Calcium-transporting ATPase

Overview
NameCalcium-transporting ATPase
Smed IDSMED30036005
Length (bp)3457
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calcium-transporting ATPase (SMED30036005) t-SNE clustered cells

Violin plots show distribution of expression levels for Calcium-transporting ATPase (SMED30036005) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Calcium-transporting ATPase (SMED30036005) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Calcium-transporting ATPase (SMED30036005) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2A2 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 2 [Source:HGNC Symbol;Acc:HGNC:812])

HSP 1 Score: 1429.46 bits (3699), Expect = 0.000e+0
Identity = 721/992 (72.68%), Postives = 838/992 (84.48%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGS---PKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTD 3311
            MEN+H KTV+EVL +F V+E  GLS EQVK+  ER+G NE+PAEE K L +L++EQF+DLLV+ILLLAA ISFVLA FEE E++ITAFVEPFVI+LIL+ANAIVGVWQERNAE+AIEALKEYEPE+ KVYR++ K VQ+IKA+++VPGDI +IAVGDKVPADIR+T I STT+R+DQSILTGESVSVIKH+D +PDPRAVNQDKKN+LFSGTN+A+GK  GVV+ TG++TEIGKIR++M+ TEQERTPLQQKLDEFG+QLSKVI++ICIAVW INIGHFNDP HGGSW+RGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV RMF+   +     S ++F ITGS YAP GEV  + + V    Y+ L+E+A ICA+CNDS++DYNE K  YEKVGEATETALTCLVEKMNV +    GL+K +   ACN  I+   KKEFTLEFSRDRKSMS Y  P K       KMF KGAPEG++DRC  +RVGS K+PMT+ +K +IM +  E+G+G DTLRCLALAT DNP ++E+M+LEDS  F KYETN+TFVG VGMLDPPR EV  S+  CR AGIRVI+ITGDNK TA AICRRIG+F ++E    K++TGREFD+L+   +++A   A+ FARVEP+HKSKIVE+LQ   E++AMTGDGVNDAPALKKAEIGIAMGSGTAVAK+ASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVV IFLTAALG PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM+KPPR+ +EPLI+GWLFFRY+A+G YVGAATVGAAAWWF     GP++++YQL+H  QC      FEGVDC+IF  P PMTMALSVLV IEM NA+NSLSENQSLL+MPPW N+WLVGS+ LSMSLHFLIL V+ L  +FQITPL+V +W  V+KIS PVIL+DE LK +AR + +
Sbjct:    1 MENAHTKTVEEVLGHFGVNESTGLSLEQVKKLKERWGSNELPAEEGKTLLELVIEQFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALKEYEPEMGKVYRQDRKSVQRIKAKDIVPGDIVEIAVGDKVPADIRLTSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAMGVVVATGVNTEIGKIRDEMVATEQERTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFILDRVEGDTCSLNEFTITGSTYAPIGEVHKDDKPVNCHQYDGLVELATICALCNDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTELKGLSKIERANACNSVIKQLMKKEFTLEFSRDRKSMSVYCTPNKPSRTSMSKMFVKGAPEGVIDRCTHIRVGSTKVPMTSGVKQKIMSVIREWGSGSDTLRCLALATHDNPLRREEMHLEDSANFIKYETNLTFVGCVGMLDPPRIEVASSVKLCRQAGIRVIMITGDNKGTAVAICRRIGIFGQDEDVTSKAFTGREFDELNPSAQRDACLNARCFARVEPSHKSKIVEFLQSFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYVGAATVGAAAWWFIAADGGPRVSFYQLSHFLQCKEDNPDFEGVDCAIFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWENIWLVGSICLSMSLHFLILYVEPLPLIFQITPLNVTQWLMVLKISLPVILMDETLKFVARNYLE 992          
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2A2 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 2 [Source:HGNC Symbol;Acc:HGNC:812])

HSP 1 Score: 1428.69 bits (3697), Expect = 0.000e+0
Identity = 721/992 (72.68%), Postives = 838/992 (84.48%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGS---PKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTD 3311
            MEN+H KTV+EVL +F V+E  GLS EQVK+  ER+G NE+PAEE K L +L++EQF+DLLV+ILLLAA ISFVLA FEE E++ITAFVEPFVI+LIL+ANAIVGVWQERNAE+AIEALKEYEPE+ KVYR++ K VQ+IKA+++VPGDI +IAVGDKVPADIR+T I STT+R+DQSILTGESVSVIKH+D +PDPRAVNQDKKN+LFSGTN+A+GK  GVV+ TG++TEIGKIR++M+ TEQERTPLQQKLDEFG+QLSKVI++ICIAVW INIGHFNDP HGGSW+RGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV RMF+   +     S ++F ITGS YAP GEV  + + V    Y+ L+E+A ICA+CNDS++DYNE K  YEKVGEATETALTCLVEKMNV +    GL+K +   ACN  I+   KKEFTLEFSRDRKSMS Y  P K       KMF KGAPEG++DRC  +RVGS K+PMT+ +K +IM +  E+G+G DTLRCLALAT DNP ++E+M+LEDS  F KYETN+TFVG VGMLDPPR EV  S+  CR AGIRVI+ITGDNK TA AICRRIG+F ++E    K++TGREFD+L+   +++A   A+ FARVEP+HKSKIVE+LQ   E++AMTGDGVNDAPALKKAEIGIAMGSGTAVAK+ASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVV IFLTAALG PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM+KPPR+ +EPLI+GWLFFRY+A+G YVGAATVGAAAWWF     GP++++YQL+H  QC      FEGVDC+IF  P PMTMALSVLV IEM NA+NSLSENQSLL+MPPW N+WLVGS+ LSMSLHFLIL V+ L  +FQITPL+V +W  V+KIS PVIL+DE LK +AR + +
Sbjct:    1 MENAHTKTVEEVLGHFGVNESTGLSLEQVKKLKERWGSNELPAEEGKTLLELVIEQFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALKEYEPEMGKVYRQDRKSVQRIKAKDIVPGDIVEIAVGDKVPADIRLTSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAMGVVVATGVNTEIGKIRDEMVATEQERTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFILDRVEGDTCSLNEFTITGSTYAPIGEVHKDDKPVNCHQYDGLVELATICALCNDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTELKGLSKIERANACNSVIKQLMKKEFTLEFSRDRKSMSVYCTPNKPSRTSMSKMFVKGAPEGVIDRCTHIRVGSTKVPMTSGVKQKIMSVIREWGSGSDTLRCLALATHDNPLRREEMHLEDSANFIKYETNLTFVGCVGMLDPPRIEVASSVKLCRQAGIRVIMITGDNKGTAVAICRRIGIFGQDEDVTSKAFTGREFDELNPSAQRDACLNARCFARVEPSHKSKIVEFLQSFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYVGAATVGAAAWWFIAADGGPRVSFYQLSHFLQCKEDNPDFEGVDCAIFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWENIWLVGSICLSMSLHFLILYVEPLPLIFQITPLNVTQWLMVLKISLPVILMDETLKFVARNYLE 992          
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2A1 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1 [Source:HGNC Symbol;Acc:HGNC:811])

HSP 1 Score: 1427.92 bits (3695), Expect = 0.000e+0
Identity = 721/994 (72.54%), Postives = 831/994 (83.60%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGSP----KMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTDG 3314
            ME +H KT +E L YF V E  GL+ +QVKR +E++G NE+PAEE K LW+L++EQF+DLLV+ILLLAA ISFVLA FEE E++ITAFVEPFVI+LILIANAIVGVWQERNAE+AIEALKEYEPE+ KVYR + K VQ+IKAR++VPGDI ++AVGDKVPADIRI  I STT+R+DQSILTGESVSVIKH++ +PDPRAVNQDKKN+LFSGTN+A+GK  G+V  TG+ TEIGKIR+QM  TEQ++TPLQQKLDEFG+QLSKVI++IC+AVW INIGHFNDP HGGSW RGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV +MF+   +       ++F ITGS YAPEGEV  N + VR G Y+ L+E+A ICA+CNDSS+D+NE K  YEKVGEATETALT LVEKMNV N     L+K +   ACN  I+   KKEFTLEFSRDRKSMS Y +PAK        KMF KGAPEG++DRC +VRVG+ ++P+T  +K +IM +  E+GTGRDTLRCLALAT D P K+E+M L+DS +F +YET++TFVGVVGMLDPPR EV  SI  CR AGIRVI+ITGDNK TA AICRRIG+F ENE    ++YTGREFDDL    ++EA RRA  FARVEP+HKSKIVEYLQ   E++AMTGDGVNDAPALKKAEIGIAMGSGTAVAK+ASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVV IFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM +PPRS +EPLI+GWLFFRYMA+G YVGAATVGAAAWWF     GP +NY QLTH  QC    + FEG+DC +F  P+PMTMALSVLV IEM NA+NSLSENQSLL+MPPWVN+WL+GS+ LSMSLHFLIL VD L  +F++  L + +W  V+KIS PVI LDE+LK +AR + +G
Sbjct:    1 MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGLNELPAEEGKTLWELVIEQFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILIANAIVGVWQERNAENAIEALKEYEPEMGKVYRADRKSVQRIKARDIVPGDIVEVAVGDKVPADIRILAIKSTTLRVDQSILTGESVSVIKHTEPVPDPRAVNQDKKNMLFSGTNIAAGKALGIVATTGVGTEIGKIRDQMAATEQDKTPLQQKLDEFGEQLSKVISLICVAVWLINIGHFNDPVHGGSWFRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCKMFIIDKVDGDICLLNEFSITGSTYAPEGEVLKNDKPVRPGQYDGLVELATICALCNDSSLDFNEAKGVYEKVGEATETALTTLVEKMNVFNTDVRSLSKVERANACNSVIRQLMKKEFTLEFSRDRKSMSVYCSPAKSSRAAVGNKMFVKGAPEGVIDRCNYVRVGTTRVPLTGPVKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVGMLDPPRKEVTGSIQLCRDAGIRVIMITGDNKGTAIAICRRIGIFGENEEVADRAYTGREFDDLPLAEQREACRRACCFARVEPSHKSKIVEYLQSYDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRPPRSPKEPLISGWLFFRYMAIGGYVGAATVGAAAWWFLYAEDGPHVNYSQLTHFMQCTEDNTHFEGIDCEVFEAPEPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWVNIWLLGSICLSMSLHFLILYVDPLPMIFKLRALDLTQWLMVLKISLPVIGLDEILKFVARNYLEG 994          
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2A1 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1 [Source:HGNC Symbol;Acc:HGNC:811])

HSP 1 Score: 1423.68 bits (3684), Expect = 0.000e+0
Identity = 720/991 (72.65%), Postives = 829/991 (83.65%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGSP----KMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKF 3305
            ME +H KT +E L YF V E  GL+ +QVKR +E++G NE+PAEE K LW+L++EQF+DLLV+ILLLAA ISFVLA FEE E++ITAFVEPFVI+LILIANAIVGVWQERNAE+AIEALKEYEPE+ KVYR + K VQ+IKAR++VPGDI ++AVGDKVPADIRI  I STT+R+DQSILTGESVSVIKH++ +PDPRAVNQDKKN+LFSGTN+A+GK  G+V  TG+ TEIGKIR+QM  TEQ++TPLQQKLDEFG+QLSKVI++IC+AVW INIGHFNDP HGGSW RGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV +MF+   +       ++F ITGS YAPEGEV  N + VR G Y+ L+E+A ICA+CNDSS+D+NE K  YEKVGEATETALT LVEKMNV N     L+K +   ACN  I+   KKEFTLEFSRDRKSMS Y +PAK        KMF KGAPEG++DRC +VRVG+ ++P+T  +K +IM +  E+GTGRDTLRCLALAT D P K+E+M L+DS +F +YET++TFVGVVGMLDPPR EV  SI  CR AGIRVI+ITGDNK TA AICRRIG+F ENE    ++YTGREFDDL    ++EA RRA  FARVEP+HKSKIVEYLQ   E++AMTGDGVNDAPALKKAEIGIAMGSGTAVAK+ASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVV IFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM +PPRS +EPLI+GWLFFRYMA+G YVGAATVGAAAWWF     GP +NY QLTH  QC    + FEG+DC +F  P+PMTMALSVLV IEM NA+NSLSENQSLL+MPPWVN+WL+GS+ LSMSLHFLIL VD L  +F++  L + +W  V+KIS PVI LDE+LK +AR +
Sbjct:    1 MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGLNELPAEEGKTLWELVIEQFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILIANAIVGVWQERNAENAIEALKEYEPEMGKVYRADRKSVQRIKARDIVPGDIVEVAVGDKVPADIRILAIKSTTLRVDQSILTGESVSVIKHTEPVPDPRAVNQDKKNMLFSGTNIAAGKALGIVATTGVGTEIGKIRDQMAATEQDKTPLQQKLDEFGEQLSKVISLICVAVWLINIGHFNDPVHGGSWFRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCKMFIIDKVDGDICLLNEFSITGSTYAPEGEVLKNDKPVRPGQYDGLVELATICALCNDSSLDFNEAKGVYEKVGEATETALTTLVEKMNVFNTDVRSLSKVERANACNSVIRQLMKKEFTLEFSRDRKSMSVYCSPAKSSRAAVGNKMFVKGAPEGVIDRCNYVRVGTTRVPLTGPVKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVGMLDPPRKEVTGSIQLCRDAGIRVIMITGDNKGTAIAICRRIGIFGENEEVADRAYTGREFDDLPLAEQREACRRACCFARVEPSHKSKIVEYLQSYDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRPPRSPKEPLISGWLFFRYMAIGGYVGAATVGAAAWWFLYAEDGPHVNYSQLTHFMQCTEDNTHFEGIDCEVFEAPEPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWVNIWLLGSICLSMSLHFLILYVDPLPMIFKLRALDLTQWLMVLKISLPVIGLDEILKFVARNY 991          
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2A3 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 3 [Source:HGNC Symbol;Acc:HGNC:813])

HSP 1 Score: 1337.01 bits (3459), Expect = 0.000e+0
Identity = 675/1001 (67.43%), Postives = 806/1001 (80.52%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAK-----EGSPKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTDGKNKHVH 3332
            ME +H+    +VL +F+V  E GLS  QV    ER+G NE+P+EE K+LW+L+LEQF+DLLV+ILLLAA++SFVLA FEE E++ TAFVEP VIMLIL+ANAIVGVWQERNAESAIEALKEYEPE+ KV R + KGVQ+I+AR++VPGDI ++AVGDKVPAD+R+ +I STT+R+DQSILTGESVSV KH++AIPDPRAVNQDKKN+LFSGTN+ SGK  GV + TGL TE+GKIR+QM   E ERTPLQ+KLDEFG+QLS  I++IC+AVW INIGHF DPAHGGSW+RGA+YYFKIAVALAVAAIPEGLPAVITTCLALGTRRMA+KNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV RMFV +         H+F I+G+ Y PEGEV    Q VR G ++ L+E+A ICA+CNDS++DYNE K  YEKVGEATETALTCLVEKMNV +     L++ +   ACN  I+   +KEFTLEFSRDRKSMS Y  P +     +GS KMF KGAPE +++RC+ VRVGS+  P+T   + +I+    ++G+G DTLRCLALAT D P +KE M L+D ++F +YET++TFVG VGMLDPPR EV   I +C  AGIRV++ITGDNK TA AICRR+G+F + E   GK+YTGREFDDLS E +++A R A+ FARVEPAHKS+IVE LQ   E++AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSA+EMVL+DDNF++IVAAVEEGRAIY+NMKQFIRYLISSNVGEVV IFLTA LG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM K PRS RE LI+GWLFFRY+A+G YVG ATV AA WWF    +GP +N+YQL +  +C      F G+DC +F    P TMALSVLV IEM NA+NS+SENQSLL+MPPW+N WL+ ++ +SM+LHFLIL V  L  +FQ+TPLS  +W  V++IS PVILLDE LK ++R        H+H
Sbjct:    1 MEAAHLLPAADVLRHFSVTAEGGLSPAQVTGARERYGPNELPSEEGKSLWELVLEQFEDLLVRILLLAALVSFVLAWFEEGEETTTAFVEPLVIMLILVANAIVGVWQERNAESAIEALKEYEPEMGKVIRSDRKGVQRIRARDIVPGDIVEVAVGDKVPADLRLIEIKSTTLRVDQSILTGESVSVTKHTEAIPDPRAVNQDKKNMLFSGTNITSGKAVGVAVATGLHTELGKIRSQMAAVEPERTPLQRKLDEFGRQLSHAISVICVAVWVINIGHFADPAHGGSWLRGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMARKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFVVAEADAGSCLLHEFTISGTTYTPEGEVRQGDQPVRCGQFDGLVELATICALCNDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTDLQALSRVERAGACNTVIKQLMRKEFTLEFSRDRKSMSVYCTPTRPHPTGQGS-KMFVKGAPESVIERCSSVRVGSRTAPLTPTSREQILAKIRDWGSGSDTLRCLALATRDAPPRKEDMELDDCSKFVQYETDLTFVGCVGMLDPPRPEVAACITRCYQAGIRVVMITGDNKGTAVAICRRLGIFGDTEDVAGKAYTGREFDDLSPEQQRQACRTARCFARVEPAHKSRIVENLQSFNEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLSDDNFASIVAAVEEGRAIYSNMKQFIRYLISSNVGEVVCIFLTAILGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKLPRSPREALISGWLFFRYLAIGVYVGLATVAAATWWFVYDAEGPHINFYQLRNFLKCSEDNPLFAGIDCEVFESRFPTTMALSVLVTIEMCNALNSVSENQSLLRMPPWMNPWLLVAVAMSMALHFLILLVPPLPLIFQVTPLSGRQWVVVLQISLPVILLDEALKYLSR-------NHMH 993          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: sca-1 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:Q9XU13])

HSP 1 Score: 1442.17 bits (3732), Expect = 0.000e+0
Identity = 729/1001 (72.83%), Postives = 839/1001 (83.82%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHED---SITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVR--TGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGS-PKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTDGKNKHV 3329
            ME++H K  +EV  +F    E GL+ +QV+    ++G NEMPAEE K+LW+LILEQFDDLLVKILLLAAIISFVLALFEEHED   ++TAFVEPFVI+LILIANA VGVWQERNAESAIEALKEYEPE+AKV R    G+Q ++A+ELVPGD+ +++VGDK+PAD+R+ KI+STTIRIDQSILTGESVSVIKH+D++PDPRAVNQDKKN LFSGTNVASGK RG+V GTGL TEIGKIR +M ETE E+TPLQQKLDEFG+QLSKVI++IC+AVWAINIGHFNDPAHGGSWV+GAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV++MF+    +   I+  +F I+GS Y P G+V  NG+++    G++E+L E+A ICAMCNDSS+DYNETK  YEKVGEATETAL  L EKMNV   SKAGL+ K+LG  CN  IQ  WKKEFTLEFSRDRKSMS Y  PA  GS  KMF KGAPEG+L RC  VRV  +K+P+T+A+  +I+    +YGTGRDTLRCLAL T+D P     MNLEDS QF KYE ++TFVGVVGMLDPPRTEV DSI  C  AGIRVI+ITGDNK TAEAI RRIG+F ENE T GK+YTGREFDDL  E + EA RRAKLFARVEP+HKSKIV+ LQ  GE++AMTGDGVNDAPALKKAEIGI+MGSGTAVAKSASEMVLADDNF++IV+AVEEGRAIYNNMKQFIRYLISSNVGEVVSIF+ AALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM + PRS  + LI+GWLFFRY+AVGTYVG ATVGA+ WWF +Y +GPQ+ YYQLTH  +C  +   F  +DC++F    P  MALSVLV IEMLNA+NSLSENQSLL MPPW N+WL+ ++ LSMSLHF+IL VD ++ +FQITPL+  EW AV+KIS PV+LLDE+LK IAR + DGK + V
Sbjct:    1 MEDAHAKDANEVCKFFGTGPE-GLTPQQVETLRNKYGENEMPAEEGKSLWELILEQFDDLLVKILLLAAIISFVLALFEEHEDQTEAVTAFVEPFVILLILIANATVGVWQERNAESAIEALKEYEPEMAKVIRSGHHGIQMVRAKELVPGDLVEVSVGDKIPADLRLVKIYSTTIRIDQSILTGESVSVIKHTDSVPDPRAVNQDKKNCLFSGTNVASGKARGIVFGTGLTTEIGKIRTEMAETENEKTPLQQKLDEFGEQLSKVISVICVAVWAINIGHFNDPAHGGSWVKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSKMFIAGQASGDNINFTEFAISGSTYEPVGKVSTNGREINPAAGEFESLTELAMICAMCNDSSVDYNETKKIYEKVGEATETALIVLAEKMNVFGTSKAGLSPKELGGVCNRVIQQKWKKEFTLEFSRDRKSMSAYCFPASGGSGAKMFVKGAPEGVLGRCTHVRVNGQKVPLTSAMTQKIVDQCVQYGTGRDTLRCLALGTIDTPVSVSNMNLEDSTQFVKYEQDITFVGVVGMLDPPRTEVSDSIKACNHAGIRVIMITGDNKNTAEAIGRRIGLFGENEDTTGKAYTGREFDDLPPEQQSEACRRAKLFARVEPSHKSKIVDILQSQGEITAMTGDGVNDAPALKKAEIGISMGSGTAVAKSASEMVLADDNFASIVSAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFMVAALGIPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRHPRSANDGLISGWLFFRYLAVGTYVGVATVGASMWWFLLYEEGPQITYYQLTHWMRCEIEPDNFADLDCAVFEDNHPNAMALSVLVTIEMLNAINSLSENQSLLVMPPWKNIWLMAAISLSMSLHFVILYVDIMATIFQITPLNWVEWIAVLKISLPVLLLDEILKFIARNYIDGKPETV 1000          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: sca-1 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:Q9XU13])

