (gamma) a [Source:ZFIN;Acc:ZDB-GENE-030131-2721])

HSP 1 Score: 66.2402 bits (160), Expect = 1.316e-11
Identity = 57/203 (28.08%), Postives = 92/203 (45.32%), Query Frame = 1
Query:  304 ASFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQFDFLEFCREFSEIFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMKLGKCIHS-ENVIVPDIETQKNVLKQFKGSISSTLMLNNPNDNVEWLPGQLEFEALMRDFEYNESSSGYDFK 909
            A F  H  I++     D RCI+ I++     VS    GL P+SQE+  +     F +             GS  E+     L K  G   ++L      +L+N G    G+TIEE +   Y    AC+ Q+    C    EN+IV D+E  ++   + +G   + + + + N   +W  G+LEFE+LMR  +     +GY ++
Sbjct:  205 AGFSPHAAIYSMRP--DVRCIVHIHTPVTAAVSSMKCGLLPISQEALILGDIAYFNYQ------------GSLDEQEERVELQKALGPSAKVL------VLRNHGVVALGETIEEAFHYIYTAQLACEIQVNAFSCAGGVENLIVLDLEKYRS---RTQGVAQTGVNMASQN---KWKIGELEFESLMRMLDNLGYRTGYAYR 381          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Cavefish
Match: add2 (adducin 2 [Source:NCBI gene;Acc:103036061])

HSP 1 Score: 61.2326 bits (147), Expect = 5.621e-10
Identity = 57/248 (22.98%), Postives = 96/248 (38.71%), Query Frame = 1
Query:  220 EIDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQFDFLEFCRE------FSEIFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMKLGKCIHSE-NVIVPDIETQKNVLKQFKGSISSTLMLNNPNDNVEWL-----P------GQLEFEALMRDFEYNESSSGYDFK 909
            E+  + L  ++I  E V+     +   + +F +H  I+++    D RC+L +++     VS    GL P+S E+  V   E+  +D+     E        +  G  C+                      + +L+N G    G+++EE ++  Y    ACQ Q+    C   E N+I+ D                 T    NP   V W      P      G+ EFEALMR  +     +GY ++
Sbjct:  169 EVTASNLVKVNILGEVVERGSTTLGVDLPTFSLHSAIYSARP--DVRCLLHLHTPATAAVSAMKCGLLPLSHEALLVG--EVAYYDYNGVMEEEEDRVDLQKSLGPTCK----------------------VLVLRNHGIVALGESVEEAFYTIYHIQSACQIQVSALCCAGGEQNLILLD----------------RTAHRANPTGTVGWAGSTFGPMHKSRLGEHEFEALMRTLDNLGYRTGYAYR 374          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Cavefish
Match: add2 (adducin 2 [Source:NCBI gene;Acc:103036061])

HSP 1 Score: 61.2326 bits (147), Expect = 6.413e-10
Identity = 56/248 (22.58%), Postives = 96/248 (38.71%), Query Frame = 1
Query:  220 EIDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQFDFLEFCRE------FSEIFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMKLGKCIHSE-NVIVPDIETQKNVLKQFKGSISSTLMLNNPNDNVEWL-----P------GQLEFEALMRDFEYNESSSGYDFK 909
            E+  + L  ++I  E V+     +   + +F +H  I+++    D RC+L +++     VS    GL P+S E+  V   E+  +D+     E        +  G  C+                      + +L+N G    G+++EE ++  Y    ACQ Q+    C   E N+I+                +  T    NP   V W      P      G+ EFEALMR  +     +GY ++
Sbjct:  169 EVTASNLVKVNILGEVVERGSTTLGVDLPTFSLHSAIYSARP--DVRCLLHLHTPATAAVSAMKCGLLPLSHEALLVG--EVAYYDYNGVMEEEEDRVDLQKSLGPTCK----------------------VLVLRNHGIVALGESVEEAFYTIYHIQSACQIQVSALCCAGGEQNLIL----------------LDRTAHRANPTGTVGWAGSTFGPMHKSRLGEHEFEALMRTLDNLGYRTGYAYR 374          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Cavefish
Match: add1 (adducin 1 (alpha) [Source:ZFIN;Acc:ZDB-GENE-030909-2])