HSP 1 Score: 1437.94 bits (3721), Expect = 0.000e+0
Identity = 726/995 (72.96%), Postives = 835/995 (83.92%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHED---SITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVR--TGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGS-PKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTD 3311
            ME++H K  +EV  +F    E GL+ +QV+    ++G NEMPAEE K+LW+LILEQFDDLLVKILLLAAIISFVLALFEEHED   ++TAFVEPFVI+LILIANA VGVWQERNAESAIEALKEYEPE+AKV R    G+Q ++A+ELVPGD+ +++VGDK+PAD+R+ KI+STTIRIDQSILTGESVSVIKH+D++PDPRAVNQDKKN LFSGTNVASGK RG+V GTGL TEIGKIR +M ETE E+TPLQQKLDEFG+QLSKVI++IC+AVWAINIGHFNDPAHGGSWV+GAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV++MF+    +   I+  +F I+GS Y P G+V  NG+++    G++E+L E+A ICAMCNDSS+DYNETK  YEKVGEATETAL  L EKMNV   SKAGL+ K+LG  CN  IQ  WKKEFTLEFSRDRKSMS Y  PA  GS  KMF KGAPEG+L RC  VRV  +K+P+T+A+  +I+    +YGTGRDTLRCLAL T+D P     MNLEDS QF KYE ++TFVGVVGMLDPPRTEV DSI  C  AGIRVI+ITGDNK TAEAI RRIG+F ENE T GK+YTGREFDDL  E + EA RRAKLFARVEP+HKSKIV+ LQ  GE++AMTGDGVNDAPALKKAEIGI+MGSGTAVAKSASEMVLADDNF++IV+AVEEGRAIYNNMKQFIRYLISSNVGEVVSIF+ AALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM + PRS  + LI+GWLFFRY+AVGTYVG ATVGA+ WWF +Y +GPQ+ YYQLTH  +C  +   F  +DC++F    P  MALSVLV IEMLNA+NSLSENQSLL MPPW N+WL+ ++ LSMSLHF+IL VD ++ +FQITPL+  EW AV+KIS PV+LLDE+LK IAR + D
Sbjct:    1 MEDAHAKDANEVCKFFGTGPE-GLTPQQVETLRNKYGENEMPAEEGKSLWELILEQFDDLLVKILLLAAIISFVLALFEEHEDQTEAVTAFVEPFVILLILIANATVGVWQERNAESAIEALKEYEPEMAKVIRSGHHGIQMVRAKELVPGDLVEVSVGDKIPADLRLVKIYSTTIRIDQSILTGESVSVIKHTDSVPDPRAVNQDKKNCLFSGTNVASGKARGIVFGTGLTTEIGKIRTEMAETENEKTPLQQKLDEFGEQLSKVISVICVAVWAINIGHFNDPAHGGSWVKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSKMFIAGQASGDNINFTEFAISGSTYEPVGKVSTNGREINPAAGEFESLTELAMICAMCNDSSVDYNETKKIYEKVGEATETALIVLAEKMNVFGTSKAGLSPKELGGVCNRVIQQKWKKEFTLEFSRDRKSMSAYCFPASGGSGAKMFVKGAPEGVLGRCTHVRVNGQKVPLTSAMTQKIVDQCVQYGTGRDTLRCLALGTIDTPVSVSNMNLEDSTQFVKYEQDITFVGVVGMLDPPRTEVSDSIKACNHAGIRVIMITGDNKNTAEAIGRRIGLFGENEDTTGKAYTGREFDDLPPEQQSEACRRAKLFARVEPSHKSKIVDILQSQGEITAMTGDGVNDAPALKKAEIGISMGSGTAVAKSASEMVLADDNFASIVSAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFMVAALGIPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRHPRSANDGLISGWLFFRYLAVGTYVGVATVGASMWWFLLYEEGPQITYYQLTHWMRCEIEPDNFADLDCAVFEDNHPNAMALSVLVTIEMLNAINSLSENQSLLVMPPWKNIWLMAAISLSMSLHFVILYVDIMATIFQITPLNWVEWIAVLKISLPVLLLDEILKFIARNYID 994          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: sca-1 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:Q9XU13])

HSP 1 Score: 1437.94 bits (3721), Expect = 0.000e+0
Identity = 726/995 (72.96%), Postives = 835/995 (83.92%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHED---SITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVR--TGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGS-PKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTD 3311
            ME++H K  +EV  +F    E GL+ +QV+    ++G NEMPAEE K+LW+LILEQFDDLLVKILLLAAIISFVLALFEEHED   ++TAFVEPFVI+LILIANA VGVWQERNAESAIEALKEYEPE+AKV R    G+Q ++A+ELVPGD+ +++VGDK+PAD+R+ KI+STTIRIDQSILTGESVSVIKH+D++PDPRAVNQDKKN LFSGTNVASGK RG+V GTGL TEIGKIR +M ETE E+TPLQQKLDEFG+QLSKVI++IC+AVWAINIGHFNDPAHGGSWV+GAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV++MF+    +   I+  +F I+GS Y P G+V  NG+++    G++E+L E+A ICAMCNDSS+DYNETK  YEKVGEATETAL  L EKMNV   SKAGL+ K+LG  CN  IQ  WKKEFTLEFSRDRKSMS Y  PA  GS  KMF KGAPEG+L RC  VRV  +K+P+T+A+  +I+    +YGTGRDTLRCLAL T+D P     MNLEDS QF KYE ++TFVGVVGMLDPPRTEV DSI  C  AGIRVI+ITGDNK TAEAI RRIG+F ENE T GK+YTGREFDDL  E + EA RRAKLFARVEP+HKSKIV+ LQ  GE++AMTGDGVNDAPALKKAEIGI+MGSGTAVAKSASEMVLADDNF++IV+AVEEGRAIYNNMKQFIRYLISSNVGEVVSIF+ AALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM + PRS  + LI+GWLFFRY+AVGTYVG ATVGA+ WWF +Y +GPQ+ YYQLTH  +C  +   F  +DC++F    P  MALSVLV IEMLNA+NSLSENQSLL MPPW N+WL+ ++ LSMSLHF+IL VD ++ +FQITPL+  EW AV+KIS PV+LLDE+LK IAR + D
Sbjct:    1 MEDAHAKDANEVCKFFGTGPE-GLTPQQVETLRNKYGENEMPAEEGKSLWELILEQFDDLLVKILLLAAIISFVLALFEEHEDQTEAVTAFVEPFVILLILIANATVGVWQERNAESAIEALKEYEPEMAKVIRSGHHGIQMVRAKELVPGDLVEVSVGDKIPADLRLVKIYSTTIRIDQSILTGESVSVIKHTDSVPDPRAVNQDKKNCLFSGTNVASGKARGIVFGTGLTTEIGKIRTEMAETENEKTPLQQKLDEFGEQLSKVISVICVAVWAINIGHFNDPAHGGSWVKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSKMFIAGQASGDNINFTEFAISGSTYEPVGKVSTNGREINPAAGEFESLTELAMICAMCNDSSVDYNETKKIYEKVGEATETALIVLAEKMNVFGTSKAGLSPKELGGVCNRVIQQKWKKEFTLEFSRDRKSMSAYCFPASGGSGAKMFVKGAPEGVLGRCTHVRVNGQKVPLTSAMTQKIVDQCVQYGTGRDTLRCLALGTIDTPVSVSNMNLEDSTQFVKYEQDITFVGVVGMLDPPRTEVSDSIKACNHAGIRVIMITGDNKNTAEAIGRRIGLFGENEDTTGKAYTGREFDDLPPEQQSEACRRAKLFARVEPSHKSKIVDILQSQGEITAMTGDGVNDAPALKKAEIGISMGSGTAVAKSASEMVLADDNFASIVSAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFMVAALGIPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRHPRSANDGLISGWLFFRYLAVGTYVGVATVGASMWWFLLYEEGPQITYYQLTHWMRCEIEPDNFADLDCAVFEDNHPNAMALSVLVTIEMLNAINSLSENQSLLVMPPWKNIWLMAAISLSMSLHFVILYVDIMATIFQITPLNWVEWIAVLKISLPVLLLDEILKFIARNYID 994          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: sca-1 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:Q9XU13])

HSP 1 Score: 1437.94 bits (3721), Expect = 0.000e+0
Identity = 726/995 (72.96%), Postives = 835/995 (83.92%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHED---SITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVR--TGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGS-PKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTD 3311
            ME++H K  +EV  +F    E GL+ +QV+    ++G NEMPAEE K+LW+LILEQFDDLLVKILLLAAIISFVLALFEEHED   ++TAFVEPFVI+LILIANA VGVWQERNAESAIEALKEYEPE+AKV R    G+Q ++A+ELVPGD+ +++VGDK+PAD+R+ KI+STTIRIDQSILTGESVSVIKH+D++PDPRAVNQDKKN LFSGTNVASGK RG+V GTGL TEIGKIR +M ETE E+TPLQQKLDEFG+QLSKVI++IC+AVWAINIGHFNDPAHGGSWV+GAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV++MF+    +   I+  +F I+GS Y P G+V  NG+++    G++E+L E+A ICAMCNDSS+DYNETK  YEKVGEATETAL  L EKMNV   SKAGL+ K+LG  CN  IQ  WKKEFTLEFSRDRKSMS Y  PA  GS  KMF KGAPEG+L RC  VRV  +K+P+T+A+  +I+    +YGTGRDTLRCLAL T+D P     MNLEDS QF KYE ++TFVGVVGMLDPPRTEV DSI  C  AGIRVI+ITGDNK TAEAI RRIG+F ENE T GK+YTGREFDDL  E + EA RRAKLFARVEP+HKSKIV+ LQ  GE++AMTGDGVNDAPALKKAEIGI+MGSGTAVAKSASEMVLADDNF++IV+AVEEGRAIYNNMKQFIRYLISSNVGEVVSIF+ AALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM + PRS  + LI+GWLFFRY+AVGTYVG ATVGA+ WWF +Y +GPQ+ YYQLTH  +C  +   F  +DC++F    P  MALSVLV IEMLNA+NSLSENQSLL MPPW N+WL+ ++ LSMSLHF+IL VD ++ +FQITPL+  EW AV+KIS PV+LLDE+LK IAR + D
Sbjct:    1 MEDAHAKDANEVCKFFGTGPE-GLTPQQVETLRNKYGENEMPAEEGKSLWELILEQFDDLLVKILLLAAIISFVLALFEEHEDQTEAVTAFVEPFVILLILIANATVGVWQERNAESAIEALKEYEPEMAKVIRSGHHGIQMVRAKELVPGDLVEVSVGDKIPADLRLVKIYSTTIRIDQSILTGESVSVIKHTDSVPDPRAVNQDKKNCLFSGTNVASGKARGIVFGTGLTTEIGKIRTEMAETENEKTPLQQKLDEFGEQLSKVISVICVAVWAINIGHFNDPAHGGSWVKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSKMFIAGQASGDNINFTEFAISGSTYEPVGKVSTNGREINPAAGEFESLTELAMICAMCNDSSVDYNETKKIYEKVGEATETALIVLAEKMNVFGTSKAGLSPKELGGVCNRVIQQKWKKEFTLEFSRDRKSMSAYCFPASGGSGAKMFVKGAPEGVLGRCTHVRVNGQKVPLTSAMTQKIVDQCVQYGTGRDTLRCLALGTIDTPVSVSNMNLEDSTQFVKYEQDITFVGVVGMLDPPRTEVSDSIKACNHAGIRVIMITGDNKNTAEAIGRRIGLFGENEDTTGKAYTGREFDDLPPEQQSEACRRAKLFARVEPSHKSKIVDILQSQGEITAMTGDGVNDAPALKKAEIGISMGSGTAVAKSASEMVLADDNFASIVSAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFMVAALGIPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRHPRSANDGLISGWLFFRYLAVGTYVGVATVGASMWWFLLYEEGPQITYYQLTHWMRCEIEPDNFADLDCAVFEDNHPNAMALSVLVTIEMLNAINSLSENQSLLVMPPWKNIWLMAAISLSMSLHFVILYVDIMATIFQITPLNWVEWIAVLKISLPVLLLDEILKFIARNYID 994          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: sca-1 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:Q9XU13])

HSP 1 Score: 1280.39 bits (3312), Expect = 0.000e+0
Identity = 636/873 (72.85%), Postives = 732/873 (83.85%), Query Frame = 3
Query:  720 IAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVR--TGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGS-PKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTDGKNKHV 3329
            +AKV R    G+Q ++A+ELVPGD+ +++VGDK+PAD+R+ KI+STTIRIDQSILTGESVSVIKH+D++PDPRAVNQDKKN LFSGTNVASGK RG+V GTGL TEIGKIR +M ETE E+TPLQQKLDEFG+QLSKVI++IC+AVWAINIGHFNDPAHGGSWV+GAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV++MF+    +   I+  +F I+GS Y P G+V  NG+++    G++E+L E+A ICAMCNDSS+DYNETK  YEKVGEATETAL  L EKMNV   SKAGL+ K+LG  CN  IQ  WKKEFTLEFSRDRKSMS Y  PA  GS  KMF KGAPEG+L RC  VRV  +K+P+T+A+  +I+    +YGTGRDTLRCLAL T+D P     MNLEDS QF KYE ++TFVGVVGMLDPPRTEV DSI  C  AGIRVI+ITGDNK TAEAI RRIG+F ENE T GK+YTGREFDDL  E + EA RRAKLFARVEP+HKSKIV+ LQ  GE++AMTGDGVNDAPALKKAEIGI+MGSGTAVAKSASEMVLADDNF++IV+AVEEGRAIYNNMKQFIRYLISSNVGEVVSIF+ AALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM + PRS  + LI+GWLFFRY+AVGTYVG ATVGA+ WWF +Y +GPQ+ YYQLTH  +C  +   F  +DC++F    P  MALSVLV IEMLNA+NSLSENQSLL MPPW N+WL+ ++ LSMSLHF+IL VD ++ +FQITPL+  EW AV+KIS PV+LLDE+LK IAR + DGK + V
Sbjct:    1 MAKVIRSGHHGIQMVRAKELVPGDLVEVSVGDKIPADLRLVKIYSTTIRIDQSILTGESVSVIKHTDSVPDPRAVNQDKKNCLFSGTNVASGKARGIVFGTGLTTEIGKIRTEMAETENEKTPLQQKLDEFGEQLSKVISVICVAVWAINIGHFNDPAHGGSWVKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSKMFIAGQASGDNINFTEFAISGSTYEPVGKVSTNGREINPAAGEFESLTELAMICAMCNDSSVDYNETKKIYEKVGEATETALIVLAEKMNVFGTSKAGLSPKELGGVCNRVIQQKWKKEFTLEFSRDRKSMSAYCFPASGGSGAKMFVKGAPEGVLGRCTHVRVNGQKVPLTSAMTQKIVDQCVQYGTGRDTLRCLALGTIDTPVSVSNMNLEDSTQFVKYEQDITFVGVVGMLDPPRTEVSDSIKACNHAGIRVIMITGDNKNTAEAIGRRIGLFGENEDTTGKAYTGREFDDLPPEQQSEACRRAKLFARVEPSHKSKIVDILQSQGEITAMTGDGVNDAPALKKAEIGISMGSGTAVAKSASEMVLADDNFASIVSAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFMVAALGIPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRHPRSANDGLISGWLFFRYLAVGTYVGVATVGASMWWFLLYEEGPQITYYQLTHWMRCEIEPDNFADLDCAVFEDNHPNAMALSVLVTIEMLNAINSLSENQSLLVMPPWKNIWLMAAISLSMSLHFVILYVDIMATIFQITPLNWVEWIAVLKISLPVLLLDEILKFIARNYIDGKPETV 873          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: SERCA (gene:FBgn0263006 transcript:FBtr0072216)

HSP 1 Score: 1496.1 bits (3872), Expect = 0.000e+0
Identity = 739/996 (74.20%), Postives = 859/996 (86.24%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEG----SPKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTDGKN 3320
            ME+ H KTV++ LN+F  D E GL+ +Q+K   +++G NE+P EE K++WQL+LEQFDDLLVKILLLAAIISFVLALFEEHE++ TAFVEP VI+LILIANA+VGVWQERNAESAIEALKEYEPE+ KV R++  G+QK++A+E+VPGD+ +++VGDK+PADIRIT I+STT+RIDQSILTGESVSVIKH+DAIPDPRAVNQDKKN+LFSGTNVA+GK RGVVIGTGL T IGKIR +M ETE+ +TPLQQKLDEFG+QLSKVI++IC+AVWAINIGHFNDPAHGGSW++GAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV+RMF+F  +   + S  +FE+TGS Y P GEVFLNGQ+++  DY+TL E++ IC MCNDS+IDYNE K A+EKVGEATETAL  L EK+N  +++K+GL ++   +AC   I+  WKKEFTLEFSRDRKSMS Y  P K       PK+F KGAPEG+L+RC   RVG+ K+P+T+A+K++I+ +TG+YGTGRDTLRCLALA  D+P K ++M+L DS +FY+YE N+TFVGVVGMLDPPR EVFDSIV+CR AGIRVIVITGDNKATAEAICRRIGVF+E+E T GKSY+GREFDDLS   +K AV R++LF+RVEP HKSKIVE+LQ   E+SAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSA+EMVLADDNFS+IV+AVEEGRAIYNNMKQFIRYLISSN+GEVVSIFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM KPPR   E LI+GWLFFRYMA+G YVGAATVGAAAWWF    +GP+L+Y+QLTH   CL     F+GVDC IF  P  MTMALSVLV IEMLNAMNSLSENQSL+ MPPW NLWL+GSM LS +LHF+IL VD LS VFQ+TPLS EEW  V+K S PV+LLDE LK +ARK  DG++
Sbjct:    1 MEDGHSKTVEQSLNFFGTDPERGLTLDQIKANQKKYGPNELPTEEGKSIWQLVLEQFDDLLVKILLLAAIISFVLALFEEHEETFTAFVEPLVILLILIANAVVGVWQERNAESAIEALKEYEPEMGKVVRQDKSGIQKVRAKEIVPGDLVEVSVGDKIPADIRITHIYSTTLRIDQSILTGESVSVIKHTDAIPDPRAVNQDKKNILFSGTNVAAGKARGVVIGTGLSTAIGKIRTEMSETEEIKTPLQQKLDEFGEQLSKVISVICVAVWAINIGHFNDPAHGGSWIKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRMFIFDKVEGNDSSFLEFEMTGSTYEPIGEVFLNGQRIKAADYDTLQELSTICIMCNDSAIDYNEFKQAFEKVGEATETALIVLAEKLNSFSVNKSGLDRRSAAIACRGEIETKWKKEFTLEFSRDRKSMSSYCTPLKASRLGTGPKLFVKGAPEGVLERCTHARVGTTKVPLTSALKAKILALTGQYGTGRDTLRCLALAVADSPMKPDEMDLGDSTKFYQYEVNLTFVGVVGMLDPPRKEVFDSIVRCRAAGIRVIVITGDNKATAEAICRRIGVFAEDEDTTGKSYSGREFDDLSPTEQKAAVARSRLFSRVEPQHKSKIVEFLQSMNEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLADDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKPPRKADEGLISGWLFFRYMAIGFYVGAATVGAAAWWFVFSDEGPKLSYWQLTHHLSCLGGGDEFKGVDCKIFSDPHAMTMALSVLVTIEMLNAMNSLSENQSLITMPPWCNLWLIGSMALSFTLHFVILYVDVLSTVFQVTPLSAEEWITVMKFSIPVVLLDETLKFVARKIADGES 996          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: SERCA (gene:FBgn0263006 transcript:FBtr0072211)

HSP 1 Score: 1496.1 bits (3872), Expect = 0.000e+0
Identity = 739/996 (74.20%), Postives = 859/996 (86.24%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEG----SPKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTDGKN 3320
            ME+ H KTV++ LN+F  D E GL+ +Q+K   +++G NE+P EE K++WQL+LEQFDDLLVKILLLAAIISFVLALFEEHE++ TAFVEP VI+LILIANA+VGVWQERNAESAIEALKEYEPE+ KV R++  G+QK++A+E+VPGD+ +++VGDK+PADIRIT I+STT+RIDQSILTGESVSVIKH+DAIPDPRAVNQDKKN+LFSGTNVA+GK RGVVIGTGL T IGKIR +M ETE+ +TPLQQKLDEFG+QLSKVI++IC+AVWAINIGHFNDPAHGGSW++GAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV+RMF+F  +   + S  +FE+TGS Y P GEVFLNGQ+++  DY+TL E++ IC MCNDS+IDYNE K A+EKVGEATETAL  L EK+N  +++K+GL ++   +AC   I+  WKKEFTLEFSRDRKSMS Y  P K       PK+F KGAPEG+L+RC   RVG+ K+P+T+A+K++I+ +TG+YGTGRDTLRCLALA  D+P K ++M+L DS +FY+YE N+TFVGVVGMLDPPR EVFDSIV+CR AGIRVIVITGDNKATAEAICRRIGVF+E+E T GKSY+GREFDDLS   +K AV R++LF+RVEP HKSKIVE+LQ   E+SAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSA+EMVLADDNFS+IV+AVEEGRAIYNNMKQFIRYLISSN+GEVVSIFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM KPPR   E LI+GWLFFRYMA+G YVGAATVGAAAWWF    +GP+L+Y+QLTH   CL     F+GVDC IF  P  MTMALSVLV IEMLNAMNSLSENQSL+ MPPW NLWL+GSM LS +LHF+IL VD LS VFQ+TPLS EEW  V+K S PV+LLDE LK +ARK  DG++
Sbjct:    1 MEDGHSKTVEQSLNFFGTDPERGLTLDQIKANQKKYGPNELPTEEGKSIWQLVLEQFDDLLVKILLLAAIISFVLALFEEHEETFTAFVEPLVILLILIANAVVGVWQERNAESAIEALKEYEPEMGKVVRQDKSGIQKVRAKEIVPGDLVEVSVGDKIPADIRITHIYSTTLRIDQSILTGESVSVIKHTDAIPDPRAVNQDKKNILFSGTNVAAGKARGVVIGTGLSTAIGKIRTEMSETEEIKTPLQQKLDEFGEQLSKVISVICVAVWAINIGHFNDPAHGGSWIKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRMFIFDKVEGNDSSFLEFEMTGSTYEPIGEVFLNGQRIKAADYDTLQELSTICIMCNDSAIDYNEFKQAFEKVGEATETALIVLAEKLNSFSVNKSGLDRRSAAIACRGEIETKWKKEFTLEFSRDRKSMSSYCTPLKASRLGTGPKLFVKGAPEGVLERCTHARVGTTKVPLTSALKAKILALTGQYGTGRDTLRCLALAVADSPMKPDEMDLGDSTKFYQYEVNLTFVGVVGMLDPPRKEVFDSIVRCRAAGIRVIVITGDNKATAEAICRRIGVFAEDEDTTGKSYSGREFDDLSPTEQKAAVARSRLFSRVEPQHKSKIVEFLQSMNEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLADDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKPPRKADEGLISGWLFFRYMAIGFYVGAATVGAAAWWFVFSDEGPKLSYWQLTHHLSCLGGGDEFKGVDCKIFSDPHAMTMALSVLVTIEMLNAMNSLSENQSLITMPPWCNLWLIGSMALSFTLHFVILYVDVLSTVFQVTPLSAEEWITVMKFSIPVVLLDETLKFVARKIADGES 996          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: SERCA (gene:FBgn0263006 transcript:FBtr0072214)

HSP 1 Score: 1496.1 bits (3872), Expect = 0.000e+0
Identity = 739/996 (74.20%), Postives = 859/996 (86.24%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEG----SPKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTDGKN 3320
            ME+ H KTV++ LN+F  D E GL+ +Q+K   +++G NE+P EE K++WQL+LEQFDDLLVKILLLAAIISFVLALFEEHE++ TAFVEP VI+LILIANA+VGVWQERNAESAIEALKEYEPE+ KV R++  G+QK++A+E+VPGD+ +++VGDK+PADIRIT I+STT+RIDQSILTGESVSVIKH+DAIPDPRAVNQDKKN+LFSGTNVA+GK RGVVIGTGL T IGKIR +M ETE+ +TPLQQKLDEFG+QLSKVI++IC+AVWAINIGHFNDPAHGGSW++GAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV+RMF+F  +   + S  +FE+TGS Y P GEVFLNGQ+++  DY+TL E++ IC MCNDS+IDYNE K A+EKVGEATETAL  L EK+N  +++K+GL ++   +AC   I+  WKKEFTLEFSRDRKSMS Y  P K       PK+F KGAPEG+L+RC   RVG+ K+P+T+A+K++I+ +TG+YGTGRDTLRCLALA  D+P K ++M+L DS +FY+YE N+TFVGVVGMLDPPR EVFDSIV+CR AGIRVIVITGDNKATAEAICRRIGVF+E+E T GKSY+GREFDDLS   +K AV R++LF+RVEP HKSKIVE+LQ   E+SAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSA+EMVLADDNFS+IV+AVEEGRAIYNNMKQFIRYLISSN+GEVVSIFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM KPPR   E LI+GWLFFRYMA+G YVGAATVGAAAWWF    +GP+L+Y+QLTH   CL     F+GVDC IF  P  MTMALSVLV IEMLNAMNSLSENQSL+ MPPW NLWL+GSM LS +LHF+IL VD LS VFQ+TPLS EEW  V+K S PV+LLDE LK +ARK  DG++
Sbjct:    1 MEDGHSKTVEQSLNFFGTDPERGLTLDQIKANQKKYGPNELPTEEGKSIWQLVLEQFDDLLVKILLLAAIISFVLALFEEHEETFTAFVEPLVILLILIANAVVGVWQERNAESAIEALKEYEPEMGKVVRQDKSGIQKVRAKEIVPGDLVEVSVGDKIPADIRITHIYSTTLRIDQSILTGESVSVIKHTDAIPDPRAVNQDKKNILFSGTNVAAGKARGVVIGTGLSTAIGKIRTEMSETEEIKTPLQQKLDEFGEQLSKVISVICVAVWAINIGHFNDPAHGGSWIKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRMFIFDKVEGNDSSFLEFEMTGSTYEPIGEVFLNGQRIKAADYDTLQELSTICIMCNDSAIDYNEFKQAFEKVGEATETALIVLAEKLNSFSVNKSGLDRRSAAIACRGEIETKWKKEFTLEFSRDRKSMSSYCTPLKASRLGTGPKLFVKGAPEGVLERCTHARVGTTKVPLTSALKAKILALTGQYGTGRDTLRCLALAVADSPMKPDEMDLGDSTKFYQYEVNLTFVGVVGMLDPPRKEVFDSIVRCRAAGIRVIVITGDNKATAEAICRRIGVFAEDEDTTGKSYSGREFDDLSPTEQKAAVARSRLFSRVEPQHKSKIVEFLQSMNEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLADDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKPPRKADEGLISGWLFFRYMAIGFYVGAATVGAAAWWFVFSDEGPKLSYWQLTHHLSCLGGGDEFKGVDCKIFSDPHAMTMALSVLVTIEMLNAMNSLSENQSLITMPPWCNLWLIGSMALSFTLHFVILYVDVLSTVFQVTPLSAEEWITVMKFSIPVVLLDETLKFVARKIADGES 996          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: SERCA (gene:FBgn0263006 transcript:FBtr0072212)

HSP 1 Score: 1496.1 bits (3872), Expect = 0.000e+0
Identity = 739/996 (74.20%), Postives = 859/996 (86.24%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEG----SPKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTDGKN 3320
            ME+ H KTV++ LN+F  D E GL+ +Q+K   +++G NE+P EE K++WQL+LEQFDDLLVKILLLAAIISFVLALFEEHE++ TAFVEP VI+LILIANA+VGVWQERNAESAIEALKEYEPE+ KV R++  G+QK++A+E+VPGD+ +++VGDK+PADIRIT I+STT+RIDQSILTGESVSVIKH+DAIPDPRAVNQDKKN+LFSGTNVA+GK RGVVIGTGL T IGKIR +M ETE+ +TPLQQKLDEFG+QLSKVI++IC+AVWAINIGHFNDPAHGGSW++GAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV+RMF+F  +   + S  +FE+TGS Y P GEVFLNGQ+++  DY+TL E++ IC MCNDS+IDYNE K A+EKVGEATETAL  L EK+N  +++K+GL ++   +AC   I+  WKKEFTLEFSRDRKSMS Y  P K       PK+F KGAPEG+L+RC   RVG+ K+P+T+A+K++I+ +TG+YGTGRDTLRCLALA  D+P K ++M+L DS +FY+YE N+TFVGVVGMLDPPR EVFDSIV+CR AGIRVIVITGDNKATAEAICRRIGVF+E+E T GKSY+GREFDDLS   +K AV R++LF+RVEP HKSKIVE+LQ   E+SAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSA+EMVLADDNFS+IV+AVEEGRAIYNNMKQFIRYLISSN+GEVVSIFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM KPPR   E LI+GWLFFRYMA+G YVGAATVGAAAWWF    +GP+L+Y+QLTH   CL     F+GVDC IF  P  MTMALSVLV IEMLNAMNSLSENQSL+ MPPW NLWL+GSM LS +LHF+IL VD LS VFQ+TPLS EEW  V+K S PV+LLDE LK +ARK  DG++
Sbjct:    1 MEDGHSKTVEQSLNFFGTDPERGLTLDQIKANQKKYGPNELPTEEGKSIWQLVLEQFDDLLVKILLLAAIISFVLALFEEHEETFTAFVEPLVILLILIANAVVGVWQERNAESAIEALKEYEPEMGKVVRQDKSGIQKVRAKEIVPGDLVEVSVGDKIPADIRITHIYSTTLRIDQSILTGESVSVIKHTDAIPDPRAVNQDKKNILFSGTNVAAGKARGVVIGTGLSTAIGKIRTEMSETEEIKTPLQQKLDEFGEQLSKVISVICVAVWAINIGHFNDPAHGGSWIKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRMFIFDKVEGNDSSFLEFEMTGSTYEPIGEVFLNGQRIKAADYDTLQELSTICIMCNDSAIDYNEFKQAFEKVGEATETALIVLAEKLNSFSVNKSGLDRRSAAIACRGEIETKWKKEFTLEFSRDRKSMSSYCTPLKASRLGTGPKLFVKGAPEGVLERCTHARVGTTKVPLTSALKAKILALTGQYGTGRDTLRCLALAVADSPMKPDEMDLGDSTKFYQYEVNLTFVGVVGMLDPPRKEVFDSIVRCRAAGIRVIVITGDNKATAEAICRRIGVFAEDEDTTGKSYSGREFDDLSPTEQKAAVARSRLFSRVEPQHKSKIVEFLQSMNEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLADDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKPPRKADEGLISGWLFFRYMAIGFYVGAATVGAAAWWFVFSDEGPKLSYWQLTHHLSCLGGGDEFKGVDCKIFSDPHAMTMALSVLVTIEMLNAMNSLSENQSLITMPPWCNLWLIGSMALSFTLHFVILYVDVLSTVFQVTPLSAEEWITVMKFSIPVVLLDETLKFVARKIADGES 996          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: SERCA (gene:FBgn0263006 transcript:FBtr0072217)

HSP 1 Score: 1496.1 bits (3872), Expect = 0.000e+0
Identity = 739/996 (74.20%), Postives = 859/996 (86.24%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEG----SPKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTDGKN 3320
            ME+ H KTV++ LN+F  D E GL+ +Q+K   +++G NE+P EE K++WQL+LEQFDDLLVKILLLAAIISFVLALFEEHE++ TAFVEP VI+LILIANA+VGVWQERNAESAIEALKEYEPE+ KV R++  G+QK++A+E+VPGD+ +++VGDK+PADIRIT I+STT+RIDQSILTGESVSVIKH+DAIPDPRAVNQDKKN+LFSGTNVA+GK RGVVIGTGL T IGKIR +M ETE+ +TPLQQKLDEFG+QLSKVI++IC+AVWAINIGHFNDPAHGGSW++GAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV+RMF+F  +   + S  +FE+TGS Y P GEVFLNGQ+++  DY+TL E++ IC MCNDS+IDYNE K A+EKVGEATETAL  L EK+N  +++K+GL ++   +AC   I+  WKKEFTLEFSRDRKSMS Y  P K       PK+F KGAPEG+L+RC   RVG+ K+P+T+A+K++I+ +TG+YGTGRDTLRCLALA  D+P K ++M+L DS +FY+YE N+TFVGVVGMLDPPR EVFDSIV+CR AGIRVIVITGDNKATAEAICRRIGVF+E+E T GKSY+GREFDDLS   +K AV R++LF+RVEP HKSKIVE+LQ   E+SAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSA+EMVLADDNFS+IV+AVEEGRAIYNNMKQFIRYLISSN+GEVVSIFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM KPPR   E LI+GWLFFRYMA+G YVGAATVGAAAWWF    +GP+L+Y+QLTH   CL     F+GVDC IF  P  MTMALSVLV IEMLNAMNSLSENQSL+ MPPW NLWL+GSM LS +LHF+IL VD LS VFQ+TPLS EEW  V+K S PV+LLDE LK +ARK  DG++
Sbjct:    1 MEDGHSKTVEQSLNFFGTDPERGLTLDQIKANQKKYGPNELPTEEGKSIWQLVLEQFDDLLVKILLLAAIISFVLALFEEHEETFTAFVEPLVILLILIANAVVGVWQERNAESAIEALKEYEPEMGKVVRQDKSGIQKVRAKEIVPGDLVEVSVGDKIPADIRITHIYSTTLRIDQSILTGESVSVIKHTDAIPDPRAVNQDKKNILFSGTNVAAGKARGVVIGTGLSTAIGKIRTEMSETEEIKTPLQQKLDEFGEQLSKVISVICVAVWAINIGHFNDPAHGGSWIKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRMFIFDKVEGNDSSFLEFEMTGSTYEPIGEVFLNGQRIKAADYDTLQELSTICIMCNDSAIDYNEFKQAFEKVGEATETALIVLAEKLNSFSVNKSGLDRRSAAIACRGEIETKWKKEFTLEFSRDRKSMSSYCTPLKASRLGTGPKLFVKGAPEGVLERCTHARVGTTKVPLTSALKAKILALTGQYGTGRDTLRCLALAVADSPMKPDEMDLGDSTKFYQYEVNLTFVGVVGMLDPPRKEVFDSIVRCRAAGIRVIVITGDNKATAEAICRRIGVFAEDEDTTGKSYSGREFDDLSPTEQKAAVARSRLFSRVEPQHKSKIVEFLQSMNEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLADDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKPPRKADEGLISGWLFFRYMAIGFYVGAATVGAAAWWFVFSDEGPKLSYWQLTHHLSCLGGGDEFKGVDCKIFSDPHAMTMALSVLVTIEMLNAMNSLSENQSLITMPPWCNLWLIGSMALSFTLHFVILYVDVLSTVFQVTPLSAEEWITVMKFSIPVVLLDETLKFVARKIADGES 996          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: atp2a3 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 3 [Source:ZFIN;Acc:ZDB-GENE-060531-103])

HSP 1 Score: 1429.85 bits (3700), Expect = 0.000e+0
Identity = 710/1004 (70.72%), Postives = 834/1004 (83.07%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGS-PKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTDGKNKHVHYTDLKQM 3353
            MEN+H K+  EVL  F V+E  GL+ EQVK   +++G NE+PAEE K+LW+L++EQF+DLLV+ILLLAA +SFVLALFEE E+S TAFVEP VI+LIL+ANA++GVWQERNAE+AIEALKEYEPE+ KVYR N   VQ+IKAR++VPGDI +I+VGDKVPADIRIT I STT+R+DQSILTGESVSVIKH+D +PDPRAVNQDKKN+LFSGTN+A+G+  GVV+ TG+ TEIGKIRNQM  TEQE+TPLQQKLDEFGQQLSKVI++ICIAVW INIGHF DP HGGSW+RGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV RMFV +   ++  S H+F I+GS YAPEGEV    ++V+ GDY+ L+E+A IC++CNDSS+DYNE K  YEKVGEATETALT LVEKMNV     +GL+K     ACN  I+   +K+FTLEFSRDRKSMS Y  P    S  KMF KGAPEG++DRC FVRVG ++ P+T A+K E+M    ++GTGRDTLRCLALAT D+P   ++M+LE++ +F +YE+++TFVG VGMLDPPR EV  SI  C  AGIRVI+ITGDNK TA AICRRIG+FSENE   G++YTGREFDDL+ E ++EAV+RA+ FARVEPAHKSKIV YLQ   E++AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVL+DDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVV IFLTA LG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM KPPR+ +EPLI+GWLFFRY+A+G YVG  TV AA WW+     GPQ+++YQL H  QC  +   FEG++C +F    P TMALSVLV IEM NA+NSLSENQSLL+MPPWVN+WL+G+++LS+SLHFLIL V+ L  +FQ+TPL   +W  V KIS PVILLDE LK I+R   +G+ +   Y   +Q+
Sbjct:    1 MENAHTKSASEVLANFGVNENTGLTLEQVKNNFDKYGPNELPAEEGKSLWELVVEQFEDLLVRILLLAACVSFVLALFEEGEESTTAFVEPIVILLILVANAVIGVWQERNAENAIEALKEYEPEMGKVYRMNRTAVQRIKARDIVPGDIVEISVGDKVPADIRITSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGRAIGVVVSTGVSTEIGKIRNQMAATEQEKTPLQQKLDEFGQQLSKVISLICIAVWVINIGHFADPVHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFVVNKADDSSCSLHEFTISGSTYAPEGEVLKADKQVQCGDYDGLVELATICSLCNDSSLDYNEAKGVYEKVGEATETALTTLVEKMNVFKTDLSGLSKVDRAAACNLIIRQLMQKKFTLEFSRDRKSMSVYCTPNGTNSQSKMFVKGAPEGVIDRCQFVRVGKERFPLTMAVKEELMSTIRDWGTGRDTLRCLALATRDSPPAVDKMDLENAGKFAEYESSLTFVGCVGMLDPPRKEVIGSIKLCNKAGIRVIMITGDNKGTAVAICRRIGIFSENEDVEGRAYTGREFDDLAPEAQREAVKRARCFARVEPAHKSKIVAYLQSFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLSDDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAILGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDKPPRNPKEPLISGWLFFRYLAIGGYVGLGTVSAATWWYLFDEDGPQVSFYQLRHFMQCTEENPMFEGINCEVFESRYPTTMALSVLVTIEMFNALNSLSENQSLLRMPPWVNIWLLGAIILSLSLHFLILHVEPLPLIFQVTPLHFSQWIIVFKISIPVILLDEALKYISRHHLEGEEED-RYRKNRQL 1003          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: atp2a1 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1 [Source:ZFIN;Acc:ZDB-GENE-020905-1])

HSP 1 Score: 1429.08 bits (3698), Expect = 0.000e+0
Identity = 709/999 (70.97%), Postives = 840/999 (84.08%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGSP----KMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTDGKNKHV 3329
            MEN+H K   E L YF V E  GL+ EQVK+   ++GFNE+PAEE K++W+L++EQF+DLLV+ILLLAA ISFVLA FEE E+++TAFVEPFVI+LILIANA+VGVWQERNAESAIEALKEYEPE+ KVYR + K VQ+IKARE+VPGDI +++VGDKVPADIRIT I STT+R+DQSILTGESVSVIKH++++PDPRAVNQDKKN+LFSGTN+A+GK  GVV+ TG+ TEIGKIR+QM  TEQE+TPLQQKLDEFG+QLSKVI++IC+AVW INIGHFNDP HGGSW+RGA+YYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM V +MFV   +    ++  Q++I+GSKY PEGEV  NG  V+ G ++ L+E+A ICA+CNDSS+DYNE+K  YEKVGEATETAL CLVEKMNV N    GL+K +    C   I+   KK+FTLEFSRDRKSMS Y +PAK        KMF KGAPEG++DRCA+VRVG+ ++P+T  +K +IM +  E+GTGRDTLRCLALAT DNP + E+MNLEDS +F +YET++TFVG VGMLDPPR EV  SI  CR AGIRVI+ITGDNK TA AICRRIG+FS++E   G+++TGREFDDL    ++EAVR+A  +ARVEP+HKSKIVE+LQ   E++AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFS+IVAAVEEGRAIYNNMKQFIRYLISSNVGEVV IFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM K PRS +EPLI+GWLFFRY+A+G YVGAATV AA WWF    +GP +++YQL+H  QC A    F G++C +F    PMTMALSVLV IEM NA+NSLSENQSLL+MPPW NLWL G+M LSMSLHF+I+ VD L  +F++T L+ ++W  V+K+SFPVIL+DE LK +AR + + K++++
Sbjct:    1 MENAHTKETPECLAYFGVSESTGLTPEQVKKNQAKYGFNELPAEEGKSIWELVVEQFEDLLVRILLLAACISFVLAWFEEGEETVTAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYEPEMGKVYRSDRKSVQRIKAREIVPGDIVEVSVGDKVPADIRITAIRSTTLRVDQSILTGESVSVIKHTESVPDPRAVNQDKKNMLFSGTNIAAGKAIGVVVATGVSTEIGKIRDQMAATEQEKTPLQQKLDEFGEQLSKVISLICVAVWLINIGHFNDPVHGGSWIRGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMCVTKMFVIEKVEGESVTLDQYDISGSKYTPEGEVTKNGLPVKCGQFDGLVELATICALCNDSSLDYNESKGIYEKVGEATETALCCLVEKMNVFNTDVRGLSKVERANTCCAVIKQLMKKDFTLEFSRDRKSMSVYCSPAKASKAPVGNKMFVKGAPEGVIDRCAYVRVGTTRVPLTGPVKDKIMAVIKEWGTGRDTLRCLALATRDNPLRPEEMNLEDSTKFAEYETDLTFVGCVGMLDPPRKEVVGSIELCRAAGIRVIMITGDNKGTAVAICRRIGIFSDDEDVTGRAFTGREFDDLPLPQQREAVRKACCYARVEPSHKSKIVEFLQGFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSSIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMGKAPRSPKEPLISGWLFFRYLAIGGYVGAATVAAAGWWFLYCDEGPMVSFYQLSHFMQCTADNEDFAGIECEVFEAAPPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWSNLWLAGAMTLSMSLHFMIIYVDPLPMIFKLTHLNFDQWIVVLKLSFPVILIDEALKFVARNYLEEKDQNL 999          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: atp2a3 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 3 [Source:ZFIN;Acc:ZDB-GENE-060531-103])

HSP 1 Score: 1427.54 bits (3694), Expect = 0.000e+0
Identity = 707/986 (71.70%), Postives = 826/986 (83.77%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGS-PKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIAR 3299
            MEN+H K+  EVL  F V+E  GL+ EQVK   +++G NE+PAEE K+LW+L++EQF+DLLV+ILLLAA +SFVLALFEE E+S TAFVEP VI+LIL+ANA++GVWQERNAE+AIEALKEYEPE+ KVYR N   VQ+IKAR++VPGDI +I+VGDKVPADIRIT I STT+R+DQSILTGESVSVIKH+D +PDPRAVNQDKKN+LFSGTN+A+G+  GVV+ TG+ TEIGKIRNQM  TEQE+TPLQQKLDEFGQQLSKVI++ICIAVW INIGHF DP HGGSW+RGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV RMFV +   ++  S H+F I+GS YAPEGEV    ++V+ GDY+ L+E+A IC++CNDSS+DYNE K  YEKVGEATETALT LVEKMNV     +GL+K     ACN  I+   +K+FTLEFSRDRKSMS Y  P    S  KMF KGAPEG++DRC FVRVG ++ P+T A+K E+M    ++GTGRDTLRCLALAT D+P   ++M+LE++ +F +YE+++TFVG VGMLDPPR EV  SI  C  AGIRVI+ITGDNK TA AICRRIG+FSENE   G++YTGREFDDL+ E ++EAV+RA+ FARVEPAHKSKIV YLQ   E++AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVL+DDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVV IFLTA LG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM KPPR+ +EPLI+GWLFFRY+A+G YVG  TV AA WW+     GPQ+++YQL H  QC  +   FEG++C +F    P TMALSVLV IEM NA+NSLSENQSLL+MPPWVN+WL+G+++LS+SLHFLIL V+ L  +FQ+TPL   +W  V KIS PVILLDE LK I+R
Sbjct:    1 MENAHTKSASEVLANFGVNENTGLTLEQVKNNFDKYGPNELPAEEGKSLWELVVEQFEDLLVRILLLAACVSFVLALFEEGEESTTAFVEPIVILLILVANAVIGVWQERNAENAIEALKEYEPEMGKVYRMNRTAVQRIKARDIVPGDIVEISVGDKVPADIRITSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGRAIGVVVSTGVSTEIGKIRNQMAATEQEKTPLQQKLDEFGQQLSKVISLICIAVWVINIGHFADPVHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFVVNKADDSSCSLHEFTISGSTYAPEGEVLKADKQVQCGDYDGLVELATICSLCNDSSLDYNEAKGVYEKVGEATETALTTLVEKMNVFKTDLSGLSKVDRAAACNLIIRQLMQKKFTLEFSRDRKSMSVYCTPNGTNSQSKMFVKGAPEGVIDRCQFVRVGKERFPLTMAVKEELMSTIRDWGTGRDTLRCLALATRDSPPAVDKMDLENAGKFAEYESSLTFVGCVGMLDPPRKEVIGSIKLCNKAGIRVIMITGDNKGTAVAICRRIGIFSENEDVEGRAYTGREFDDLAPEAQREAVKRARCFARVEPAHKSKIVAYLQSFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLSDDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAILGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDKPPRNPKEPLISGWLFFRYLAIGGYVGLGTVSAATWWYLFDEDGPQVSFYQLRHFMQCTEENPMFEGINCEVFESRYPTTMALSVLVTIEMFNALNSLSENQSLLRMPPWVNIWLLGAIILSLSLHFLILHVEPLPLIFQVTPLHFSQWIIVFKISIPVILLDEALKYISR 986          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: atp2a1l (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1, like [Source:ZFIN;Acc:ZDB-GENE-041229-2])