HSP 1 Score: 59.6918 bits (143), Expect = 2.004e-9
Identity = 52/235 (22.13%), Postives = 102/235 (43.40%), Query Frame = 1
Query:  220 EIDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQFDFLEFCREFSEIFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMK-LGKCIHSENVIVPDIETQKNVLKQFKGSISSTLMLNNPNDNVEWLPGQLEFEALMRDFEYNESSSGYDFKIKSI 921
            E+  + L  +++  E VD    N+    A F +H  I+ +    D +CI+ I++     VS    GL P+S E+  +   E+   D       +  I     E ++I+           +   + + +L+N G    G+T+EE ++  +    AC+ Q++ L      +N+++ D    K   +  +     T        +++W  G+ EFEALMR  +     +GY ++  ++
Sbjct:  180 EVSASSLVKINLQGEIVDRGSTNLGVNQAGFTLHSAIYAARP--DVKCIVHIHTPAGAAVSAMKCGLLPISPEALSLG--EVAYHD-------YHGILVDEEENVLIQ---------KNLGPTSKVLILRNHGLVSVGETVEEAFYYIHNLVRACEIQVRTLASAGGPDNLVMLDPAKYKARSRHPEPVGDGT--------SLKWQIGEQEFEALMRMLDNLGYRTGYPYRCPAL 386          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Cavefish
Match: add1 (adducin 1 (alpha) [Source:ZFIN;Acc:ZDB-GENE-030909-2])

HSP 1 Score: 58.5362 bits (140), Expect = 4.249e-9
Identity = 52/235 (22.13%), Postives = 102/235 (43.40%), Query Frame = 1
Query:  220 EIDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQFDFLEFCREFSEIFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMK-LGKCIHSENVIVPDIETQKNVLKQFKGSISSTLMLNNPNDNVEWLPGQLEFEALMRDFEYNESSSGYDFKIKSI 921
            E+  + L  +++  E VD    N+    A F +H  I+ +    D +CI+ I++     VS    GL P+S E+  +   E+   D       +  I     E ++I+           +   + + +L+N G    G+T+EE ++  +    AC+ Q++ L      +N+++ D    K   +  +     T        +++W  G+ EFEALMR  +     +GY ++  ++
Sbjct:  141 EVSASSLVKINLQGEIVDRGSTNLGVNQAGFTLHSAIYAARP--DVKCIVHIHTPAGAAVSAMKCGLLPISPEALSLG--EVAYHD-------YHGILVDEEENVLIQ---------KNLGPTSKVLILRNHGLVSVGETVEEAFYYIHNLVRACEIQVRTLASAGGPDNLVMLDPAKYKARSRHPEPVGDGT--------SLKWQIGEQEFEALMRMLDNLGYRTGYPYRCPAL 347          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Sea Lamprey
Match: add1 (adducin 1 (alpha) [Source:ZFIN;Acc:ZDB-GENE-030909-2])

HSP 1 Score: 60.8474 bits (146), Expect = 1.364e-10
Identity = 55/235 (23.40%), Postives = 101/235 (42.98%), Query Frame = 1
Query:  220 EIDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQFDFLEFCREFSEIFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMK-LGKCIHSENVIVPDIETQKNVLKQFKGSISSTLMLNNPNDNVE----WLPGQLEFEALMRDFEYNESSSGYDFK 909
            E+  + L  +++  E VD    N+    A F +H  I+ +    D +C++ +++     VS    GL P+SQES  +   E+   D+                E I+    +   +   +   + + +L+N G    G+T+EE +   Y    AC+ Q++ L      +NVI+ D E         K  + +  ++ + N N+     W  G+ E EALMR  +     +GY ++
Sbjct:  191 EVTASSLVKVNLQGEIVDRGSTNLGINQAGFTLHSAIYAARP--DIKCVIHVHTPAGTAVSAMKCGLLPISQESMILG--EVTYHDY----------------EGILVDDEEKANLQKNLGPTSKVLILRNHGLVALGETVEEAFHYLYNLVMACEVQVRTLASAGSVDNVILLDEE---------KLRVRTQGIVTHGNVNMAGLHTWGVGEQELEALMRMMDSMGYRTGYAYR 396          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Nematostella
Match: EDO42734 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0I1])

HSP 1 Score: 66.2402 bits (160), Expect = 2.507e-12
Identity = 52/218 (23.85%), Postives = 98/218 (44.95%), Query Frame = 1
Query:  220 EIDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQFDFLEFCREFSEIFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMKLGKCIHSENVIVPDIETQKNVLKQFKGSISSTLMLNNPNDN--VEWLPGQLEFEALMR 867
            E+  + L  +D     VD    N+    A  ++H  +H++    D  C++ I+    + V+ T++G+ P++QE+  +   EI   DF     + +E                   I N++  K+ + +L+N G  + G TIEE +   ++   +C+ Q++       +N+I    + ++ VL+   G         N  D+   +W  G+LEFEA MR
Sbjct:  134 EVTASSLVKVDFAGNIVDGGSTNLGVNRAGLVLHSAVHSAR--KDIACVIHIHQPACVAVASTEYGILPITQEASMLG--EIAYHDFRGILLDENE----------------KDAIINELGEKSKVMVLRNHGMVIAGDTIEEAFMLAHMCVLSCEYQVR-AMSAGVDNLIKVSEQVREKVLEVTGG--------ENITDSKGSKWKHGELEFEAWMR 322          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Nematostella
Match: EDO42733 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0I0])

HSP 1 Score: 64.6994 bits (156), Expect = 1.221e-11
Identity = 59/273 (21.61%), Postives = 114/273 (41.76%), Query Frame = 1
Query:  118 LYKIGFKENWFNG--ENIFISMRKASSRVFTINAP-----KEIDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQFDFLEFCREFSEIFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMKLGKCIHSENVIVPDIETQKNVLKQFKGSISSTLMLNNPNDNVEWLPGQLEFEALMRDFEYNESSSGYDFKIK 915
            +Y++    NW      N+  + R      + +  P      E+    L  MD    T++    N+     +  IH  ++   S  D  C++ + S NV  VS  D G+ P+S E+  + G  ++                 H    I+    + + +  ++ + + + +L+NMGA   GK++EE ++N ++   AC+ Q    +     N+I  D E ++ + K  +         ++ N N   +   + FEA MR  +     +GY+F I+
Sbjct:  236 VYRLADSFNWLTDMESNVLCTARATDDDYYYLTPPLGLLAGEVSAGCLYKMDQEGNTIEEGNTNLTVNKIALEIHSQVYGCKS--DVNCVVVLCSTNVKAVSAMDCGVLPISHEAAAI-GEIVY-----------------HTLGSIVLDKAEKEALTLKLSAVDKVLVLRNMGAVCVGKSVEEAFYNAFLLHKACENQAYAVRA-GINNLIKLDDEVREKIYKSVQEG-------DDVNQNKRKV-ADVHFEAWMRMLDARGHKTGYEFSIQ 479          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Medaka
Match: add3a (gamma-adducin [Source:NCBI gene;Acc:101164133])

HSP 1 Score: 65.0846 bits (157), Expect = 3.334e-11
Identity = 64/277 (23.10%), Postives = 118/277 (42.60%), Query Frame = 1
Query:  109 LNILYKIGFKENWFNGENIFISMRKASSRVFTINAPK-----EIDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQF----DFLEFCREFSEIFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMKLGKCIHS-ENVIVPDIETQKNVLKQFKGSISSTLMLNNPNDNVEWLPGQLEFEALMRDFEYNESSSGYDFK 909
            L  LY++     W +  N +I+ R +  +   +  P+     E   + L  ++I  + +D    +++   + F  H  I++     D RCI+ +++     VS    G+ P+SQE+  +     + +    D  E  RE  +  G   +                      + +L+N G    G+T+EE +   Y   YAC+ Q+    C    EN+IV D E  ++  + F  +++S   +N       W  G+LEFE+LMR  +     +GY ++
Sbjct:  141 LASLYRLVDLFGWAHFANSYITGRVSKEQDHILIIPRGLSFAEASASNLVKVNIIGDVIDQGSTSLSINSSGFSPHAAIYSMRP--DIRCIIHVHTPAAAAVSSMKCGILPISQEALILGDIAYYTYHGSLDDQEERRELQKALGPTAK----------------------VLVLRNHGVVALGETMEEAFHYIYNAQYACEIQVNAISCAGGVENLIVLDQEKYRS--RVF--AVASAAAINMAG-QYRWKIGELEFESLMRMLDNLGYRTGYTYR 388          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Medaka
Match: add3a (gamma-adducin [Source:NCBI gene;Acc:101164133])