HSP 1 Score: 1427.15 bits (3693), Expect = 0.000e+0
Identity = 712/990 (71.92%), Postives = 827/990 (83.54%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAK-EGSPKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTD 3311
            ME++H K   E L YF+V E  GLS EQ K+ + ++G+NE+PAEE K++W+LI+EQF+DLLV+ILLLAA ISFVLA FEE E++ITAFVEPFVI+LILIANA+VGVWQERNAESAIEALKEYEPE+ KVYR + K VQ IKARE+VPGDI +++VGDKVPADIRIT I STT+R+DQSILTGESVSVIKH++ +PDPRAVNQDKKN+LFSGTN+A+GK  GV + TG+ TEIGKIR+QM  TEQE+TPLQQKLDEFG+QLSKVI++IC+AVW INIGHFNDP HGGSW+RGA+YYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM V +MFV   I    +    F+I+GSKY PEGEV   G KV    Y+ L+E+A ICA+CNDSS+DYNETK  YEKVGEATETAL CLVEKMNV   +   L+K +   AC   ++   KK FTLEFSRDRKSMS Y  P K +   KMF KGAPEG++DRC +VRVGS ++P+T A+K +IM +  E+GTGRDTLRCLALAT D+P K E+MNLEDS +F  YET++TFVG VGMLDPPR EV  SI  CR AGIRVI+ITGDNK TA AICRRIG+FSE+E   GK+YTGREFDDL    + EAVRRA  FARVEP+HKSKIVE+LQ   E++AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFS+IVAAVEEGRAIYNNMKQFIRYLISSN+GEVV IFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDL+IM KPPRS +EPLI+GWLFFRYM VG YVGAATV AAA+WF    +GPQ+ YYQL+H  QC  +   F G++C +F    PMTMALSVLV IEM NA+NSLSENQSL++MPPW N WL+ +M LSMSLHF+I+ VD +  +F++T L+ E+WF V+K+SFPVIL+DE+LK +AR + D
Sbjct:    1 MEDAHTKGPAECLAYFSVSETTGLSPEQFKKNLAKYGYNELPAEEGKSIWELIIEQFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYEPEMGKVYRSDRKSVQMIKAREIVPGDIVEVSVGDKVPADIRITHIRSTTLRVDQSILTGESVSVIKHTEPVPDPRAVNQDKKNMLFSGTNIAAGKAVGVAVATGVATEIGKIRDQMAATEQEKTPLQQKLDEFGEQLSKVISLICVAVWMINIGHFNDPVHGGSWIRGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMCVTKMFVIDRIDGDHVELDSFDISGSKYTPEGEVTKLGAKVDCSQYDGLVELATICALCNDSSLDYNETKKIYEKVGEATETALCCLVEKMNVFKSNVGNLSKVERANACCSVVKQLMKKNFTLEFSRDRKSMSVYCTPVKGDAGSKMFVKGAPEGVIDRCTYVRVGSTRVPLTGAVKDKIMNVIKEWGTGRDTLRCLALATRDSPLKVEEMNLEDSTKFADYETDLTFVGCVGMLDPPRKEVTGSIELCRAAGIRVIMITGDNKGTAVAICRRIGIFSEDEDVTGKAYTGREFDDLPHSEQSEAVRRACCFARVEPSHKSKIVEFLQGYDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSSIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLEIMGKPPRSPKEPLISGWLFFRYMTVGAYVGAATVAAAAYWFIYDEEGPQVTYYQLSHFMQCHEENEDFTGIECEVFEACPPMTMALSVLVTIEMCNALNSLSENQSLVRMPPWSNGWLLSAMTLSMSLHFMIIYVDPMPMIFRLTHLNTEQWFVVLKLSFPVILIDEMLKFLARNYVD 990          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: atp2a1 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1 [Source:ZFIN;Acc:ZDB-GENE-020905-1])

HSP 1 Score: 1426.77 bits (3692), Expect = 0.000e+0
Identity = 708/994 (71.23%), Postives = 835/994 (84.00%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGSP----KMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTDG 3314
            MEN+H K   E L YF V E  GL+ EQVK+   ++GFNE+PAEE K++W+L++EQF+DLLV+ILLLAA ISFVLA FEE E+++TAFVEPFVI+LILIANA+VGVWQERNAESAIEALKEYEPE+ KVYR + K VQ+IKARE+VPGDI +++VGDKVPADIRIT I STT+R+DQSILTGESVSVIKH++++PDPRAVNQDKKN+LFSGTN+A+GK  GVV+ TG+ TEIGKIR+QM  TEQE+TPLQQKLDEFG+QLSKVI++IC+AVW INIGHFNDP HGGSW+RGA+YYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM V +MFV   +    ++  Q++I+GSKY PEGEV  NG  V+ G ++ L+E+A ICA+CNDSS+DYNE+K  YEKVGEATETAL CLVEKMNV N    GL+K +    C   I+   KK+FTLEFSRDRKSMS Y +PAK        KMF KGAPEG++DRCA+VRVG+ ++P+T  +K +IM +  E+GTGRDTLRCLALAT DNP + E+MNLEDS +F +YET++TFVG VGMLDPPR EV  SI  CR AGIRVI+ITGDNK TA AICRRIG+FS++E   G+++TGREFDDL    ++EAVR+A  +ARVEP+HKSKIVE+LQ   E++AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFS+IVAAVEEGRAIYNNMKQFIRYLISSNVGEVV IFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM K PRS +EPLI+GWLFFRY+A+G YVGAATV AA WWF    +GP +++YQL+H  QC A    F G++C +F    PMTMALSVLV IEM NA+NSLSENQSLL+MPPW NLWL G+M LSMSLHF+I+ VD L  +F++T L+ ++W  V+K+SFPVIL+DE LK +AR + + 
Sbjct:    1 MENAHTKETPECLAYFGVSESTGLTPEQVKKNQAKYGFNELPAEEGKSIWELVVEQFEDLLVRILLLAACISFVLAWFEEGEETVTAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYEPEMGKVYRSDRKSVQRIKAREIVPGDIVEVSVGDKVPADIRITAIRSTTLRVDQSILTGESVSVIKHTESVPDPRAVNQDKKNMLFSGTNIAAGKAIGVVVATGVSTEIGKIRDQMAATEQEKTPLQQKLDEFGEQLSKVISLICVAVWLINIGHFNDPVHGGSWIRGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMCVTKMFVIEKVEGESVTLDQYDISGSKYTPEGEVTKNGLPVKCGQFDGLVELATICALCNDSSLDYNESKGIYEKVGEATETALCCLVEKMNVFNTDVRGLSKVERANTCCAVIKQLMKKDFTLEFSRDRKSMSVYCSPAKASKAPVGNKMFVKGAPEGVIDRCAYVRVGTTRVPLTGPVKDKIMAVIKEWGTGRDTLRCLALATRDNPLRPEEMNLEDSTKFAEYETDLTFVGCVGMLDPPRKEVVGSIELCRAAGIRVIMITGDNKGTAVAICRRIGIFSDDEDVTGRAFTGREFDDLPLPQQREAVRKACCYARVEPSHKSKIVEFLQGFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSSIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMGKAPRSPKEPLISGWLFFRYLAIGGYVGAATVAAAGWWFLYCDEGPMVSFYQLSHFMQCTADNEDFAGIECEVFEAAPPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWSNLWLAGAMTLSMSLHFMIIYVDPLPMIFKLTHLNFDQWIVVLKLSFPVILIDEALKFVARNYLEA 994          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: ATP2A2 (ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 [Source:NCBI gene;Acc:100489059])

HSP 1 Score: 1435.62 bits (3715), Expect = 0.000e+0
Identity = 724/992 (72.98%), Postives = 840/992 (84.68%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGS---PKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTD 3311
            MEN+H KTV+EVL +FNV+E  GLS EQVK+Q ER+G NE+PAEE K LW+L++EQF+DLLV+ILLLAA ISFVLA FEE E++ITAFVEPFVI+LIL+ANAIVGVWQERNAE+AIEALKEYEPE+ KVYR++ K VQ+IKAR++VPGDI ++AVGDKVPADIR+T I STT+R+DQSILTGESVSVIKH+D +PDPRAVNQDKKN+LFSGTN+A+GK  GVV+ TG++TEIGKIR++M+ TEQERTPLQQKLDEFG+QLSKVI++ICIAVW INIGHFNDP HGGSW+RGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV RMF+   +       ++F ITGS YAP GEV  + + V+   Y+ L+E+A ICA+CNDSS+D+NE K  YEKVGEATETALTCLVEKMNV +    GL++ +   ACN  I+   KKEFTLEFSRDRKSMS Y  P K       KMF KGAPEG++DRC  +RVGS K+P+TA IK +IM +  E+GTGRDTLRCLALAT DNP +KE MNLEDS  F  YETN+TFVG VGMLDPPRTEV  S+  CR AGIRVI+ITGDNK TA AICRR+G+F E+E    +++TGREFD+LS   +++A   A+ FARVEP+HKSKIVE+LQ   E++AMTGDGVNDAPALKKAEIGIAMGSGTAVAK+ASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVV IFLTAALG PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM+KPPR+ +EPLI+GWLFFRY+A+G YVGAATVGAAAWWF     GP++ +YQL+H  QC  +   F+GV+C IF  P PMTMALSVLV IEM NA+NSLSENQSLL+MPPW N+WL+GS+ LSMSLHFLIL V+ L  +FQITPL++ +W  V+KIS PVILLDE LK +AR + +
Sbjct:    1 MENAHTKTVEEVLAHFNVNESTGLSLEQVKKQKERWGANELPAEEGKTLWELVIEQFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALKEYEPEMGKVYRQDRKSVQRIKARDIVPGDIVEVAVGDKVPADIRLTSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAIGVVVATGVNTEIGKIRDEMVATEQERTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFIVDKVEGDNCFLNEFNITGSTYAPMGEVLKDDKLVKCHQYDGLVELATICALCNDSSLDFNEAKGVYEKVGEATETALTCLVEKMNVFDTDLKGLSRIERANACNSVIKQLMKKEFTLEFSRDRKSMSVYCTPNKPSRTSMSKMFVKGAPEGLIDRCTHIRVGSIKVPLTAGIKQKIMSVIREWGTGRDTLRCLALATHDNPPRKEDMNLEDSTNFINYETNLTFVGCVGMLDPPRTEVAASVKMCRQAGIRVIMITGDNKGTAVAICRRVGIFREDEDVSERAFTGREFDELSPAAQRDACLNARCFARVEPSHKSKIVEFLQSFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYVGAATVGAAAWWFIAAEDGPRITFYQLSHFLQCREENPDFDGVECEIFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWENVWLLGSICLSMSLHFLILYVEPLPLIFQITPLNLIQWLMVLKISLPVILLDETLKYVARNYLE 992          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: ATP2A2 (ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 [Source:NCBI gene;Acc:100489059])

HSP 1 Score: 1435.62 bits (3715), Expect = 0.000e+0
Identity = 725/995 (72.86%), Postives = 842/995 (84.62%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGS---PKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTDGKN 3320
            MEN+H KTV+EVL +FNV+E  GLS EQVK+Q ER+G NE+PAEE K LW+L++EQF+DLLV+ILLLAA ISFVLA FEE E++ITAFVEPFVI+LIL+ANAIVGVWQERNAE+AIEALKEYEPE+ KVYR++ K VQ+IKAR++VPGDI ++AVGDKVPADIR+T I STT+R+DQSILTGESVSVIKH+D +PDPRAVNQDKKN+LFSGTN+A+GK  GVV+ TG++TEIGKIR++M+ TEQERTPLQQKLDEFG+QLSKVI++ICIAVW INIGHFNDP HGGSW+RGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV RMF+   +       ++F ITGS YAP GEV  + + V+   Y+ L+E+A ICA+CNDSS+D+NE K  YEKVGEATETALTCLVEKMNV +    GL++ +   ACN  I+   KKEFTLEFSRDRKSMS Y  P K       KMF KGAPEG++DRC  +RVGS K+P+TA IK +IM +  E+GTGRDTLRCLALAT DNP +KE MNLEDS  F  YETN+TFVG VGMLDPPRTEV  S+  CR AGIRVI+ITGDNK TA AICRR+G+F E+E    +++TGREFD+LS   +++A   A+ FARVEP+HKSKIVE+LQ   E++AMTGDGVNDAPALKKAEIGIAMGSGTAVAK+ASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVV IFLTAALG PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM+KPPR+ +EPLI+GWLFFRY+A+G YVGAATVGAAAWWF     GP++ +YQL+H  QC  +   F+GV+C IF  P PMTMALSVLV IEM NA+NSLSENQSLL+MPPW N+WL+GS+ LSMSLHFLIL V+ L  +FQITPL++ +W  V+KIS PVILLDE LK +AR + + +N
Sbjct:    1 MENAHTKTVEEVLAHFNVNESTGLSLEQVKKQKERWGANELPAEEGKTLWELVIEQFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALKEYEPEMGKVYRQDRKSVQRIKARDIVPGDIVEVAVGDKVPADIRLTSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAIGVVVATGVNTEIGKIRDEMVATEQERTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFIVDKVEGDNCFLNEFNITGSTYAPMGEVLKDDKLVKCHQYDGLVELATICALCNDSSLDFNEAKGVYEKVGEATETALTCLVEKMNVFDTDLKGLSRIERANACNSVIKQLMKKEFTLEFSRDRKSMSVYCTPNKPSRTSMSKMFVKGAPEGLIDRCTHIRVGSIKVPLTAGIKQKIMSVIREWGTGRDTLRCLALATHDNPPRKEDMNLEDSTNFINYETNLTFVGCVGMLDPPRTEVAASVKMCRQAGIRVIMITGDNKGTAVAICRRVGIFREDEDVSERAFTGREFDELSPAAQRDACLNARCFARVEPSHKSKIVEFLQSFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYVGAATVGAAAWWFIAAEDGPRITFYQLSHFLQCREENPDFDGVECEIFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWENVWLLGSICLSMSLHFLILYVEPLPLIFQITPLNLIQWLMVLKISLPVILLDETLKYVARNYLEPEN 995          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: ATP2A2 (ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 [Source:NCBI gene;Acc:100489059])

HSP 1 Score: 1434.47 bits (3712), Expect = 0.000e+0
Identity = 724/992 (72.98%), Postives = 840/992 (84.68%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGS---PKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTD 3311
            MEN+H KTV+EVL +FNV+E  GLS EQVK+Q ER+G NE+PAEE K LW+L++EQF+DLLV+ILLLAA ISFVLA FEE E++ITAFVEPFVI+LIL+ANAIVGVWQERNAE+AIEALKEYEPE+ KVYR++ K VQ+IKAR++VPGDI ++AVGDKVPADIR+T I STT+R+DQSILTGESVSVIKH+D +PDPRAVNQDKKN+LFSGTN+A+GK  GVV+ TG++TEIGKIR++M+ TEQERTPLQQKLDEFG+QLSKVI++ICIAVW INIGHFNDP HGGSW+RGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV RMF+   +       ++F ITGS YAP GEV  + + V+   Y+ L+E+A ICA+CNDSS+D+NE K  YEKVGEATETALTCLVEKMNV +    GL++ +   ACN  I+   KKEFTLEFSRDRKSMS Y  P K       KMF KGAPEG++DRC  +RVGS K+P+TA IK +IM +  E+GTGRDTLRCLALAT DNP +KE MNLEDS  F  YETN+TFVG VGMLDPPRTEV  S+  CR AGIRVI+ITGDNK TA AICRR+G+F E+E    +++TGREFD+LS   +++A   A+ FARVEP+HKSKIVE+LQ   E++AMTGDGVNDAPALKKAEIGIAMGSGTAVAK+ASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVV IFLTAALG PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM+KPPR+ +EPLI+GWLFFRY+A+G YVGAATVGAAAWWF     GP++ +YQL+H  QC  +   F+GV+C IF  P PMTMALSVLV IEM NA+NSLSENQSLL+MPPW N+WL+GS+ LSMSLHFLIL V+ L  +FQITPL++ +W  V+KIS PVILLDE LK +AR + +
Sbjct:    1 MENAHTKTVEEVLAHFNVNESTGLSLEQVKKQKERWGANELPAEEGKTLWELVIEQFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALKEYEPEMGKVYRQDRKSVQRIKARDIVPGDIVEVAVGDKVPADIRLTSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAIGVVVATGVNTEIGKIRDEMVATEQERTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFIVDKVEGDNCFLNEFNITGSTYAPMGEVLKDDKLVKCHQYDGLVELATICALCNDSSLDFNEAKGVYEKVGEATETALTCLVEKMNVFDTDLKGLSRIERANACNSVIKQLMKKEFTLEFSRDRKSMSVYCTPNKPSRTSMSKMFVKGAPEGLIDRCTHIRVGSIKVPLTAGIKQKIMSVIREWGTGRDTLRCLALATHDNPPRKEDMNLEDSTNFINYETNLTFVGCVGMLDPPRTEVAASVKMCRQAGIRVIMITGDNKGTAVAICRRVGIFREDEDVSERAFTGREFDELSPAAQRDACLNARCFARVEPSHKSKIVEFLQSFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYVGAATVGAAAWWFIAAEDGPRITFYQLSHFLQCREENPDFDGVECEIFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWENVWLLGSICLSMSLHFLILYVEPLPLIFQITPLNLIQWLMVLKISLPVILLDETLKYVARNYLE 992          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: ATP2A2 (ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 [Source:NCBI gene;Acc:100489059])

HSP 1 Score: 1434.08 bits (3711), Expect = 0.000e+0
Identity = 724/992 (72.98%), Postives = 840/992 (84.68%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGS---PKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTD 3311
            MEN+H KTV+EVL +FNV+E  GLS EQVK+Q ER+G NE+PAEE K LW+L++EQF+DLLV+ILLLAA ISFVLA FEE E++ITAFVEPFVI+LIL+ANAIVGVWQERNAE+AIEALKEYEPE+ KVYR++ K VQ+IKAR++VPGDI ++AVGDKVPADIR+T I STT+R+DQSILTGESVSVIKH+D +PDPRAVNQDKKN+LFSGTN+A+GK  GVV+ TG++TEIGKIR++M+ TEQERTPLQQKLDEFG+QLSKVI++ICIAVW INIGHFNDP HGGSW+RGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV RMF+   +       ++F ITGS YAP GEV  + + V+   Y+ L+E+A ICA+CNDSS+D+NE K  YEKVGEATETALTCLVEKMNV +    GL++ +   ACN  I+   KKEFTLEFSRDRKSMS Y  P K       KMF KGAPEG++DRC  +RVGS K+P+TA IK +IM +  E+GTGRDTLRCLALAT DNP +KE MNLEDS  F  YETN+TFVG VGMLDPPRTEV  S+  CR AGIRVI+ITGDNK TA AICRR+G+F E+E    +++TGREFD+LS   +++A   A+ FARVEP+HKSKIVE+LQ   E++AMTGDGVNDAPALKKAEIGIAMGSGTAVAK+ASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVV IFLTAALG PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM+KPPR+ +EPLI+GWLFFRY+A+G YVGAATVGAAAWWF     GP++ +YQL+H  QC  +   F+GV+C IF  P PMTMALSVLV IEM NA+NSLSENQSLL+MPPW N+WL+GS+ LSMSLHFLIL V+ L  +FQITPL++ +W  V+KIS PVILLDE LK +AR + +
Sbjct:    1 MENAHTKTVEEVLAHFNVNESTGLSLEQVKKQKERWGANELPAEEGKTLWELVIEQFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALKEYEPEMGKVYRQDRKSVQRIKARDIVPGDIVEVAVGDKVPADIRLTSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAIGVVVATGVNTEIGKIRDEMVATEQERTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFIVDKVEGDNCFLNEFNITGSTYAPMGEVLKDDKLVKCHQYDGLVELATICALCNDSSLDFNEAKGVYEKVGEATETALTCLVEKMNVFDTDLKGLSRIERANACNSVIKQLMKKEFTLEFSRDRKSMSVYCTPNKPSRTSMSKMFVKGAPEGLIDRCTHIRVGSIKVPLTAGIKQKIMSVIREWGTGRDTLRCLALATHDNPPRKEDMNLEDSTNFINYETNLTFVGCVGMLDPPRTEVAASVKMCRQAGIRVIMITGDNKGTAVAICRRVGIFREDEDVSERAFTGREFDELSPAAQRDACLNARCFARVEPSHKSKIVEFLQSFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYVGAATVGAAAWWFIAAEDGPRITFYQLSHFLQCREENPDFDGVECEIFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWENVWLLGSICLSMSLHFLILYVEPLPLIFQITPLNLIQWLMVLKISLPVILLDETLKYVARNYLE 992          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: atp2a1 (ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 [Source:NCBI gene;Acc:613090])