HSP 1 Score: 64.3142 bits (155), Expect = 6.326e-11
Identity = 64/277 (23.10%), Postives = 118/277 (42.60%), Query Frame = 1
Query:  109 LNILYKIGFKENWFNGENIFISMRKASSRVFTINAPK-----EIDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQF----DFLEFCREFSEIFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMKLGKCIHS-ENVIVPDIETQKNVLKQFKGSISSTLMLNNPNDNVEWLPGQLEFEALMRDFEYNESSSGYDFK 909
            L  LY++     W +  N +I+ R +  +   +  P+     E   + L  ++I  + +D    +++   + F  H  I++     D RCI+ +++     VS    G+ P+SQE+  +     + +    D  E  RE  +  G   +                      + +L+N G    G+T+EE +   Y   YAC+ Q+    C    EN+IV D E  ++  + F  +++S   +N       W  G+LEFE+LMR  +     +GY ++
Sbjct:  141 LASLYRLVDLFGWAHFANSYITGRVSKEQDHILIIPRGLSFAEASASNLVKVNIIGDVIDQGSTSLSINSSGFSPHAAIYSMRP--DIRCIIHVHTPAAAAVSSMKCGILPISQEALILGDIAYYTYHGSLDDQEERRELQKALGPTAK----------------------VLVLRNHGVVALGETMEEAFHYIYNAQYACEIQVNAISCAGGVENLIVLDQEKYRS--RVF--AVASAAAINMAG-QYRWKIGELEFESLMRMLDNLGYRTGYTYR 388          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Medaka
Match: add3a (gamma-adducin [Source:NCBI gene;Acc:101164133])

HSP 1 Score: 63.929 bits (154), Expect = 6.894e-11
Identity = 64/277 (23.10%), Postives = 118/277 (42.60%), Query Frame = 1
Query:  109 LNILYKIGFKENWFNGENIFISMRKASSRVFTINAPK-----EIDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQF----DFLEFCREFSEIFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMKLGKCIHS-ENVIVPDIETQKNVLKQFKGSISSTLMLNNPNDNVEWLPGQLEFEALMRDFEYNESSSGYDFK 909
            L  LY++     W +  N +I+ R +  +   +  P+     E   + L  ++I  + +D    +++   + F  H  I++     D RCI+ +++     VS    G+ P+SQE+  +     + +    D  E  RE  +  G   +                      + +L+N G    G+T+EE +   Y   YAC+ Q+    C    EN+IV D E  ++  + F  +++S   +N       W  G+LEFE+LMR  +     +GY ++
Sbjct:  141 LASLYRLVDLFGWAHFANSYITGRVSKEQDHILIIPRGLSFAEASASNLVKVNIIGDVIDQGSTSLSINSSGFSPHAAIYSMRP--DIRCIIHVHTPAAAAVSSMKCGILPISQEALILGDIAYYTYHGSLDDQEERRELQKALGPTAK----------------------VLVLRNHGVVALGETMEEAFHYIYNAQYACEIQVNAISCAGGVENLIVLDQEKYRS--RVF--AVASAAAINMAG-QYRWKIGELEFESLMRMLDNLGYRTGYTYR 388          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Medaka
Match: add3b (gamma-adducin [Source:NCBI gene;Acc:101170613])

HSP 1 Score: 62.7734 bits (151), Expect = 1.638e-10
Identity = 62/287 (21.60%), Postives = 123/287 (42.86%), Query Frame = 1
Query:   79 SKSDLEFDLNLNILYKIGFKENWFNGENIFISMRKASSRVFTINAPK-----EIDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQF----DFLEFCREFSEIFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMKLGKCI-HSENVIVPDIETQKNVLKQFKGSISSTLMLNNPNDNVEWLPGQLEFEALMRDFEYNESSSGYDFK 909
            +K + +    L  LY++    NW    + +I++R +  +   + +P+     E+    L  ++I  E VD     +      F  H  I++     D RCI+ I++     VS    G+ P+SQE+  +     + +    D  E   EF +  G                        + + +L N G    G+T+EE +   Y    AC+ Q+   +C  +++N+ + D +  K +    +G  ++ ++++N    V+W  G+ EFE+L+R  +     +GY ++
Sbjct:  132 AKGEKQSRCKLASLYRLVDLFNWARFTSAYITVRVSKEQDHILISPRGLSFAEVTAANLVKVNIVGEVVDQGSTELGIDHFGFAPHAAIYSMRP--DVRCIIHIHTPATTAVSSMKCGILPISQEALLLGDVSCYGYHGSLDNKEEMVEFQKALGP----------------------TSKVMMLSNHGLLALGETVEEAFHYVYHSQLACEIQVHSLRCSGNADNLTLLDRQKFKPLT---QGVAAAGVVIDN---EVKWKVGEAEFESLLRMLDNLGYRTGYAYR 388          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Medaka
Match: add3b (gamma-adducin [Source:NCBI gene;Acc:101170613])

HSP 1 Score: 62.7734 bits (151), Expect = 1.638e-10
Identity = 62/287 (21.60%), Postives = 123/287 (42.86%), Query Frame = 1
Query:   79 SKSDLEFDLNLNILYKIGFKENWFNGENIFISMRKASSRVFTINAPK-----EIDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQF----DFLEFCREFSEIFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMKLGKCI-HSENVIVPDIETQKNVLKQFKGSISSTLMLNNPNDNVEWLPGQLEFEALMRDFEYNESSSGYDFK 909
            +K + +    L  LY++    NW    + +I++R +  +   + +P+     E+    L  ++I  E VD     +      F  H  I++     D RCI+ I++     VS    G+ P+SQE+  +     + +    D  E   EF +  G                        + + +L N G    G+T+EE +   Y    AC+ Q+   +C  +++N+ + D +  K +    +G  ++ ++++N    V+W  G+ EFE+L+R  +     +GY ++
Sbjct:  132 AKGEKQSRCKLASLYRLVDLFNWARFTSAYITVRVSKEQDHILISPRGLSFAEVTAANLVKVNIVGEVVDQGSTELGIDHFGFAPHAAIYSMRP--DVRCIIHIHTPATTAVSSMKCGILPISQEALLLGDVSCYGYHGSLDNKEEMVEFQKALGP----------------------TSKVMMLSNHGLLALGETVEEAFHYVYHSQLACEIQVHSLRCSGNADNLTLLDRQKFKPLT---QGVAAAGVVIDN---EVKWKVGEAEFESLLRMLDNLGYRTGYAYR 388          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Planmine SMEST
Match: SMESG000027670.1 (SMESG000027670.1)

HSP 1 Score: 213.772 bits (543), Expect = 4.626e-70
Identity = 100/104 (96.15%), Postives = 100/104 (96.15%), Query Frame = 1
Query:  613 MGAFVTGKTIEETWFNCYIFDYACQTQMKLGKCIHSENVIVPDIETQKNVLKQFKGSISSTLMLNNPNDNVEWLPGQLEFEALMRDFEYNESSSGYDFKIKSIW 924
            MGAFVTGKTIEETWFNCYIFDYACQTQMKLGKCIHSENVIVP IE QKNVLKQFKG ISSTLMLNNPNDNVEWLPGQLEFEALMRD EYNESSSGYDFKIKSIW
Sbjct:    1 MGAFVTGKTIEETWFNCYIFDYACQTQMKLGKCIHSENVIVPGIEAQKNVLKQFKGGISSTLMLNNPNDNVEWLPGQLEFEALMRDLEYNESSSGYDFKIKSIW 104          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Planmine SMEST
Match: SMESG000027664.1 (SMESG000027664.1)

HSP 1 Score: 213.772 bits (543), Expect = 7.939e-70
Identity = 108/111 (97.30%), Postives = 108/111 (97.30%), Query Frame = 1
Query:   73 MLSKSDLEFDLNLNILYKIGFKENWFNGENIFISMRKASSRVFTINAPKEIDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSK 405
            MLSKSDLEFDLNLNILYKIGFKENWFNGENIFISMRKASSRVFTIN PKEIDKN LKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEV K
Sbjct:    1 MLSKSDLEFDLNLNILYKIGFKENWFNGENIFISMRKASSRVFTINVPKEIDKNLLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVGK 111          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Planmine SMEST
Match: SMESG000040577.1 (SMESG000040577.1)

HSP 1 Score: 211.846 bits (538), Expect = 4.468e-69
Identity = 109/113 (96.46%), Postives = 110/113 (97.35%), Query Frame = 1
Query:   73 MLSKSDLEFDLNLNILYKIGFKENWFNGENIFISMRKASSRVFTINAPKEIDKN--QLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSK 405
            MLSKSDLEFDLNLNILYKIGFKENWFNGENIFISMRKASSRVFTINAPKEIDKN  +LKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEV K
Sbjct:    1 MLSKSDLEFDLNLNILYKIGFKENWFNGENIFISMRKASSRVFTINAPKEIDKNLLKLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVGK 113          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Planmine SMEST
Match: SMESG000044944.1 (SMESG000044944.1)