HSP 1 Score: 1423.68 bits (3684), Expect = 0.000e+0
Identity = 718/1004 (71.51%), Postives = 839/1004 (83.57%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGSP----KMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTDGKNKHVHYTDL 3344
            ME +H KT +E L YF V+E  GLS E VK+  ++FG NE+PAEE K++W+L+ EQF+DLLV+ILLLAA ISFVLA FEE E+++TAFVEPFVI+LILIANA+VGVWQERNAE AIEALKEYEPE+ KVYR + K VQ+IKARE+VPGDI ++AVGDKVPADIR+  I STT+RIDQSILTGESVSVIKH++A+PDPRAVNQDKKN+LFSGTNV +GK  GVVI TG +TEIGKIR++M  TEQE+TPLQQKLDEFG+QLSKVI++IC+AVW INIGHFNDP HGGSW++GAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV RMFV   +     S ++F ITGS YAPEGEV  N + V+ G Y+ L+E+A ICA+CNDSS+DYNE+K  +EKVGEATETALT LVEKMNV N     L+K +   ACN  I+   KKEFTLEFSRDRKSMS Y  PAK        KMF KGAPEG++DRC +VRVG+ ++P+T AIK +I+ +  E+GTGRDTLRCLALAT D P K+E+M L+D+ +F  YET++TFVG VGMLDPPR EV  SI  CR AGIRVI+ITGDNK TA AICRRIG+F E++     ++TGREFDDL    ++EA +RA  FARVEP HKSKIVE+LQ   E++AMTGDGVNDAPALKKAEIGIAMGSGTAVAK+ASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVV IFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM +PPRS +EPLI+GWLFFRY+A+G YVGAATVGAAAWWF     GP++ +YQL+H  QC  + + FEG++C IF  P PMTMALSVLV IEM NA+NSLSENQSL++MPPWVN+WL+GS+ LSMSLHFLIL V+ L  +F++TPL+  +WF V+KIS PVILLDE+LK +AR + +GK++ +    L
Sbjct:    1 MEAAHTKTTEECLAYFGVNENTGLSPEIVKKNFDKFGPNELPAEEGKSIWELVAEQFEDLLVRILLLAACISFVLAWFEEGEETVTAFVEPFVILLILIANAVVGVWQERNAEDAIEALKEYEPEMGKVYRSDRKSVQRIKAREIVPGDIVEVAVGDKVPADIRLISIKSTTLRIDQSILTGESVSVIKHTEAVPDPRAVNQDKKNMLFSGTNVGAGKAIGVVIATGPNTEIGKIRDEMAATEQEKTPLQQKLDEFGEQLSKVISLICVAVWLINIGHFNDPIHGGSWIKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFVLDKVDGDICSLNEFSITGSTYAPEGEVLKNDKSVKAGQYDGLVELATICALCNDSSLDYNESKGVFEKVGEATETALTTLVEKMNVFNTEVRSLSKVERANACNSVIKQLMKKEFTLEFSRDRKSMSVYCTPAKASRAAVGNKMFVKGAPEGVIDRCNYVRVGTTRVPLTPAIKDKILTVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDATKFVDYETDLTFVGCVGMLDPPRKEVMGSIKLCREAGIRVIMITGDNKGTAIAICRRIGIFGEDDDVSRCAFTGREFDDLPPTEQREACKRASCFARVEPTHKSKIVEFLQSFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRPPRSPKEPLISGWLFFRYLAIGGYVGAATVGAAAWWFMYADDGPEVTFYQLSHFMQCTEENADFEGLECEIFESPVPMTMALSVLVTIEMCNALNSLSENQSLVRMPPWVNIWLLGSICLSMSLHFLILYVEPLPMIFKLTPLNFTQWFVVLKISIPVILLDELLKFVARNYLEGKSQLILLPQL 1004          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2a1 (ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 [Source:MGI Symbol;Acc:MGI:105058])

HSP 1 Score: 1430.23 bits (3701), Expect = 0.000e+0
Identity = 721/994 (72.54%), Postives = 834/994 (83.90%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGSP----KMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTDG 3314
            ME +H K+ +E L+YF V E  GL+ +QVKR +E++G NE+PAEE K+LW+L++EQF+DLLV+ILLLAA ISFVLA FEE E+++TAFVEPFVI+LILIANAIVGVWQERNAE+AIEALKEYEPE+ KVYR + K VQ+IKAR++VPGDI ++AVGDKVPADIRI  I STT+R+DQSILTGESVSVIKH+D +PDPRAVNQDKKN+LFSGTN+A+GK  G+V  TG+ TEIGKIR+QM  TEQ++TPLQQKLDEFG+QLSKVI++IC+AVW INIGHFNDP HGGSW RGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV +MF+   +     S ++F ITGS YAPEGEV  N + VR G Y+ L+E+A ICA+CNDSS+D+NETK  YEKVGEATETALT LVEKMNV N     L+K +   ACN  I+   KKEFTLEFSRDRKSMS Y +PAK        KMF KGAPEG++DRC +VRVG+ ++P+T  +K +IM +  E+GTGRDTLRCLALAT D P K+E+M L+DS +F +YE ++TFVGVVGMLDPPR EV  SI  CR AGIRVI+ITGDNK TA AICRRIG+FSENE    ++YTGREFDDL    ++EA RRA  FARVEP+HKSKIVEYLQ   E++AMTGDGVNDAPALKKAEIGIAMGSGTAVAK+ASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVV IFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM +PPRS +EPLI+GWLFFRYMA+G YVGAATVGAAAWWF     GP ++Y+QLTH  QC      F+G+DC +F  P+PMTMALSVLV IEM NA+NSLSENQSLL+MPPWVN+WL+GS+ LSMSLHFLIL VD L  +F++  L   +W  V+KIS PVI LDE+LK IAR + +G
Sbjct:    1 MEAAHSKSTEECLSYFGVSETTGLTPDQVKRHLEKYGPNELPAEEGKSLWELVVEQFEDLLVRILLLAACISFVLAWFEEGEETVTAFVEPFVILLILIANAIVGVWQERNAENAIEALKEYEPEMGKVYRADRKSVQRIKARDIVPGDIVEVAVGDKVPADIRILSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAVGIVATTGVSTEIGKIRDQMAATEQDKTPLQQKLDEFGEQLSKVISLICVAVWLINIGHFNDPVHGGSWFRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCKMFIIDKVDGDVCSLNEFSITGSTYAPEGEVLKNDKPVRAGQYDGLVELATICALCNDSSLDFNETKGVYEKVGEATETALTTLVEKMNVFNTEVRSLSKVERANACNSVIRQLMKKEFTLEFSRDRKSMSVYCSPAKSSRAAVGNKMFVKGAPEGVIDRCNYVRVGTTRVPLTGPVKEKIMSVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSAKFMEYEMDLTFVGVVGMLDPPRKEVTGSIQLCRDAGIRVIMITGDNKGTAIAICRRIGIFSENEEVTDRAYTGREFDDLPLAEQREACRRACCFARVEPSHKSKIVEYLQSYDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRPPRSPKEPLISGWLFFRYMAIGGYVGAATVGAAAWWFLYAEDGPHVSYHQLTHFMQCTEHNPEFDGLDCEVFEAPEPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWVNIWLLGSICLSMSLHFLILYVDPLPMIFKLRALDFTQWLMVLKISLPVIGLDELLKFIARNYLEG 994          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2a2 (ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 [Source:MGI Symbol;Acc:MGI:88110])

HSP 1 Score: 1428.69 bits (3697), Expect = 0.000e+0
Identity = 720/992 (72.58%), Postives = 838/992 (84.48%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGS---PKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTD 3311
            MEN+H KTV+EVL +F V+E  GLS EQVK+  ER+G NE+PAEE K L +L++EQF+DLLV+ILLLAA ISFVLA FEE E++ITAFVEPFVI+LIL+ANAIVGVWQERNAE+AIEALKEYEPE+ KVYR++ K VQ+IKA+++VPGDI +IAVGDKVPADIR+T I STT+R+DQSILTGESVSVIKH+D +PDPRAVNQDKKN+LFSGTN+A+GK  GVV+ TG++TEIGKIR++M+ TEQERTPLQQKLDEFG+QLSKVI++ICIAVW INIGHFNDP HGGSW+RGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV RMF+   +     S ++F ITGS YAP GEV  + + V+   Y+ L+E+A ICA+CNDS++DYNE K  YEKVGEATETALTCLVEKMNV +    GL+K +   ACN  I+   KKEFTLEFSRDRKSMS Y  P K       KMF KGAPEG++DRC  +RVGS K+PMT  +K +IM +  E+G+G DTLRCLALAT DNP K+E+M+LEDS  F KYETN+TFVG VGMLDPPR EV  S+  CR AGIRVI+ITGDNK TA AICRRIG+F ++E    K++TGREFD+LS   +++A   A+ FARVEP+HKSKIVE+LQ   E++AMTGDGVNDAPALKK+EIGIAMGSGTAVAK+ASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVV IFLTAALG PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM+KPPR+ +EPLI+GWLFFRY+A+G YVGAATVGAAAWWF     GP++++YQL+H  QC      F+GVDC+IF  P PMTMALSVLV IEM NA+NSLSENQSLL+MPPW N+WLVGS+ LSMSLHFLIL V+ L  +FQITPL++ +W  V+KIS PVIL+DE LK +AR + +
Sbjct:    1 MENAHTKTVEEVLGHFGVNESTGLSLEQVKKLKERWGSNELPAEEGKTLLELVIEQFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALKEYEPEMGKVYRQDRKSVQRIKAKDIVPGDIVEIAVGDKVPADIRLTSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAMGVVVATGVNTEIGKIRDEMVATEQERTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFILDKVEGDTCSLNEFSITGSTYAPIGEVQKDDKPVKCHQYDGLVELATICALCNDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTELKGLSKIERANACNSVIKQLMKKEFTLEFSRDRKSMSVYCTPNKPSRTSMSKMFVKGAPEGVIDRCTHIRVGSTKVPMTPGVKQKIMSVIREWGSGSDTLRCLALATHDNPLKREEMHLEDSANFIKYETNLTFVGCVGMLDPPRIEVASSVKLCRQAGIRVIMITGDNKGTAVAICRRIGIFGQDEDVTSKAFTGREFDELSPSAQRDACLNARCFARVEPSHKSKIVEFLQSFDEITAMTGDGVNDAPALKKSEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYVGAATVGAAAWWFIAADGGPRVSFYQLSHFLQCKEDNPDFDGVDCAIFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWENIWLVGSICLSMSLHFLILYVEPLPLIFQITPLNLTQWLMVLKISLPVILMDETLKFVARNYLE 992          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2a2 (ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 [Source:MGI Symbol;Acc:MGI:88110])

HSP 1 Score: 1425.61 bits (3689), Expect = 0.000e+0
Identity = 721/997 (72.32%), Postives = 839/997 (84.15%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGS---PKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTDGKNKH 3326
            MEN+H KTV+EVL +F V+E  GLS EQVK+  ER+G NE+PAEE K L +L++EQF+DLLV+ILLLAA ISFVLA FEE E++ITAFVEPFVI+LIL+ANAIVGVWQERNAE+AIEALKEYEPE+ KVYR++ K VQ+IKA+++VPGDI +IAVGDKVPADIR+T I STT+R+DQSILTGESVSVIKH+D +PDPRAVNQDKKN+LFSGTN+A+GK  GVV+ TG++TEIGKIR++M+ TEQERTPLQQKLDEFG+QLSKVI++ICIAVW INIGHFNDP HGGSW+RGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV RMF+   +     S ++F ITGS YAP GEV  + + V+   Y+ L+E+A ICA+CNDS++DYNE K  YEKVGEATETALTCLVEKMNV +    GL+K +   ACN  I+   KKEFTLEFSRDRKSMS Y  P K       KMF KGAPEG++DRC  +RVGS K+PMT  +K +IM +  E+G+G DTLRCLALAT DNP K+E+M+LEDS  F KYETN+TFVG VGMLDPPR EV  S+  CR AGIRVI+ITGDNK TA AICRRIG+F ++E    K++TGREFD+LS   +++A   A+ FARVEP+HKSKIVE+LQ   E++AMTGDGVNDAPALKK+EIGIAMGSGTAVAK+ASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVV IFLTAALG PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM+KPPR+ +EPLI+GWLFFRY+A+G YVGAATVGAAAWWF     GP++++YQL+H  QC      F+GVDC+IF  P PMTMALSVLV IEM NA+NSLSENQSLL+MPPW N+WLVGS+ LSMSLHFLIL V+ L  +FQITPL++ +W  V+KIS PVIL+DE LK +AR + +   K 
Sbjct:    1 MENAHTKTVEEVLGHFGVNESTGLSLEQVKKLKERWGSNELPAEEGKTLLELVIEQFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALKEYEPEMGKVYRQDRKSVQRIKAKDIVPGDIVEIAVGDKVPADIRLTSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAMGVVVATGVNTEIGKIRDEMVATEQERTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFILDKVEGDTCSLNEFSITGSTYAPIGEVQKDDKPVKCHQYDGLVELATICALCNDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTELKGLSKIERANACNSVIKQLMKKEFTLEFSRDRKSMSVYCTPNKPSRTSMSKMFVKGAPEGVIDRCTHIRVGSTKVPMTPGVKQKIMSVIREWGSGSDTLRCLALATHDNPLKREEMHLEDSANFIKYETNLTFVGCVGMLDPPRIEVASSVKLCRQAGIRVIMITGDNKGTAVAICRRIGIFGQDEDVTSKAFTGREFDELSPSAQRDACLNARCFARVEPSHKSKIVEFLQSFDEITAMTGDGVNDAPALKKSEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYVGAATVGAAAWWFIAADGGPRVSFYQLSHFLQCKEDNPDFDGVDCAIFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWENIWLVGSICLSMSLHFLILYVEPLPLIFQITPLNLTQWLMVLKISLPVILMDETLKFVARNYLEQPGKE 997          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2a2 (ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 [Source:MGI Symbol;Acc:MGI:88110])

HSP 1 Score: 1425.61 bits (3689), Expect = 0.000e+0
Identity = 721/997 (72.32%), Postives = 839/997 (84.15%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGS---PKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTDGKNKH 3326
            MEN+H KTV+EVL +F V+E  GLS EQVK+  ER+G NE+PAEE K L +L++EQF+DLLV+ILLLAA ISFVLA FEE E++ITAFVEPFVI+LIL+ANAIVGVWQERNAE+AIEALKEYEPE+ KVYR++ K VQ+IKA+++VPGDI +IAVGDKVPADIR+T I STT+R+DQSILTGESVSVIKH+D +PDPRAVNQDKKN+LFSGTN+A+GK  GVV+ TG++TEIGKIR++M+ TEQERTPLQQKLDEFG+QLSKVI++ICIAVW INIGHFNDP HGGSW+RGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV RMF+   +     S ++F ITGS YAP GEV  + + V+   Y+ L+E+A ICA+CNDS++DYNE K  YEKVGEATETALTCLVEKMNV +    GL+K +   ACN  I+   KKEFTLEFSRDRKSMS Y  P K       KMF KGAPEG++DRC  +RVGS K+PMT  +K +IM +  E+G+G DTLRCLALAT DNP K+E+M+LEDS  F KYETN+TFVG VGMLDPPR EV  S+  CR AGIRVI+ITGDNK TA AICRRIG+F ++E    K++TGREFD+LS   +++A   A+ FARVEP+HKSKIVE+LQ   E++AMTGDGVNDAPALKK+EIGIAMGSGTAVAK+ASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVV IFLTAALG PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM+KPPR+ +EPLI+GWLFFRY+A+G YVGAATVGAAAWWF     GP++++YQL+H  QC      F+GVDC+IF  P PMTMALSVLV IEM NA+NSLSENQSLL+MPPW N+WLVGS+ LSMSLHFLIL V+ L  +FQITPL++ +W  V+KIS PVIL+DE LK +AR + +   K 
Sbjct:    1 MENAHTKTVEEVLGHFGVNESTGLSLEQVKKLKERWGSNELPAEEGKTLLELVIEQFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALKEYEPEMGKVYRQDRKSVQRIKAKDIVPGDIVEIAVGDKVPADIRLTSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAMGVVVATGVNTEIGKIRDEMVATEQERTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFILDKVEGDTCSLNEFSITGSTYAPIGEVQKDDKPVKCHQYDGLVELATICALCNDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTELKGLSKIERANACNSVIKQLMKKEFTLEFSRDRKSMSVYCTPNKPSRTSMSKMFVKGAPEGVIDRCTHIRVGSTKVPMTPGVKQKIMSVIREWGSGSDTLRCLALATHDNPLKREEMHLEDSANFIKYETNLTFVGCVGMLDPPRIEVASSVKLCRQAGIRVIMITGDNKGTAVAICRRIGIFGQDEDVTSKAFTGREFDELSPSAQRDACLNARCFARVEPSHKSKIVEFLQSFDEITAMTGDGVNDAPALKKSEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYVGAATVGAAAWWFIAADGGPRVSFYQLSHFLQCKEDNPDFDGVDCAIFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWENIWLVGSICLSMSLHFLILYVEPLPLIFQITPLNLTQWLMVLKISLPVILMDETLKFVARNYLEQPGKE 997          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2a3 (ATPase, Ca++ transporting, ubiquitous [Source:MGI Symbol;Acc:MGI:1194503])

HSP 1 Score: 1355.12 bits (3506), Expect = 0.000e+0
Identity = 679/995 (68.24%), Postives = 810/995 (81.41%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAK-----EGSPKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTDG 3314
            ME +H+ +  +VL  F+V  E GLS EQV    ER+G NE+P EE K+LW+L++EQF+DLLV+ILLLAA++SFVLA FEE E++ TAFVEP VIMLIL+ANAIVGVWQERNAESAIEALKEYEPE+ KV R + KGVQ+I+AR++VPGDI ++AVGDKVPAD+R+ +I STT+R+DQSILTGESVSV KH+DAIPDPRAVNQDKKN+LFSGTN+ASGK  GV + TGL TE+GKIR+QM   E ERTPLQ+KLDEFG+QLS  I++IC+AVW INIGHF DPAHGGSW+RGA+YYFKIAVALAVAAIPEGLPAVITTCLALGTRRMA+KNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV RMFV +         H+F I+G+ Y PEGEV    Q VR G ++ L+E+A ICA+CNDS++DYNE K  YEKVGEATETALTCLVEKMNV +    GL++ +   ACN  I+   +KEFTLEFSRDRKSMS Y  P +     +GS KMF KGAPE +++RC+ VRVGS+  P++   +  I+    ++G+G DTLRCLALAT D P +KE M+L+D ++F +YET++TFVG VGMLDPPR EV   I +C  AGIRV++ITGDNK TA AICRR+G+F + E   GK+YTGREFDDLS E +++A R A+ FARVEPAHKS+IVE LQ   E++AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSA+EMVL+DDNF++IVAAVEEGRAIYNNMKQFIRYLISSNVGEVV IFLTA LG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM KPPR+ RE LI+GWLFFRY+A+G YVG ATV AA WWF    +GPQ+ +YQL +  +C      F G+DC +F    P TMALSVLV IEM NA+NS+SENQSLL+MPPW+N WL+G++V+SM+LHFLIL V  L  +FQ+TPLS  +W  V+++S PVILLDE LK ++R   DG
Sbjct:    1 MEEAHLLSAADVLRRFSVTAEGGLSLEQVTDARERYGPNELPTEEGKSLWELVVEQFEDLLVRILLLAALVSFVLAWFEEGEETTTAFVEPLVIMLILVANAIVGVWQERNAESAIEALKEYEPEMGKVIRSDRKGVQRIRARDIVPGDIVEVAVGDKVPADLRLIEIKSTTLRVDQSILTGESVSVTKHTDAIPDPRAVNQDKKNMLFSGTNIASGKALGVAVATGLQTELGKIRSQMAAVEPERTPLQRKLDEFGRQLSHAISVICVAVWVINIGHFADPAHGGSWLRGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMARKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFVVAEAEAGTCRLHEFTISGTTYTPEGEVRQGEQPVRCGQFDGLVELATICALCNDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTDLKGLSRVERAGACNSVIKQLMRKEFTLEFSRDRKSMSVYCTPTRADPKVQGS-KMFVKGAPESVIERCSSVRVGSRTAPLSTTSREHILAKIRDWGSGSDTLRCLALATRDTPPRKEDMHLDDCSRFVQYETDLTFVGCVGMLDPPRPEVAACITRCSRAGIRVVMITGDNKGTAVAICRRLGIFGDTEDVLGKAYTGREFDDLSPEQQRQACRTARCFARVEPAHKSRIVENLQSFNEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLSDDNFASIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAILGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKPPRNPREALISGWLFFRYLAIGVYVGLATVAAATWWFLYDTEGPQVTFYQLRNFLKCSEDNPLFAGIDCKVFESRFPTTMALSVLVTIEMCNALNSVSENQSLLRMPPWLNPWLLGAVVMSMALHFLILLVPPLPLIFQVTPLSGRQWGVVLQMSLPVILLDEALKYLSRNHMDG 994          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|P22700|ATC1_DROME (Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Drosophila melanogaster OX=7227 GN=SERCA PE=1 SV=2)