HSP 1 Score: 209.92 bits (533), Expect = 4.447e-66
Identity = 111/271 (40.96%), Postives = 164/271 (60.52%), Query Frame = 1
Query:  118 LYKIGFKENWFNGENIFISMRKASSRVFTI-NAPK-EIDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQFDFLEFCREFSEIFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIFDYACQTQMKLGKCIHSENVIVPDIETQKNVLKQFKGSISSTLMLNNPNDNVEWLPGQLEFEALMRDFEYNESSSGYDFKIKSIW 924
            L+KIG  +NWF GE IFIS++ + ++ F I N PK + D N   F+ +N++    +  ++     SFLIHFL+ N+    + +C L IN  +V+++S+   GL P+SQES  +   EI + +F EF  EF   F S  E+ I   L KYQ   N  + KNN   +KN+G  VTG+TIEE WF   +  YAC+TQ+KL  CIHS+N++ P  E++  +        S+ +++NN    + WL G+LEFEA MR  EY++  +GYDFK+K+IW
Sbjct:   16 LHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNNPKIKSDNNPSNFLKLNLDNFPTELNSI-----SFLIHFLVQNTV---NCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYEFVNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFIKNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKNIVFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFKLKNIW 278          
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Planmine SMEST
Match: SMESG000012838.1 (SMESG000012838.1)