HSP 1 Score: 1496.1 bits (3872), Expect = 0.000e+0
Identity = 739/996 (74.20%), Postives = 859/996 (86.24%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEG----SPKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTDGKN 3320
            ME+ H KTV++ LN+F  D E GL+ +Q+K   +++G NE+P EE K++WQL+LEQFDDLLVKILLLAAIISFVLALFEEHE++ TAFVEP VI+LILIANA+VGVWQERNAESAIEALKEYEPE+ KV R++  G+QK++A+E+VPGD+ +++VGDK+PADIRIT I+STT+RIDQSILTGESVSVIKH+DAIPDPRAVNQDKKN+LFSGTNVA+GK RGVVIGTGL T IGKIR +M ETE+ +TPLQQKLDEFG+QLSKVI++IC+AVWAINIGHFNDPAHGGSW++GAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV+RMF+F  +   + S  +FE+TGS Y P GEVFLNGQ+++  DY+TL E++ IC MCNDS+IDYNE K A+EKVGEATETAL  L EK+N  +++K+GL ++   +AC   I+  WKKEFTLEFSRDRKSMS Y  P K       PK+F KGAPEG+L+RC   RVG+ K+P+T+A+K++I+ +TG+YGTGRDTLRCLALA  D+P K ++M+L DS +FY+YE N+TFVGVVGMLDPPR EVFDSIV+CR AGIRVIVITGDNKATAEAICRRIGVF+E+E T GKSY+GREFDDLS   +K AV R++LF+RVEP HKSKIVE+LQ   E+SAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSA+EMVLADDNFS+IV+AVEEGRAIYNNMKQFIRYLISSN+GEVVSIFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM KPPR   E LI+GWLFFRYMA+G YVGAATVGAAAWWF    +GP+L+Y+QLTH   CL     F+GVDC IF  P  MTMALSVLV IEMLNAMNSLSENQSL+ MPPW NLWL+GSM LS +LHF+IL VD LS VFQ+TPLS EEW  V+K S PV+LLDE LK +ARK  DG++
Sbjct:    1 MEDGHSKTVEQSLNFFGTDPERGLTLDQIKANQKKYGPNELPTEEGKSIWQLVLEQFDDLLVKILLLAAIISFVLALFEEHEETFTAFVEPLVILLILIANAVVGVWQERNAESAIEALKEYEPEMGKVVRQDKSGIQKVRAKEIVPGDLVEVSVGDKIPADIRITHIYSTTLRIDQSILTGESVSVIKHTDAIPDPRAVNQDKKNILFSGTNVAAGKARGVVIGTGLSTAIGKIRTEMSETEEIKTPLQQKLDEFGEQLSKVISVICVAVWAINIGHFNDPAHGGSWIKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRMFIFDKVEGNDSSFLEFEMTGSTYEPIGEVFLNGQRIKAADYDTLQELSTICIMCNDSAIDYNEFKQAFEKVGEATETALIVLAEKLNSFSVNKSGLDRRSAAIACRGEIETKWKKEFTLEFSRDRKSMSSYCTPLKASRLGTGPKLFVKGAPEGVLERCTHARVGTTKVPLTSALKAKILALTGQYGTGRDTLRCLALAVADSPMKPDEMDLGDSTKFYQYEVNLTFVGVVGMLDPPRKEVFDSIVRCRAAGIRVIVITGDNKATAEAICRRIGVFAEDEDTTGKSYSGREFDDLSPTEQKAAVARSRLFSRVEPQHKSKIVEFLQSMNEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLADDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKPPRKADEGLISGWLFFRYMAIGFYVGAATVGAAAWWFVFSDEGPKLSYWQLTHHLSCLGGGDEFKGVDCKIFSDPHAMTMALSVLVTIEMLNAMNSLSENQSLITMPPWCNLWLIGSMALSFTLHFVILYVDVLSTVFQVTPLSAEEWITVMKFSIPVVLLDETLKFVARKIADGES 996          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|Q7PPA5|ATC1_ANOGA (Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Anopheles gambiae OX=7165 GN=SERCA PE=3 SV=5)

HSP 1 Score: 1493.79 bits (3866), Expect = 0.000e+0
Identity = 743/1002 (74.15%), Postives = 851/1002 (84.93%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEG----SPKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTDGKN--KHVH 3332
            ME+ H KTVDEVL++F VD E GLS +QVK   +++G NE+PAEE K LWQL+LEQFDDLLVKILLLAAIISFVLALFEEHE  + AFVEPFVI+LILIANA+VGVWQERNAESAIEALKEYEPE+ KV R +  GVQKI+A+E+VPGD+ +++VGDK+PADIR+ KI+STTIRIDQSILTGESVSVIKH+DA+PDPRAVNQDKKN+LFSGTNVA+GK RGVVIGTGL+T IGKIR +M ETE+ +TPLQQKLDEFG+QLSKVI++IC+AVWAINIGHFNDPAHGGSW++GA+YYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV+RMF+F  I   + S  +FEI+GS Y P GEV LNGQ+++  DYETL E+  IC MCNDS+ID+NETK  +EKVGEATETAL  L EK+N  N++K GL ++   +     I+  WKKEFTLEFSRDRKSMS Y  P K       PK+FCKGAPEG+L+RC   RVGS K+P+T  +K  I+ +T  YGTGRDTLRCLALAT D+P K + M+L DS +FY YE N+TFVGVVGMLDPPR EV DSIV+CR AGIRVIVITGDNKATAEAICRRIGVF E+E T GKSY+GREFDDLS   ++EA  RA+LF+RVEPAHKSKIVE+LQ   E+SAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSA+EMVLADDNFS+IVAAVEEGRAIYNNMKQFIRYLISSN+GEVVSIFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM+KPPR   E LI+GWLFFRYMA+G YVG ATVG AAWWF     GPQL+Y+QLTH   CL     F+G+DC IF  P PMTMALSVLV IEMLNAMNSLSENQSL++MPPW N+WL+ SM LS +LHF+IL VD LS VFQ+TPL   EW  V+K S PV+LLDE+LK +AR+ +DG++  K++H
Sbjct:    1 MEDGHSKTVDEVLSHFRVDPERGLSLDQVKEYQKKYGPNELPAEEGKTLWQLVLEQFDDLLVKILLLAAIISFVLALFEEHE-GVEAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYEPEMGKVIRGDKSGVQKIRAKEIVPGDVVEVSVGDKIPADIRLIKIYSTTIRIDQSILTGESVSVIKHTDAVPDPRAVNQDKKNILFSGTNVAAGKARGVVIGTGLNTAIGKIRTEMSETEEIKTPLQQKLDEFGEQLSKVISLICVAVWAINIGHFNDPAHGGSWIKGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRMFIFEKIEGNDSSFTEFEISGSTYEPIGEVTLNGQRIKAADYETLHELGTICIMCNDSAIDFNETKKVFEKVGEATETALIVLAEKLNPFNVAKQGLDRRSSAICVRQEIETKWKKEFTLEFSRDRKSMSSYCTPLKASKLGNGPKLFCKGAPEGVLERCTHARVGSTKVPLTQTLKQRILDLTRTYGTGRDTLRCLALATADSPMKPDDMDLNDSTKFYTYEVNLTFVGVVGMLDPPRKEVQDSIVRCRAAGIRVIVITGDNKATAEAICRRIGVFGEDEDTTGKSYSGREFDDLSVSEQREACSRARLFSRVEPAHKSKIVEFLQSMNEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLADDNFSSIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMTKPPRKADEGLISGWLFFRYMAIGGYVGCATVGGAAWWFMFSETGPQLSYWQLTHHLSCLGGGEEFKGIDCKIFNDPHPMTMALSVLVTIEMLNAMNSLSENQSLVQMPPWCNIWLIASMCLSFALHFVILYVDVLSTVFQVTPLDGNEWMTVMKFSLPVVLLDEILKFVARRISDGESYIKNMH 1001          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|Q292Q0|ATC1_DROPS (Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=SERCA PE=3 SV=2)

HSP 1 Score: 1485.32 bits (3844), Expect = 0.000e+0
Identity = 737/993 (74.22%), Postives = 849/993 (85.50%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEG----SPKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTD 3311
            ME+ H KTV++ LN+F  D E GL+ +Q+K    ++G NE+P EE K++WQL+LEQFDDLLVKILLLAAIISFVLALFEEHE++ TAFVEP VI+LILIANA+VGVWQERNAESAIEALKEYEPE+ KV R++  G+QK++A+E+VPGD+ +++VGDK+PADIR+T I+STTIRIDQSILTGESVSVIKH+DAIPDPRAVNQDKKN+LFSGTNVA+GK RGVVIGTGL T IGKIR +M ETE+ +TPLQQKLDEFG+QLSKVI++IC+AVWAINIGHFNDPAHGGSW++GAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV+RM +F  +   + S  +FE+TGS Y P GE+FL GQ+V+  DYE L E+A +C MCNDS+IDYNE K+A+EKVGEATETAL  L EK+N  +++K+GL ++   +A    I+  WKKEFTLEFSRDRKSMS Y  P K       PK+F KGAPEG+LDRC   RVG+ K+P+T+A+K++I+ +TG+YGTGRDTLRCLALA  D+P + E M+L DS +FY+YE N+TFVGVVGMLDPPR EVFD+IV+CR AGIRVIVITGDNKATAEAICRRIGVF+E E T GKSY+GREFDDLS   +K AV R++LF+RVEP HKSKIVEYLQ   E+SAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSA+EMVLADDNFS+IV+AVEEGRAIYNNMKQFIRYLISSN+GEVVSIFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM KPPR   E LI+GWLFFRYMA+G YVGAATVGAAAWWF    +GP L Y+QLTH   CL     F+GVDC IF  PK MTMALSVLV IEMLNAMNSLSENQSL+ MPPW NLWL+GSM LS +LHF+IL VD LS VFQ+TPLS EEW  V+K S PV+LLDE LK +ARK  D
Sbjct:    1 MEDGHSKTVEQSLNFFGTDGERGLTLDQIKTNQAKYGPNELPTEEGKSIWQLVLEQFDDLLVKILLLAAIISFVLALFEEHEETFTAFVEPLVILLILIANAVVGVWQERNAESAIEALKEYEPEMGKVIRQDKSGIQKVRAKEIVPGDLVEVSVGDKIPADIRLTHIYSTTIRIDQSILTGESVSVIKHTDAIPDPRAVNQDKKNILFSGTNVAAGKARGVVIGTGLSTAIGKIRTEMSETEEIKTPLQQKLDEFGEQLSKVISVICVAVWAINIGHFNDPAHGGSWIKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRMLIFEKVEGNDSSFLEFELTGSTYEPIGELFLGGQRVKASDYEALQELATVCIMCNDSAIDYNEFKAAFEKVGEATETALIVLAEKLNAFSVNKSGLDRRSNAIAARGEIETKWKKEFTLEFSRDRKSMSSYCTPLKASRLGTGPKLFVKGAPEGVLDRCTHARVGTSKVPLTSALKAKILALTGQYGTGRDTLRCLALAVADSPIRPEDMDLGDSTKFYQYEVNLTFVGVVGMLDPPRKEVFDAIVRCRAAGIRVIVITGDNKATAEAICRRIGVFTEEEDTTGKSYSGREFDDLSIAEQKAAVARSRLFSRVEPQHKSKIVEYLQGMNEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLADDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDKPPRKADEGLISGWLFFRYMAIGFYVGAATVGAAAWWFIASSEGPGLTYWQLTHHLSCLGGGDEFKGVDCKIFSDPKAMTMALSVLVTIEMLNAMNSLSENQSLISMPPWCNLWLIGSMALSFTLHFVILYVDVLSTVFQVTPLSAEEWITVMKFSIPVVLLDETLKFVARKIAD 993          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|P35316|ATC_ARTSF (Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Artemia franciscana OX=6661 PE=2 SV=1)

HSP 1 Score: 1462.2 bits (3784), Expect = 0.000e+0
Identity = 742/997 (74.42%), Postives = 848/997 (85.06%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHED---SITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEI-STHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEG----SPKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTD 3311
            ME++H K  +EV++YF VD E GL+ EQVK+  E++G NE+PAEE K+L  LILEQFDDLLVKILLLAAIIS VLALFEEH+D    +TA+VEPFVI+LILIANA+VGVWQE+NAESAIEALKEYEPE+ KV R +  G+QKIKAR+LVPGDI +I+VGDK+PAD+R+  I STT+RIDQSILTGESVSVIKH+D +PDPRAVNQDKKN+LFSGTNV++GK RGVV+GTGL+T IG IR QM ETE+ +TPLQQKLDEFG+QLSKVI++IC+AVWAINIGHFNDPAHGGSW++GAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV+RMFVF +I +      +QFE+TGS Y P GE F+ GQK+   DY+ + EI  IC MCNDS+ID+NE K A+EKVGEATETAL  L EK+N +NLSKAG  ++   +     +   WKKEFTLEFSRDRKSMS Y  P K G     PKMF KGAPEG+LDRC  VRVG+KK+PMT AI  +I+ +T  YGTGRDTLRCLALAT+D+P   + M++ DS +F KYE N TFVGVVGMLDPPR EV D+I +CR AGIRVIVITGDNKATAEAICRRIGVF E+E T G +YTGREFDDLS E +++AV R++LFARVEP HKSKIVEYLQ  GE+SAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSA+EMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSN+GEVVSIFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM+KPPR   E LITGWLFFRYMA+GTYVGAATVGAAA WF + P GP LN+YQL+H  QC  +   FEG+DC IF  P PMTMALSVLV IEMLNA+NSLSENQSLL MPPW N+WL+ ++ LSM+LHF+IL V+ LS VFQI PL++ EW  V+KISFPV+LLDEVLK +ARK+TD
Sbjct:    1 MEDAHAKKWEEVVDYFGVDPERGLALEQVKKNQEKYGPNELPAEEGKSLLTLILEQFDDLLVKILLLAAIISLVLALFEEHDDEAEQLTAYVEPFVILLILIANAVVGVWQEKNAESAIEALKEYEPEMGKVIRADKTGIQKIKARDLVPGDIVEISVGDKIPADLRLISILSTTLRIDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNVSAGKARGVVMGTGLNTAIGSIRTQMFETEEMKTPLQQKLDEFGEQLSKVISVICVAVWAINIGHFNDPAHGGSWIKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRMFVFKDIPDDAAPELYQFELTGSTYEPIGETFMQGQKINAADYDAVKEITTICMMCNDSAIDFNEYKQAFEKVGEATETALIVLGEKLNPYNLSKAGKDRRSAALVVREDMDTRWKKEFTLEFSRDRKSMSSYCVPLKAGLLSNGPKMFVKGAPEGVLDRCTHVRVGTKKVPMTPAIMDKILEVTRAYGTGRDTLRCLALATIDDPMDPKDMDIIDSTKFVKYEQNCTFVGVVGMLDPPRKEVLDAIERCRAAGIRVIVITGDNKATAEAICRRIGVFGEDENTEGMAYTGREFDDLSVEGQRDAVARSRLFARVEPFHKSKIVEYLQGMGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRRADEGLITGWLFFRYMAIGTYVGAATVGAAAHWFMMSPTGPGLNFYQLSHHLQCTPENEYFEGIDCEIFSDPHPMTMALSVLVTIEMLNAINSLSENQSLLVMPPWSNIWLISAICLSMTLHFVILYVEILSTVFQICPLTLTEWIVVLKISFPVLLLDEVLKFVARKYTD 997          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|P70083|AT2A1_MAKNI (Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Makaira nigricans OX=13604 GN=atp2a1 PE=2 SV=2)

HSP 1 Score: 1436.01 bits (3716), Expect = 0.000e+0
Identity = 715/990 (72.22%), Postives = 830/990 (83.84%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAK-EGSPKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTD 3311
            MEN+H K+  E L+YF V+E  GLS +Q K+ +++FG+NE+PAEE K++W LI+EQF+DLLV+ILLLAA ISFVLA FEE E++ITAFVEPFVI+LILIANAIVGVWQERNAE AIEALKEYEPE+ KVYR + K VQ+IKARE+VPGDI +++VGDKVPADIRI  I STT+R+DQSILTGESVSVIKH++++PDPRAVNQDKKN+LFSGTN+A+GK  GV I TG+ TEIGKIR+QM  TEQE+TPLQ KLDEFG+QLSKVI++IC+AVWAINIGHFNDP HGGSW+RGA+YYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM V +MF+  ++    +  + F+I+GSKY PEGEV   G K     Y+ L+E+A ICA+CNDSS+DYNE+K  YEKVGEATETAL CLVEKMNV N +   L++ +   AC   I+   KK FTLEFSRDRKSMS Y  PAK +G  KMF KGAPEG++DRCA+VRVG+ ++P+T+AIK +IM +  ++GTGRDTLRCLALAT D P K E+MNLEDS +F  YET+MTFVG VGMLDPPR EV  SI  CR AGIRVI+ITGDNK TA AICRRIG+F E+E    K+YTGREFDDL  + + EAVRRA  FARVEP+HKSKIVE+LQ + +++AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFS+IVAAVEEGRAIYNNMKQFIRYLISSNVGEVV IFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM KPPRS +EPLI+GWLFFRYMA+G YVGAATVG AAWWF     GP + YYQL+H  QC      F GVDC IF    PMTMALSVLV IEM NA+NSLSENQSL++MPPW NLWL+ +M LSMSLHF+I+ VD L  +F++T L+ ++W  V K+SFPVIL+DEVLK  AR + +
Sbjct:    1 MENAHTKSPAECLSYFGVNEHTGLSPDQFKKNLDKFGYNELPAEEGKSIWDLIVEQFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILIANAIVGVWQERNAEDAIEALKEYEPEMGKVYRSDRKSVQRIKAREIVPGDIVEVSVGDKVPADIRIVSIKSTTLRVDQSILTGESVSVIKHTESVPDPRAVNQDKKNMLFSGTNIAAGKAIGVAIATGVSTEIGKIRDQMAATEQEKTPLQAKLDEFGEQLSKVISLICVAVWAINIGHFNDPVHGGSWIRGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMCVTKMFIVKSVDGDHVDLNAFDISGSKYTPEGEVSHGGSKTNCSAYDGLVELATICALCNDSSLDYNESKKIYEKVGEATETALCCLVEKMNVFNSNVKNLSRIERANACCTVIKQLMKKNFTLEFSRDRKSMSVYCTPAKGDGGAKMFVKGAPEGVIDRCAYVRVGTTRVPLTSAIKEKIMAVIRDWGTGRDTLRCLALATRDTPLKVEEMNLEDSTKFADYETDMTFVGCVGMLDPPRKEVTGSIELCRDAGIRVIMITGDNKGTAIAICRRIGIFKEDEDVSNKAYTGREFDDLPSQDQAEAVRRACCFARVEPSHKSKIVEFLQGNDDITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSSIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMGKPPRSPKEPLISGWLFFRYMAIGGYVGAATVGGAAWWFLYDSTGPAVTYYQLSHFMQCHNHNEDFTGVDCDIFEASPPMTMALSVLVTIEMCNALNSLSENQSLIRMPPWSNLWLMAAMTLSMSLHFMIIYVDPLPMIFKLTHLTFDQWLMVFKLSFPVILIDEVLKFFARNYIE 990          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: A0A0X3P5R6 (Calcium-transporting ATPase OS=Schistocephalus solidus OX=70667 GN=TR145178 PE=3 SV=1)

HSP 1 Score: 1654.03 bits (4282), Expect = 0.000e+0
Identity = 813/1005 (80.90%), Postives = 908/1005 (90.35%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGS----------------PKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTD 3311
            MEN+H + V++VL+YFNVDEE GLSDEQVKRQ ++FG NEMPAEE K++W+LI EQFDDLLVKILLLAA+ISFVLALFEE +DSITAFVEPFVI+LILIANAIVGVWQERNAESAIEALKEYEPEIAKV+RK+++GVQ+IKA  LVPGDI +++VGDKVPAD+RITKI+ST++R+DQSILTGESVSV K ++ +PDPRAVNQDKKN+LFSGTN+ASGKCRGVVIGTGL TEIGKIRNQMM TEQ+RTPLQQKLDEFGQQLSKVI+IICIAVWAINIGHFNDPAHGGSW+RGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMA KNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV R FVFS+  E  I+THQFEITGSKYAPEGEVFLNGQ++R G+YE L+E+ANICAMCNDS++DYNE+K  YEKVGEATETAL  LVEKMNV+N +K+GLTKK+LGM CN  I+  W K FTLEFSRDRKSMS ++ P K GS                P+MF KGAPEG++DRC FVRVGSKK+PM+ A+K+EIM+    YGTGRDTLRCLALAT D P  KEQM+L+D+++F  YE+N+TFVGVVGMLDPPRTEVFDSIVKCR AGIRVIVITGDNKATAEAICRRIGVF E E+T GKSYTGREFDDL  E K+EA RRA+LFARVEPAHKSKIVE+LQ DGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIY+NMKQFIRYLISSNVGEVVSIFLTAALG+PEALIPVQLLWVNLVTDG PATALGFNPPDLDIM++PPRST +PLI+GWLFFRY+ +G YVG ATVG+AAWWF  Y KGPQLNYYQLTHQ+QCLAQESRF+GVDCSIF+HPKPMTMALSVLVL+EMLNAMNSLSENQSL+ MPPWVNLWLV +M+LS+ LH +ILEVDFL+ VFQ+TPLS+EEW+ V K S PV+ +DE+LKLIARKFTD
Sbjct:    1 MENAHCRKVEDVLSYFNVDEETGLSDEQVKRQTDKFGLNEMPAEEAKSIWELIFEQFDDLLVKILLLAAVISFVLALFEEDDDSITAFVEPFVILLILIANAIVGVWQERNAESAIEALKEYEPEIAKVFRKSSRGVQRIKAVNLVPGDIVEVSVGDKVPADVRITKIYSTSMRVDQSILTGESVSVSKMTEEVPDPRAVNQDKKNILFSGTNIASGKCRGVVIGTGLSTEIGKIRNQMMATEQDRTPLQQKLDEFGQQLSKVISIICIAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAAKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRAFVFSHADENTIATHQFEITGSKYAPEGEVFLNGQRIRCGEYEGLIELANICAMCNDSAVDYNESKGLYEKVGEATETALCVLVEKMNVYNDNKSGLTKKELGMVCNLSIKNMWNKLFTLEFSRDRKSMSVFLVP-KTGSKNAYPVGGVSSASGPGPRMFVKGAPEGVIDRCTFVRVGSKKVPMSPALKAEIMKNVSAYGTGRDTLRCLALATCDVPVPKEQMDLDDTSKFKIYESNLTFVGVVGMLDPPRTEVFDSIVKCRHAGIRVIVITGDNKATAEAICRRIGVFGEEESTIGKSYTGREFDDLPIEEKREACRRARLFARVEPAHKSKIVEFLQADGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYSNMKQFIRYLISSNVGEVVSIFLTAALGLPEALIPVQLLWVNLVTDGFPATALGFNPPDLDIMTRPPRSTSDPLISGWLFFRYLTIGGYVGCATVGSAAWWFIAYDKGPQLNYYQLTHQSQCLAQESRFKGVDCSIFVHPKPMTMALSVLVLVEMLNAMNSLSENQSLMVMPPWVNLWLVAAMILSIGLHLIILEVDFLANVFQLTPLSLEEWWVVTKFSLPVVFIDEILKLIARKFTD 1004          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: A0A5K3FDE6 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 1640.55 bits (4247), Expect = 0.000e+0
Identity = 801/1004 (79.78%), Postives = 900/1004 (89.64%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGS---------------PKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTD 3311
            MEN+H +  ++VL YFNVDEE GLSDEQVKR  E++G NE+PAEETK+LW+L++EQFDDLLVKILLLAA+ISFVLALFEE EDSITAFVEPFVI+LIL+ANAIVGVWQERNAESAIEALKEYEPEIAKV+RK+ +G+Q+IKA  LVPGDI ++++GDKVPADIRITKIFSTT+R+DQSILTGESVSV+K ++ +PDPRAVNQDKKN+LFSGTN+A+GKCRGVV+GTGL TEIGKIRNQMM TEQ++TPLQQKLDEFGQQLSKVI+IICIAVWAINIGHFNDPAHGGSW+RGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMA KNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V R F+FS+  E  I+THQFEITGSKYAPEGEVFL GQ+V  G+YE L+E+ANICAMCNDS++DYNE+K  YEKVGEATETAL   VEKMNV+ +SK+GLTKK+LGM CNH+IQ  W K FTLEFSRDRKSMS +V P    +                +MF KGAPEG++DRC F RVGSKK+ MT  IK+EI++    YGTGRDTLRCLALAT D P  KEQM+LEDS +F KYE+N+TFVGVVGMLDPPR+EV DSIVKCR AGIRVIVITGDNKATAEAICRRIGVFSE+E T GKS+TGREFDDL  E ++EAVRRA+LFARVEPAHKSKIVE+LQ DGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIY+NMKQFIRYLISSNVGEVVSIFLTAALG+PEALIPVQLLWVNLVTDG PATALGFNPPDLDIM++PPRST +PLI+GWLFFRY+ +G YVG ATVG+AAWWF IY KGPQLNYYQLTHQ+QCLAQESRF+G+DCSIF HPKPMTMALSVLV++EMLNAMNSLSENQSLL MPPW N WL+G+M++S+ LHF+ILEVDFL+ VFQ+TPLS EEW  V++ S PVI +DE+LKLIARKFTD
Sbjct:    1 MENAHCRKAEDVLAYFNVDEETGLSDEQVKRNSEKYGLNELPAEETKSLWELVIEQFDDLLVKILLLAALISFVLALFEEDEDSITAFVEPFVILLILVANAIVGVWQERNAESAIEALKEYEPEIAKVFRKSHRGIQRIKAVNLVPGDIVEVSIGDKVPADIRITKIFSTTMRVDQSILTGESVSVLKMTEEVPDPRAVNQDKKNMLFSGTNIAAGKCRGVVVGTGLSTEIGKIRNQMMATEQDKTPLQQKLDEFGQQLSKVISIICIAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAAKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVCRAFIFSHADENNIATHQFEITGSKYAPEGEVFLGGQRVNCGEYEGLVELANICAMCNDSAVDYNESKGLYEKVGEATETALCVFVEKMNVYGISKSGLTKKELGMVCNHNIQAMWNKLFTLEFSRDRKSMSVFVTPKTNTTNPHPVGGVSTPTGPGARMFVKGAPEGVIDRCTFARVGSKKVAMTPQIKAEIVKYVAAYGTGRDTLRCLALATCDAPIPKEQMDLEDSTKFRKYESNLTFVGVVGMLDPPRSEVHDSIVKCRHAGIRVIVITGDNKATAEAICRRIGVFSEDEPTTGKSFTGREFDDLPLEEQREAVRRARLFARVEPAHKSKIVEFLQADGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYSNMKQFIRYLISSNVGEVVSIFLTAALGLPEALIPVQLLWVNLVTDGFPATALGFNPPDLDIMTRPPRSTSDPLISGWLFFRYLTIGGYVGCATVGSAAWWFLIYDKGPQLNYYQLTHQSQCLAQESRFKGIDCSIFAHPKPMTMALSVLVVVEMLNAMNSLSENQSLLVMPPWTNYWLLGAMIMSIGLHFIILEVDFLANVFQLTPLSFEEWIVVIEFSLPVIFIDEILKLIARKFTD 1004          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: A0A564ZBV6 (Calcium-transporting ATPase OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS14474 PE=3 SV=1)