HSP 1 Score: 80.1073 bits (196), Expect = 2.922e-16
Identity = 61/219 (27.85%), Postives = 112/219 (51.14%), Query Frame = 1
Query:  307 SFLIHFLIHNSDSINDARCILFINSINVIEVSKTDHGLFPVSQESFFVNGSEIFQFDFLEFCREFSEIFGSHCEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETW---FNCYIFDYACQTQMKLGKCIHSENVIVPDIETQKNVLKQFK----GSISSTLMLNNPNDNVEWLP------GQLEFEALMRDFEYNESSSGYDFKIKSIW 924
            +++IH  I++    +  R IL + +   + +S  +HGL P+ +E+  + GS +   +   F  E   I       +I+  L  Y  + + I+  + I ++ N G  + G+ IEE W    NC I   AC+TQMKLG  +  +++ +PD   Q ++  Q++    G ++   + +   +N E +P      G+LEFEALMR  + N   +GY ++ ++I+
Sbjct:  206 AWMIHSAIYSCQ--HSIRAILELKTPAALAISSLEHGLLPICREAILL-GSTVILDNLPGFVSESKSI------SLIMTDLNNY--LTSVIVPNSKILIVPNCGFLICGEHIEEAWHLLMNCQI---ACETQMKLGN-LTIDDLYIPDKNCQADLFHQWRSTDLGGVTKIEIDSVSYENSEHVPQAQWRIGELEFEALMRHMDNNGYRTGYMYRQENIY 409          
The following BLAST results are available for this feature:
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ADD31.626e-1022.58adducin 3 [Source:HGNC Symbol;Acc:HGNC:245][more]
ADD31.626e-1022.58adducin 3 [Source:HGNC Symbol;Acc:HGNC:245][more]
ADD32.508e-1022.22adducin 3 [Source:HGNC Symbol;Acc:HGNC:245][more]
ADD13.556e-923.48adducin 1 [Source:HGNC Symbol;Acc:HGNC:243][more]
ADD14.424e-922.13adducin 1 [Source:HGNC Symbol;Acc:HGNC:243][more]
back to top
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
add-22.624e-1423.01Adducin-related protein 2 [Source:UniProtKB/Swiss... [more]
add-21.905e-1324.66Adducin-related protein 2 [Source:UniProtKB/Swiss... [more]
add-21.905e-1324.66Adducin-related protein 2 [Source:UniProtKB/Swiss... [more]
add-21.905e-1324.66Adducin-related protein 2 [Source:UniProtKB/Swiss... [more]
add-15.285e-1125.12Adducin-related protein 1 [Source:UniProtKB/Swiss... [more]
back to top
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
add3a1.129e-1325.26adducin 3 (gamma) a [Source:ZFIN;Acc:ZDB-GENE-0301... [more]
add3a1.129e-1325.26adducin 3 (gamma) a [Source:ZFIN;Acc:ZDB-GENE-0301... [more]
add3a1.866e-1325.44adducin 3 (gamma) a [Source:ZFIN;Acc:ZDB-GENE-0301... [more]
add3a2.026e-1325.44adducin 3 (gamma) a [Source:ZFIN;Acc:ZDB-GENE-0301... [more]
add3a2.026e-1325.44adducin 3 (gamma) a [Source:ZFIN;Acc:ZDB-GENE-0301... [more]
back to top
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
add12.111e-1123.83adducin 1 [Source:NCBI gene;Acc:448173][more]
add12.726e-1123.83adducin 1 [Source:NCBI gene;Acc:448173][more]
add13.082e-1123.83adducin 1 [Source:NCBI gene;Acc:448173][more]
add14.475e-1123.83adducin 1 [Source:NCBI gene;Acc:448173][more]
add16.018e-1123.83adducin 1 [Source:NCBI gene;Acc:448173][more]
back to top
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Add33.493e-1122.06adducin 3 (gamma) [Source:MGI Symbol;Acc:MGI:13516... [more]
Add33.493e-1122.06adducin 3 (gamma) [Source:MGI Symbol;Acc:MGI:13516... [more]
Add33.493e-1122.06adducin 3 (gamma) [Source:MGI Symbol;Acc:MGI:13516... [more]
Add33.493e-1122.06adducin 3 (gamma) [Source:MGI Symbol;Acc:MGI:13516... [more]
Add33.493e-1122.06adducin 3 (gamma) [Source:MGI Symbol;Acc:MGI:13516... [more]
back to top
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q20952|ADD2_CAEEL2.423e-1224.66Adducin-related protein 2 OS=Caenorhabditis elegan... [more]
sp|Q62847|ADDG_RAT8.511e-1122.06Gamma-adducin OS=Rattus norvegicus OX=10116 GN=Add... [more]
sp|Q9QYB5|ADDG_MOUSE4.396e-1022.06Gamma-adducin OS=Mus musculus OX=10090 GN=Add3 PE=... [more]
sp|Q9U9K0|ADD1_CAEEL1.039e-925.12Adducin-related protein 1 OS=Caenorhabditis elegan... [more]
sp|Q9UEY8|ADDG_HUMAN1.204e-922.22Gamma-adducin OS=Homo sapiens OX=9606 GN=ADD3 PE=1... [more]
back to top
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S8WUF23.317e-1727.14Class II Aldolase and Adducin domain protein (Frag... [more]
G7Y4304.327e-1727.14Protein hu-li tai shao OS=Clonorchis sinensis OX=7... [more]
A0A419PIF14.812e-1727.14Protein hu-li tai shao (Fragment) OS=Clonorchis si... [more]
A0A564YZ884.921e-1723.08Aldolase_II domain-containing protein OS=Hymenolep... [more]
A0A423TVY76.099e-1728.05Protein hu-li tai shao OS=Penaeus vannamei OX=6689... [more]
back to top
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
add3a1.316e-1128.08adducin 3 (gamma) a [Source:ZFIN;Acc:ZDB-GENE-0301... [more]
add25.621e-1022.98adducin 2 [Source:NCBI gene;Acc:103036061][more]
add26.413e-1022.58adducin 2 [Source:NCBI gene;Acc:103036061][more]
add12.004e-922.13adducin 1 (alpha) [Source:ZFIN;Acc:ZDB-GENE-030909... [more]
add14.249e-922.13adducin 1 (alpha) [Source:ZFIN;Acc:ZDB-GENE-030909... [more]
back to top
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
add11.364e-1023.40adducin 1 (alpha) [Source:ZFIN;Acc:ZDB-GENE-030909... [more]
back to top
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO427342.507e-1223.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO427331.221e-1121.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
add3a3.334e-1123.10gamma-adducin [Source:NCBI gene;Acc:101164133][more]
add3a6.326e-1123.10gamma-adducin [Source:NCBI gene;Acc:101164133][more]
add3a6.894e-1123.10gamma-adducin [Source:NCBI gene;Acc:101164133][more]
add3b1.638e-1021.60gamma-adducin [Source:NCBI gene;Acc:101170613][more]
add3b1.638e-1021.60gamma-adducin [Source:NCBI gene;Acc:101170613][more]
back to top
BLAST of Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000027670.14.626e-7096.15SMESG000027670.1[more]
SMESG000027664.17.939e-7097.30SMESG000027664.1[more]
SMESG000040577.14.468e-6996.46SMESG000040577.1[more]
SMESG000044944.14.447e-6640.96SMESG000044944.1[more]
SMESG000012838.12.922e-1627.85SMESG000012838.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30036007 ID=SMED30036007|Name=Ribulose-5-phosphate 4-epimerase/Fuculose-1-phosphate aldolase|organism=Schmidtea mediterranea sexual|type=transcript|length=1010bp
TTTTAAATTACATTGAAATTATTTGTATGAATTAATAAATATATTTTTTG
AAATTTAACATTCAAATTTATTATGCTGTCCAAAAGTGATTTGGAATTCG
ATTTAAATTTGAATATTTTATACAAAATAGGATTTAAAGAGAATTGGTTC
AATGGTGAAAATATATTTATTAGTATGAGAAAGGCGAGTTCCCGTGTTTT
CACAATCAATGCTCCCAAAGAAATCGACAAAAACCAATTAAAATTCATGG
ACATAAATATGGAAACTGTTGATTTAGATTTTCAAAATGTTAACAATTAT
GTAGCATCATTTTTGATCCACTTCCTAATCCACAATTCCGACAGCATTAA
TGATGCCAGGTGCATTCTGTTTATAAATAGCATCAACGTTATAGAGGTTT
CAAAAACTGATCACGGTTTATTTCCTGTTAGCCAAGAATCGTTTTTCGTT
AATGGTAGTGAAATTTTTCAATTCGATTTCCTTGAATTTTGTAGAGAATT
TTCTGAAATCTTTGGAAGTCATTGTGAAGAAATGATTATAAAATGCTTAT
TTAAATACCAAGGAATTTTCAACCAAATTTTGTCTAAAAATAATATATTT
CTTTTAAAAAACATGGGAGCTTTTGTAACCGGTAAAACAATAGAGGAGAC
TTGGTTCAACTGCTATATATTCGATTATGCTTGCCAGACTCAGATGAAAC
TAGGCAAATGCATTCACTCGGAAAACGTAATTGTGCCTGATATCGAAACA
CAGAAGAATGTCCTTAAACAATTTAAGGGTAGCATTAGTAGTACGCTTAT
GTTAAATAATCCAAATGATAATGTTGAATGGTTACCCGGTCAGCTCGAAT
TTGAGGCACTGATGAGAGATTTTGAATACAATGAGTCGTCATCTGGTTAC
GATTTTAAAATTAAAAGTATTTGGAAATAAAAGACGAAATTGGATGATTT
CAAATTATTTAAAAACATAAATTAATTTTCTAGTAAAGAAAAAATTTTTT
TTAAAAAAAA
back to top