HSP 1 Score: 1637.47 bits (4239), Expect = 0.000e+0
Identity = 806/1005 (80.20%), Postives = 901/1005 (89.65%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGS----------------PKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTD 3311
            MEN+H + V++VL YFNVDEE GLSDEQ+KRQ E+ G NE+PAEE K++W LI EQFDDLLVKILLLAA+ISFVLALFEE +DSITAFVEPFVI+LIL+ANA+VGVWQERNAESAIEALKEYEPEIAKVYRKN  G+Q+IKA  LVPGDI +++VGDKVPAD+RITKIFSTT+R+DQSILTGESVSV+K ++ +PDPRAVNQDKKNLLFSGTN+ASGKCRGVV+GTGL TEIGKIRNQMM+TEQ+RTPLQQKLDEFGQQLSKVI+IICIAVWAINIGHFNDPAHGGSW+RGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMA KNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV R F+F+   E  IST+QFEITGSKYAPEGEVFLNGQ+++ G+YE L+E+ANICAMCNDS++DYNETK+ YEKVGEATETAL   VEKMNV+ +SK GL+K+ LGMACNH+IQ  W K FTLEFSRDRKSMS +V P K GS                P+MF KGAPEG+LDRC FVRVG+KK+ MT  IK+EI+++T  YGTGRDTLRCLALAT D P  KEQM+LEDS++F KYE+N+TFVGVVGMLDPPRTEV+DSIVKCR AGIRVIVITGDNKATAEAICRRIGVFSE+E T GKS+TGREFDDLS E ++EAVR A+LFARVEP+HKSKIVE+LQ DGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIY+NMKQFIRYLISSNVGEVVSIFLTAALG+PEALIPVQLLWVNLVTDG PATALGFNPPDLDIMS+PPRST +PLI+GWLFFRY+A+G YVG ATVG+AAWWF IY KGPQLNYYQLTH  QCLA+   F G+DC IF +PKPMTMALSVLVL+EMLNAMNSLSENQSLL MPPW N WL+G+M++S+ LHFLILE+DFL+ VFQ+TPLS EEW  V++ S PVI +DE+LKLIARKFTD
Sbjct:    1 MENAHCRKVEDVLAYFNVDEETGLSDEQIKRQTEKHGLNELPAEEAKSIWALIFEQFDDLLVKILLLAAVISFVLALFEEDDDSITAFVEPFVILLILVANAVVGVWQERNAESAIEALKEYEPEIAKVYRKNHHGIQRIKAVHLVPGDIVEVSVGDKVPADVRITKIFSTTMRVDQSILTGESVSVLKMTEEVPDPRAVNQDKKNLLFSGTNIASGKCRGVVVGTGLSTEIGKIRNQMMDTEQDRTPLQQKLDEFGQQLSKVISIICIAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAAKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRAFIFNQADENNISTNQFEITGSKYAPEGEVFLNGQRIKCGEYEGLIELANICAMCNDSAVDYNETKNIYEKVGEATETALCVFVEKMNVYGVSKVGLSKRDLGMACNHNIQEMWDKLFTLEFSRDRKSMSVFVTP-KAGSRNSYPVGGVSTASGPGPRMFVKGAPEGVLDRCTFVRVGNKKVAMTPQIKAEIVKLTAGYGTGRDTLRCLALATCDAPIPKEQMDLEDSSKFKKYESNLTFVGVVGMLDPPRTEVYDSIVKCRHAGIRVIVITGDNKATAEAICRRIGVFSEDEPTTGKSFTGREFDDLSYEEQREAVRHARLFARVEPSHKSKIVEFLQADGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYSNMKQFIRYLISSNVGEVVSIFLTAALGLPEALIPVQLLWVNLVTDGFPATALGFNPPDLDIMSRPPRSTSDPLISGWLFFRYLAIGGYVGCATVGSAAWWFLIYNKGPQLNYYQLTHHMQCLAEHDNFHGIDCRIFENPKPMTMALSVLVLVEMLNAMNSLSENQSLLVMPPWTNYWLLGAMIMSIGLHFLILEIDFLANVFQLTPLSFEEWIVVIEFSLPVIFIDELLKLIARKFTD 1004          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: A0A158QIZ2 (Calcium-transporting ATPase OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS10565 PE=3 SV=1)

HSP 1 Score: 1634.77 bits (4232), Expect = 0.000e+0
Identity = 809/1042 (77.64%), Postives = 908/1042 (87.14%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGS---------------PKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQ------------------------------------LTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTDGK 3317
            MEN+H + V++VL YFNVDEE GLSDEQ+KRQ E+ G NE+PAEE K++W+LI EQFDDLLVKILLLAA+ISFVLALFEE +DSITAFVEPFVI+LIL+ANA+VGVWQERNAESAIEALKEYEPEIAKVYRKN  G+Q+IKA  LVPGDI +++VGDKVPAD+RITKIFSTT+R+DQSILTGESVSV+K ++ +PDPRAVNQDKKNLLFSGTN+ASGKCRGVV+GTGL TEIGKIRNQMM+TEQ++TPLQQKLDEFGQQLSKVI+IICIAVWAINIGHFNDPAHGGSW+RGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMA KNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV R F+F+   E  IST QFEITGSKYAPEGEVFLNGQ+V+ G+YE L+E+ANICAMCNDS++DYNETK+ YEKVGEATETAL   VEKMNV+N+SK GL+KK +GM CNH+IQ  W+K FTLEFSRDRKSMS +V P  + S               P+MF KGAPEG+LDRC FVRVG+KK+ MT  IK+EI+++T  YGTGRDTLRCLALAT D P  KEQM+LEDS +F KYETN+TFVGVVGMLDPPRTEV+DSI+KCR AGIRVIVITGDNKATAEAICRRIGVFSE+E T GKS+TGREFDDL+ E ++EAVR A+LFARVEPAHKSKIVE+LQ DGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIV+AVEEGRAIY+NMKQFIRYLISSNVGEVVSIFLTAALG+PEALIPVQLLWVNLVTDG PATALGFNPPDLDIMS+PPRST +PLI+GWLFFRY+A+G YVG ATVG+AAWWF IY KGPQLNYYQ                                    LTHQ+QCLAQESRF+G+DC IF HPKPMTMALSVLV++EMLNAMNSLSENQSLL MPPW N WL+G+M++S+ LHF ILEVDFL+ VFQ+TPLS+EEW  V++ S PVI +DE+LKLIARKFTDG+
Sbjct:    1 MENAHCRKVEDVLAYFNVDEETGLSDEQIKRQTEKHGLNELPAEEAKSIWELIFEQFDDLLVKILLLAAVISFVLALFEEDDDSITAFVEPFVILLILVANAVVGVWQERNAESAIEALKEYEPEIAKVYRKNHHGIQRIKAVNLVPGDIVEVSVGDKVPADVRITKIFSTTMRVDQSILTGESVSVLKMTEEVPDPRAVNQDKKNLLFSGTNIASGKCRGVVVGTGLSTEIGKIRNQMMDTEQDKTPLQQKLDEFGQQLSKVISIICIAVWAINIGHFNDPAHGGSWMRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAAKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRAFIFNQADENNISTLQFEITGSKYAPEGEVFLNGQRVKCGEYEGLIELANICAMCNDSAVDYNETKNIYEKVGEATETALCVFVEKMNVYNVSKLGLSKKDVGMVCNHNIQEMWEKLFTLEFSRDRKSMSAFVTPKGKSSNQYPVGGVSTASGPGPRMFVKGAPEGVLDRCTFVRVGNKKVAMTPQIKAEIVKLTAAYGTGRDTLRCLALATCDAPIPKEQMDLEDSTKFKKYETNLTFVGVVGMLDPPRTEVYDSIMKCRHAGIRVIVITGDNKATAEAICRRIGVFSEDEPTTGKSFTGREFDDLTYEEQREAVRHARLFARVEPAHKSKIVEFLQADGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVSAVEEGRAIYSNMKQFIRYLISSNVGEVVSIFLTAALGLPEALIPVQLLWVNLVTDGFPATALGFNPPDLDIMSRPPRSTSDPLISGWLFFRYLAIGGYVGCATVGSAAWWFLIYNKGPQLNYYQLTHHMQCLAEHDNFHGIDCHIFENPKPMTMALSVLVLTHQSQCLAQESRFKGIDCLIFGHPKPMTMALSVLVMVEMLNAMNSLSENQSLLVMPPWTNYWLLGAMIMSIGLHFFILEVDFLANVFQLTPLSLEEWIVVIEFSLPVIFIDEILKLIARKFTDGE 1042          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: H2KSK6 (Calcium-transporting ATPase OS=Clonorchis sinensis OX=79923 GN=CLF_109631 PE=3 SV=1)

HSP 1 Score: 1628.61 bits (4216), Expect = 0.000e+0
Identity = 801/1000 (80.10%), Postives = 900/1000 (90.00%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYV-----------NPAKEGSPKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTD 3311
            MEN+  K + EVL +F+VDEE GLSD+QVK+   ++G NE+PAEE KALW+L+LEQFDDLLVKILLLAAIISFVLALFEE E++I+AFVEPFVI+LILIANA++GVWQERNAESAIEALKEYEPEIAKV+RKN  G+Q+IKARELVPGDI +++VGDKVPAD+RITKI STT+R+DQSILTGESVSVIK ++A+PDPRAVNQDKKN+LFSGTN+A+GK RGVV+ TGL TEIGKIRNQMM+TEQ++TPLQQKLDEFGQQLSKVI+IIC+AVWAINIGHFNDPAHGGSW++GAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMA KNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV RMF+FS   +     H FEITGSKYAPEGEVFLNGQ+V +G+Y+ L+EIANICAMCNDS+IDYNE+K  YEKVGEATETAL CLVEKMNV+  SK+GL+KK L M CNH IQ  W KEFTLEFSRDRKSMS Y+           N   E  P+MF KGAPEG+LDRC+FVRV  KK+PMT A+K+EI++    YGTGRDTLRCLALAT D+P  K QMNLEDS++F  YE N+TFVGVVGMLDPPR EV DS++KCR +GIRVI+ITGDNKATAEAICRRIG+F E+E T GKS+TGREFD L  E ++EA RRA+LFARVEPAHKSKIVE+LQ DGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSA++MVLADDNF +IV AVEEGRAIYNNMKQFIRYLISSN+GEVVSIFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM++PPR+ ++PLI+GWLFFRY+AVG YVG ATVGAAAWWFT+YPKGPQLNYYQLTHQ+QCLAQESRFEG+DC+IF HPKPMTMALSVLVLIEMLNAMNSLSENQSLL MPPWVNLWL+ +MVLSMSLHFLILEVDFLSKVFQITPL++EEWF V+KIS PV+L+DE LKLIARKFTD
Sbjct:    1 MENAFSKEIKEVLGHFDVDEETGLSDDQVKKSGAKYGPNELPAEEAKALWELVLEQFDDLLVKILLLAAIISFVLALFEESEETISAFVEPFVILLILIANAVIGVWQERNAESAIEALKEYEPEIAKVFRKNHHGIQRIKARELVPGDIVEVSVGDKVPADMRITKIMSTTLRVDQSILTGESVSVIKFTEAVPDPRAVNQDKKNMLFSGTNIAAGKARGVVVCTGLMTEIGKIRNQMMDTEQDKTPLQQKLDEFGQQLSKVISIICVAVWAINIGHFNDPAHGGSWLKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAAKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFIFSKTDDRAPEVHHFEITGSKYAPEGEVFLNGQRVESGEYDGLIEIANICAMCNDSAIDYNESKHVYEKVGEATETALCCLVEKMNVYKTSKSGLSKKDLSMVCNHQIQNLWTKEFTLEFSRDRKSMSVYLLPKPNSAAKIPNTGSETGPRMFVKGAPEGVLDRCSFVRVEGKKVPMTPALKAEIVKHVAAYGTGRDTLRCLALATSDSPPAKGQMNLEDSSKFVNYEQNLTFVGVVGMLDPPRMEVLDSVIKCRKSGIRVIMITGDNKATAEAICRRIGIFGEDEPTSGKSFTGREFDALPIEEQREACRRARLFARVEPAHKSKIVEFLQEDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAADMVLADDNFRSIVLAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNRPPRNIKDPLISGWLFFRYLAVGGYVGCATVGAAAWWFTLYPKGPQLNYYQLTHQSQCLAQESRFEGIDCAIFTHPKPMTMALSVLVLIEMLNAMNSLSENQSLLVMPPWVNLWLMLAMVLSMSLHFLILEVDFLSKVFQITPLTLEEWFMVIKISLPVLLIDETLKLIARKFTD 1000          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: atp2a1 (sarcoplasmic/endoplasmic reticulum calcium ATPase 1-like [Source:NCBI gene;Acc:103045170])

HSP 1 Score: 1431.39 bits (3704), Expect = 0.000e+0
Identity = 707/999 (70.77%), Postives = 841/999 (84.18%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGSP----KMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTDGKNKHV 3329
            MEN+H +   E L YF+V+E  GLS EQ K+ + +FG+NE+PAEE K +W+L++EQF+DLLV+ILLLAA ISFVLA FEE E+++TAFVEPFVI+LILIANA+VGVWQERNAESAIEALKEYEPE+ KVYR + K VQ+IKARE+VPGDI +++VGDKVPADIRIT I STT+R+DQSILTGESVSVIKH++++PDPRAVNQDKKN+LFSGTN+A+GK  GV + TG+ TEIGKIR+QM  TEQE+TPLQQKLDEFG+QLSKVI++IC+AVW INIGHFNDP HGGSW+RGA+YYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM V +MF+   +    +S  Q++I+GSKY PEGEV   G  V+ G  + L+E+A ICA+CNDSS+DYNE+K  YEKVGEATETAL CLVEKMNV N    GL+K +   AC   I+   KKEFTLEFSRDRKSMS Y +P K        KMF KGAPEG++DRCA+VRVG+ ++P+T  +K +IM +  E+GTGRDTLRCLALAT D+  +KE+MNLEDS +F  YET++TFVG VGMLDPPR EV  SI  CR AGIRVI+ITGDNK TA AICRRIG+F E+E   G+++TGREFDDL    +++AVR+A  +ARVEP+HKSKIVE+LQ   E++AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFS+IVAAVEEGRAIYNNMKQFIRYLISSNVGEVV IFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM K PRS +EPLI+GWLFFRY+A+G+YVGAATV AAAWWF     GP +++YQL+H  QC A+   FEG++C +F    PMTMALSVLV IEM NA+NSLSENQSL++MPPW NLWLV +M LSMSLHF+I+ VD L  +F++T L++E+W  V+K+SFPVIL+DE+LK +AR + + K++++
Sbjct:    1 MENAHTQESAECLAYFSVNEGTGLSPEQFKKNLTKFGYNELPAEEGKTIWELVVEQFEDLLVRILLLAACISFVLAWFEEGEETVTAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYEPEMGKVYRADRKSVQRIKAREIVPGDIVEVSVGDKVPADIRITSIKSTTLRVDQSILTGESVSVIKHTESVPDPRAVNQDKKNMLFSGTNIAAGKAIGVAVATGVSTEIGKIRDQMAATEQEKTPLQQKLDEFGEQLSKVISLICVAVWMINIGHFNDPVHGGSWIRGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMCVTKMFIIDKVEGDSVSLDQYDISGSKYTPEGEVTKRGLPVKCGQLDGLIELATICALCNDSSLDYNESKGIYEKVGEATETALCCLVEKMNVFNTEVRGLSKVERANACCSVIKQLMKKEFTLEFSRDRKSMSVYCSPGKPSKAPMGNKMFVKGAPEGVIDRCAYVRVGTNRVPLTGPVKDKIMAVIKEWGTGRDTLRCLALATRDSLLRKEEMNLEDSTKFADYETDLTFVGCVGMLDPPRKEVMGSIQLCRAAGIRVIMITGDNKGTAVAICRRIGIFGEDEDVTGRAFTGREFDDLPLTQQRDAVRKACCYARVEPSHKSKIVEFLQGFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSSIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMGKAPRSPKEPLISGWLFFRYLAIGSYVGAATVAAAAWWFIYSDDGPMVSFYQLSHFMQCSAENEDFEGIECEVFESAPPMTMALSVLVTIEMCNALNSLSENQSLVRMPPWSNLWLVAAMSLSMSLHFMIIYVDPLPMIFKLTHLTLEQWLVVLKLSFPVILIDELLKFVARNYLEQKDENL 999          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: atp2a3 (sarcoplasmic/endoplasmic reticulum calcium ATPase 1 [Source:NCBI gene;Acc:103024029])

HSP 1 Score: 1429.46 bits (3699), Expect = 0.000e+0
Identity = 714/1004 (71.12%), Postives = 831/1004 (82.77%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGS-PKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTDGKNKHVHYTDLKQM 3353
            MEN+H K+  EVL  F+V+E  GL+ EQVK   ER+G NE+PAEE K+LW+L++EQF+DLLV+ILLLAA +SFVLALFEE E+S TAFVEP VI+LILIANA++GVWQERNAE+AIEALKEYEPE+ KVYR N K VQ+IKARE+VPGDI ++AVGDKVPADIRI  I STT+R+DQSILTGESVSVIKH+D +PDPRAVNQDKKN+LFSGTN+A+G+  GVV+ TG+ TEIGKIRNQM  TEQE+TPLQQKLDEFGQQLSKVI++IC+AVW INIGHF DP HGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV RMFV      +  S H+F ITGS YAPEG+V    + V+ GD++ LLE+A IC+MCNDSS+DYNE K  YEKVGEATETALT LVEKMNV     +GL+K +   ACN  I+   KKEFTLEFSRDRKSMS Y  P K GS  KMF KGAPE ++DRC  VR+GS K  +T A K E+M    ++GTG+DTLRCLALAT D P +K+ M+LE++ +F  YE+++TFVG VGMLDPPR EV  S+  C  AGIRVI+ITGDNK TA AICRRIG+F+E+E   GK+YTGREFDDL+ E ++EAV+RA+ FARVEPAHKSKIV YLQ   E++AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVL+DDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVV IFLTA LG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM KPPR+ +EPLI+GWLFFRY+A+G YVG  TVGAA WW+    +GPQ+++ QL H  QC      F+G+DC +F    P TMALSVLV IEM NA+NSLSENQSLL+MPPWVN+WL+G+++LS+SLHFLIL V+ L  +FQ+TPL   +W  V+KIS PVILLDE LK ++R   +G+ +   Y   +Q+
Sbjct:    1 MENAHTKSASEVLRNFDVNENTGLTLEQVKTNQERYGPNELPAEEGKSLWELVVEQFEDLLVRILLLAACVSFVLALFEEGEESTTAFVEPLVILLILIANAVIGVWQERNAENAIEALKEYEPEMGKVYRMNRKAVQRIKAREIVPGDIVEVAVGDKVPADIRIVSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGRAIGVVVCTGVSTEIGKIRNQMACTEQEKTPLQQKLDEFGQQLSKVISLICVAVWVINIGHFGDPVHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFVVDKADSSSCSLHEFNITGSTYAPEGQVLKGVKPVQCGDFDGLLELATICSMCNDSSLDYNEAKGVYEKVGEATETALTTLVEKMNVFKTDLSGLSKVERAGACNSVIRQLMKKEFTLEFSRDRKSMSVYCTPTKSGSQSKMFVKGAPESVIDRCTHVRIGSGKAELTIAAKEELMSTIRDWGTGKDTLRCLALATRDTPPRKQDMDLENATKFAAYESDLTFVGCVGMLDPPRKEVIGSVKLCSEAGIRVIMITGDNKGTAVAICRRIGIFTEHEDVEGKAYTGREFDDLAPEAQREAVKRARCFARVEPAHKSKIVGYLQSFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLSDDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAILGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDKPPRNPKEPLISGWLFFRYLAIGGYVGLGTVGAATWWYLFDEQGPQVSFNQLRHFMQCTEDNPMFKGIDCEVFESRYPTTMALSVLVTIEMFNALNSLSENQSLLRMPPWVNIWLLGAIILSLSLHFLILYVEPLPLIFQVTPLHCSQWIVVLKISIPVILLDEALKYVSRHHLEGEEEE-RYMKSRQL 1003          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: atp2a1 (sarcoplasmic/endoplasmic reticulum calcium ATPase 1-like [Source:NCBI gene;Acc:103045170])