protein sequence of SMED30036007-orf-1

>SMED30036007-orf-1 ID=SMED30036007-orf-1|Name=SMED30036007-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=286bp
MLSKSDLEFDLNLNILYKIGFKENWFNGENIFISMRKASSRVFTINAPKE
IDKNQLKFMDINMETVDLDFQNVNNYVASFLIHFLIHNSDSINDARCILF
INSINVIEVSKTDHGLFPVSQESFFVNGSEIFQFDFLEFCREFSEIFGSH
CEEMIIKCLFKYQGIFNQILSKNNIFLLKNMGAFVTGKTIEETWFNCYIF
DYACQTQMKLGKCIHSENVIVPDIETQKNVLKQFKGSISSTLMLNNPNDN
VEWLPGQLEFEALMRDFEYNESSSGYDFKIKSIWK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR036409Aldolase_II/adducin_N_sf
IPR001303Aldolase_II/adducin_N
Vocabulary: molecular function
TermDefinition
GO:0003779actin binding
GO:0005080protein kinase C binding
GO:0005515protein binding
GO:0005516calmodulin binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005886plasma membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0042493response to drug
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036409Class II aldolase/adducin N-terminal domain superfamilyGENE3DG3DSA:3.40.225.10coord: 4..278
e-value: 1.4E-19
score: 72.2
IPR036409Class II aldolase/adducin N-terminal domain superfamilySUPERFAMILYSSF53639AraD/HMP-PK domain-likecoord: 65..213
IPR001303Class II aldolase/adducin N-terminalPFAMPF00596Aldolase_IIcoord: 23..209
e-value: 1.6E-11
score: 44.5
NoneNo IPR availablePANTHERPTHR10672:SF3PROTEIN HU-LI TAI SHAOcoord: 73..285
NoneNo IPR availablePANTHERPTHR10672ADDUCINcoord: 73..285