HSP 1 Score: 1429.08 bits (3698), Expect = 0.000e+0
Identity = 706/993 (71.10%), Postives = 836/993 (84.19%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGSP----KMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTD 3311
            MEN+H +   E L YF+V+E  GLS EQ K+ + +FG+NE+PAEE K +W+L++EQF+DLLV+ILLLAA ISFVLA FEE E+++TAFVEPFVI+LILIANA+VGVWQERNAESAIEALKEYEPE+ KVYR + K VQ+IKARE+VPGDI +++VGDKVPADIRIT I STT+R+DQSILTGESVSVIKH++++PDPRAVNQDKKN+LFSGTN+A+GK  GV + TG+ TEIGKIR+QM  TEQE+TPLQQKLDEFG+QLSKVI++IC+AVW INIGHFNDP HGGSW+RGA+YYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM V +MF+   +    +S  Q++I+GSKY PEGEV   G  V+ G  + L+E+A ICA+CNDSS+DYNE+K  YEKVGEATETAL CLVEKMNV N    GL+K +   AC   I+   KKEFTLEFSRDRKSMS Y +P K        KMF KGAPEG++DRCA+VRVG+ ++P+T  +K +IM +  E+GTGRDTLRCLALAT D+  +KE+MNLEDS +F  YET++TFVG VGMLDPPR EV  SI  CR AGIRVI+ITGDNK TA AICRRIG+F E+E   G+++TGREFDDL    +++AVR+A  +ARVEP+HKSKIVE+LQ   E++AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFS+IVAAVEEGRAIYNNMKQFIRYLISSNVGEVV IFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM K PRS +EPLI+GWLFFRY+A+G+YVGAATV AAAWWF     GP +++YQL+H  QC A+   FEG++C +F    PMTMALSVLV IEM NA+NSLSENQSL++MPPW NLWLV +M LSMSLHF+I+ VD L  +F++T L++E+W  V+K+SFPVIL+DE+LK +AR + +
Sbjct:    1 MENAHTQESAECLAYFSVNEGTGLSPEQFKKNLTKFGYNELPAEEGKTIWELVVEQFEDLLVRILLLAACISFVLAWFEEGEETVTAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYEPEMGKVYRADRKSVQRIKAREIVPGDIVEVSVGDKVPADIRITSIKSTTLRVDQSILTGESVSVIKHTESVPDPRAVNQDKKNMLFSGTNIAAGKAIGVAVATGVSTEIGKIRDQMAATEQEKTPLQQKLDEFGEQLSKVISLICVAVWMINIGHFNDPVHGGSWIRGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMCVTKMFIIDKVEGDSVSLDQYDISGSKYTPEGEVTKRGLPVKCGQLDGLIELATICALCNDSSLDYNESKGIYEKVGEATETALCCLVEKMNVFNTEVRGLSKVERANACCSVIKQLMKKEFTLEFSRDRKSMSVYCSPGKPSKAPMGNKMFVKGAPEGVIDRCAYVRVGTNRVPLTGPVKDKIMAVIKEWGTGRDTLRCLALATRDSLLRKEEMNLEDSTKFADYETDLTFVGCVGMLDPPRKEVMGSIQLCRAAGIRVIMITGDNKGTAVAICRRIGIFGEDEDVTGRAFTGREFDDLPLTQQRDAVRKACCYARVEPSHKSKIVEFLQGFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSSIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMGKAPRSPKEPLISGWLFFRYLAIGSYVGAATVAAAAWWFIYSDDGPMVSFYQLSHFMQCSAENEDFEGIECEVFESAPPMTMALSVLVTIEMCNALNSLSENQSLVRMPPWSNLWLVAAMSLSMSLHFMIIYVDPLPMIFKLTHLTLEQWLVVLKLSFPVILIDELLKFVARNYLE 993          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: atp2a3 (sarcoplasmic/endoplasmic reticulum calcium ATPase 1 [Source:NCBI gene;Acc:103024029])

HSP 1 Score: 1425.61 bits (3689), Expect = 0.000e+0
Identity = 711/986 (72.11%), Postives = 823/986 (83.47%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGS-PKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIAR 3299
            MEN+H K+  EVL  F+V+E  GL+ EQVK   ER+G NE+PAEE K+LW+L++EQF+DLLV+ILLLAA +SFVLALFEE E+S TAFVEP VI+LILIANA++GVWQERNAE+AIEALKEYEPE+ KVYR N K VQ+IKARE+VPGDI ++AVGDKVPADIRI  I STT+R+DQSILTGESVSVIKH+D +PDPRAVNQDKKN+LFSGTN+A+G+  GVV+ TG+ TEIGKIRNQM  TEQE+TPLQQKLDEFGQQLSKVI++IC+AVW INIGHF DP HGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV RMFV      +  S H+F ITGS YAPEG+V    + V+ GD++ LLE+A IC+MCNDSS+DYNE K  YEKVGEATETALT LVEKMNV     +GL+K +   ACN  I+   KKEFTLEFSRDRKSMS Y  P K GS  KMF KGAPE ++DRC  VR+GS K  +T A K E+M    ++GTG+DTLRCLALAT D P +K+ M+LE++ +F  YE+++TFVG VGMLDPPR EV  S+  C  AGIRVI+ITGDNK TA AICRRIG+F+E+E   GK+YTGREFDDL+ E ++EAV+RA+ FARVEPAHKSKIV YLQ   E++AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVL+DDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVV IFLTA LG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM KPPR+ +EPLI+GWLFFRY+A+G YVG  TVGAA WW+    +GPQ+++ QL H  QC      F+G+DC +F    P TMALSVLV IEM NA+NSLSENQSLL+MPPWVN+WL+G+++LS+SLHFLIL V+ L  +FQ+TPL   +W  V+KIS PVILLDE LK ++R
Sbjct:    1 MENAHTKSASEVLRNFDVNENTGLTLEQVKTNQERYGPNELPAEEGKSLWELVVEQFEDLLVRILLLAACVSFVLALFEEGEESTTAFVEPLVILLILIANAVIGVWQERNAENAIEALKEYEPEMGKVYRMNRKAVQRIKAREIVPGDIVEVAVGDKVPADIRIVSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGRAIGVVVCTGVSTEIGKIRNQMACTEQEKTPLQQKLDEFGQQLSKVISLICVAVWVINIGHFGDPVHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFVVDKADSSSCSLHEFNITGSTYAPEGQVLKGVKPVQCGDFDGLLELATICSMCNDSSLDYNEAKGVYEKVGEATETALTTLVEKMNVFKTDLSGLSKVERAGACNSVIRQLMKKEFTLEFSRDRKSMSVYCTPTKSGSQSKMFVKGAPESVIDRCTHVRIGSGKAELTIAAKEELMSTIRDWGTGKDTLRCLALATRDTPPRKQDMDLENATKFAAYESDLTFVGCVGMLDPPRKEVIGSVKLCSEAGIRVIMITGDNKGTAVAICRRIGIFTEHEDVEGKAYTGREFDDLAPEAQREAVKRARCFARVEPAHKSKIVGYLQSFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLSDDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAILGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDKPPRNPKEPLISGWLFFRYLAIGGYVGLGTVGAATWWYLFDEQGPQVSFNQLRHFMQCTEDNPMFKGIDCEVFESRYPTTMALSVLVTIEMFNALNSLSENQSLLRMPPWVNIWLLGAIILSLSLHFLILYVEPLPLIFQVTPLHCSQWIVVLKISIPVILLDEALKYVSR 986          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: ENSAMXT00000046993.1 (sarcoplasmic/endoplasmic reticulum calcium ATPase 2 [Source:NCBI gene;Acc:103040450])

HSP 1 Score: 1425.22 bits (3688), Expect = 0.000e+0
Identity = 723/991 (72.96%), Postives = 841/991 (84.86%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGSP--KMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTD 3311
            MEN+H KTV+EV +YF+V+E  GL  +Q+KRQ E++G NE+PAEE K+LW+L++EQF+DLLV+ILLLAA ISFVLA FEE E++ITAFVEPFVI+LILIANAIVGVWQERNAE+AIEALKEYEPE+ KVYR++ K VQ+IKAR++VPGDI ++AVGDKVPADIR+T I STT+R+DQSILTGESVSVIKH+D +PDPRAVNQDKKN+LFSGTN+A+GK  GVV+ TG++TEIGKIR++M  TEQERTPLQQKLDEFG+QLSKVI++ICIAVW INIGHFNDP HGGSW+RGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV RMF+   +     S  +F +TGS YAPEGEV+ +G+ V+   Y+ L+E+A ICA+CNDSS+D+NE K  YEKVGEATETALTCLVEKMNV +    GL+K +   ACN  I+   KKEFTLEFSRDRKSMS Y  P K  S   KMF KGAPEG++DRC  +RVGS K+P+T  IK +I+ +  EYGTGRDTLRCLALAT DNP  KE + LEDS +F +YET++TFVG VGMLDPPR EV  S+  CR+AGIRVI+ITGDNK TA AICRRIG+F EN+     ++TGREFDDLS   ++EAV  A+ FARVEP+HKSKIVEYLQ   E++AMTGDGVNDAPALKKAEIGIAMGSGTAVAK+ASEMVLADDNF+TIVAAVEEGRAIYNNMKQFIRYLISSNVGEVV IFLTAALG PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM+KPPR+ REPLI+GWLFFRY+A+G YVGAATVGAAAWWF     GP++ +YQL+H  QC      ++GV+C IF  P PMTMALSVLV IEM NA+NS+SENQSLL+MPPW N+WL+G++ LSMSLHFLIL V+ L  +FQITPL++ +W  V+KIS PVILLDEVLK  AR + +
Sbjct:    1 MENAHTKTVEEVYSYFSVNESTGLGLDQLKRQKEKWGPNELPAEEGKSLWELVVEQFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILIANAIVGVWQERNAENAIEALKEYEPEMGKVYRQDRKSVQRIKARDIVPGDIVEVAVGDKVPADIRLTSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAVGVVVATGVNTEIGKIRDEMASTEQERTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFIIDQVQGDSCSLREFTVTGSTYAPEGEVYQDGKPVKCSKYDALVEMATICALCNDSSLDFNEAKGVYEKVGEATETALTCLVEKMNVFDNDLKGLSKIERANACNSVIKQLMKKEFTLEFSRDRKSMSVYCTPNKARSSIGKMFVKGAPEGVIDRCTHIRVGSNKVPLTPGIKEKILSVIREYGTGRDTLRCLALATRDNPISKEDLVLEDSTRFVEYETDLTFVGCVGMLDPPRAEVAASMKLCRLAGIRVIMITGDNKGTAVAICRRIGIFGENDDVSSMAFTGREFDDLSPATQREAVLTARCFARVEPSHKSKIVEYLQSYDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKTASEMVLADDNFATIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNAREPLISGWLFFRYLAIGGYVGAATVGAAAWWFIAAEDGPRVTFYQLSHFLQCGPDNPEYKGVNCEIFESPYPMTMALSVLVTIEMCNALNSVSENQSLLRMPPWENVWLLGAICLSMSLHFLILYVEPLPMIFQITPLNLTQWLMVLKISLPVILLDEVLKFAARNYLE 991          
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010373.1 (pep scaffold:Pmarinus_7.0:GL481096:3909:20014:1 gene:ENSPMAG00000009373.1 transcript:ENSPMAT00000010373.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1194.49 bits (3089), Expect = 0.000e+0
Identity = 615/845 (72.78%), Postives = 704/845 (83.31%), Query Frame = 3
Query:  801 IAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGSP----KMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGV--VGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTDGK 3317
            +AVGDKVPADIR+T I STT+R+DQSILTGESVSVIKH+D +PDPRAVNQDKKN+LFSGTN+A+GK  GVV+ TG++TEIGKIR++M  TEQ++TPLQQKLDEFG+QLSKVI++ICIAVW INIGHFNDP HGGSW+RGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV RMF+         S ++F ITGS YAPEGEV+ N + VR G+Y+ L+E+A ICA+CNDSS+D+NE K  YEKVGEATETALTC VEKMNV +    GL+K +   ACN+ I+   KKEFTLEFSRDRKSMS Y  P K        KMF KGAPEG++DRC+ VRVG+ K+PMTA +K +I+    EYGTGRDTLRCLALAT D P ++E MNL DS +F  YE ++TFVG   VGMLDPPR EV  SI+ CR AGIRVI   GDNK TA AICRRIG+F E+E    K+YTGREFDDL  E ++ A +RA+ FARVEP+HKSKIVE+LQ   E++AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFS+IVAAVEEGRAIYNNMKQFIRYLISSNVGEVV IFLTAALG PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM +PPR+ +EPLI+GWLFFRY+A+G YVGAATVGAAAWWF     GP + +YQL+H  QC  +   FEG+DC +F  P PMTMALSVLV IEM NA+NSLSENQSLL+MPPW N+WL+G++ LSMSLHFLIL V+ L  +FQITPL++E+W  V+KIS PVILLDE LK IAR + +GK
Sbjct:    1 LAVGDKVPADIRLTSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAVGVVVATGVNTEIGKIRDEMAATEQDKTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWMRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFIIDRADGENCSLNEFTITGSTYAPEGEVYKNDKLVRCGEYDGLIELATICALCNDSSLDFNEAKGVYEKVGEATETALTCQVEKMNVFDTHLVGLSKVERANACNNVIKQLMKKEFTLEFSRDRKSMSVYCTPVKPSRSSVGNKMFVKGAPEGVIDRCSHVRVGTTKLPMTAGMKEKILATIREYGTGRDTLRCLALATRDMPPRREDMNLIDSTKFASYEVDLTFVGCVGVGMLDPPRKEVSSSIILCREAGIRVI---GDNKGTAVAICRRIGIFGEDEDVKDKAYTGREFDDLPLEEQRLACQRARCFARVEPSHKSKIVEFLQSCDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSSIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRNPKEPLISGWLFFRYLAIGCYVGAATVGAAAWWFMAADDGPGVTFYQLSHFMQCTPEHPDFEGLDCHVFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWDNIWLLGAICLSMSLHFLILYVEPLPIIFQITPLNLEQWLVVLKISLPVILLDETLKFIARNYLEGK 842          
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Match: atp2c1 (ATPase secretory pathway Ca2+ transporting 1 [Source:ZFIN;Acc:ZDB-GENE-060503-615])

HSP 1 Score: 230.72 bits (587), Expect = 1.897e-66
Identity = 151/493 (30.63%), Postives = 252/493 (51.12%), Query Frame = 3
Query: 1830 CYVNPAKEGSPKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMK-KEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARK 3302
            C    A++ +   F KGA E ++D C   R     +P++A  +  ++    E   G   LR LA+A+   P   +                +TF+G+VG++DPPR  V  S+     +G+ V ++TGD+  TA AI  R+G+ S      G + +G E  DL E  +  + +R+  +F R  P HK KIV+ LQ +GEV  MTGDGVNDA AL+ A+IG+AMG SGT V K A++M+L DD+F TI++A+EEG+ I+ N+K F+R+ +S+++  +  I L   +  P  L  +Q+LW+N++ DG PA +LG  P D D++ +PPR+ ++ ++T  L  + +                   I   G    +++                      I P+  TM  +  V  +M NA++S S+ +S+ +   + N     ++  S+     ++    L +VFQ   LS  +   ++ ++  V +  EV+K + R+
Sbjct:    2 CVQCGAQDKAEVYFVKGAFERVIDMCCSFRGQGHTLPLSA--QQLVLYKQEETYMGASGLRVLAMAS--GPELGQ----------------LTFLGLVGIIDPPRPGVRKSVAILVSSGVSVKMVTGDSMETAVAIANRLGLSSNGG---GAAISGEE--DLMETTQLSQIIRKVSVFYRASPRHKLKIVKALQKNGEVVGMTGDGVNDAVALRAADIGVAMGRSGTDVCKEAADMILVDDDFYTIMSAIEEGKGIFYNIKNFVRFQLSTSIAALTLITLATLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRQPPRNVKDSILTRSLISKILISA---------------IIIVSGTLFVFWRELQDN----------------MITPRDTTMTFTCFVFFDMFNALSSRSQTKSVFESGFFSNRMFCYAVGGSIMGQMAVIYFPPLQQVFQTENLSAVDLLFLLGLTSTVWIASEVMKAVERR 438          
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Match: atp2c1 (ATPase secretory pathway Ca2+ transporting 1 [Source:ZFIN;Acc:ZDB-GENE-060503-615])

HSP 1 Score: 214.927 bits (546), Expect = 4.122e-61
Identity = 143/475 (30.11%), Postives = 238/475 (50.11%), Query Frame = 3
Query: 1881 APEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARK 3302
            A E ++D C   R     +P++A  +  ++    E   G   LR LA+A+   P   +                +TF+G+VG++DPPR  V  S+     +G+ V ++TGD+  TA AI  R+G+ S      G + +G E            V +  +F R  P HK KIV+ LQ +GEV  MTGDGVNDA AL+ A+IG+AMG SGT V K A++M+L DD+F TI++A+EEG+ I+ N+K F+R+ +S+++  +  I L   +  P  L  +Q+LW+N++ DG PA +LG  P D D++ +PPR+ ++ ++T  L  + +                   I   G    +++                      I P+  TM  +  V  +M NA++S S+ +S+ +   + N     ++  S+     ++    L +VFQ   LS  +   ++ ++  V +  EV+K + R+
Sbjct:    1 AFERVIDMCCSFRGQGHTLPLSA--QQLVLYKQEETYMGASGLRVLAMAS--GPELGQ----------------LTFLGLVGIIDPPRPGVRKSVAILVSSGVSVKMVTGDSMETAVAIANRLGLSSNGG---GAAISGEEAWGGRHPAAAFVVLQVSVFYRASPRHKLKIVKALQKNGEVVGMTGDGVNDAVALRAADIGVAMGRSGTDVCKEAADMILVDDDFYTIMSAIEEGKGIFYNIKNFVRFQLSTSIAALTLITLATLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRQPPRNVKDSILTRSLISKILISA---------------IIIVSGTLFVFWRELQDN----------------MITPRDTTMTFTCFVFFDMFNALSSRSQTKSVFESGFFSNRMFCYAVGGSIMGQMAVIYFPPLQQVFQTENLSAVDLLFLLGLTSTVWIASEVMKAVERR 421          
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002888.1 (pep scaffold:Pmarinus_7.0:GL478641:194938:205936:1 gene:ENSPMAG00000002641.1 transcript:ENSPMAT00000002888.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 191.43 bits (485), Expect = 7.592e-52
Identity = 121/336 (36.01%), Postives = 185/336 (55.06%), Query Frame = 3
Query: 1875 KGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKK--EQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSE-NETTFGKS-------------------YTGREFDDLSEEMKKEAVRRAK--LFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTR 2807
            KGAPE ILDRC+ + +  ++  +   ++        E G   +  R L L  L  P  +       +  N  +  E ++  VG++ M+DPPR  V D++ KCR AGI+VI+ TGD+  TA+AI + +G+ SE NET    +                     G +  +++E    + ++     +FAR  P  K  IVE  Q  G + A+TGDGVND+ ALKKA+IGIAMG  G+ V+K A++M+L DDNF++IV  VEEGR I++N+K+ I Y ++SN+ E+          +P  L  V +L ++L TD +PA +L +   + DIM + PR+ R
Sbjct:   65 KGAPERILDRCSSIIIEGQEESLDEELEEAFQNAYLELGGLGE--RVLGLCQLRLPVDQFPRGYAFDTENINFPME-DLCLVGLMSMIDPPRATVPDAVGKCRSAGIKVIMATGDHPITAKAIAKSVGIISEGNETVEDIAARLNIPVNQVDPRDAKACVVHGSDLKNMTETQLDDILKNYTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSLALKKADIGIAMGIVGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFILCNIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNVR 397          
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009058.1 (pep scaffold:Pmarinus_7.0:GL480374:1:11062:-1 gene:ENSPMAG00000008154.1 transcript:ENSPMAT00000009058.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 167.162 bits (422), Expect = 1.195e-44
Identity = 123/426 (28.87%), Postives = 206/426 (48.36%), Query Frame = 3
Query:  339 EIMENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFD---DLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCN 1607
            E+  + H  ++DE+   +  D   GL++ +    + R G N +    T   W    +Q      LL+ +  +   +++ +    E E S        V+  ++I       +QE  +   +++ +   P+ A V R+  K   ++ A  +V GD+ +I  GD++PAD+RI  + S   ++D S LTGES    +  D   D      + +N+ F  TN   G  RG+VI TG  T +G+I       E  RTP+  +++ F   ++ V   + ++ + +++        G SW+   I+     + + VA +PEGL A +T CL L  +RMAKKN +V++L +VETLG TS ICSDKTGTLT N+M+VA M+  + I E + +  Q      K +P                 T   +A + ++CN
Sbjct:   36 EVSLDDHKLSLDELHRKYGTDLSRGLTNVRAAEILARDGPNALTPPPTTPEWVKFCKQLFGGFSLLLWVGAILCFLAYGIQAATEDEPSNDNLYLGVVLSAVVIITGCFSYYQESKSSRIMDSFRNMVPQQALVIREGEK--TQLNAELVVLGDLVEIKGGDRIPADLRI--VSSHGCKVDNSSLTGESEPQSRSPDFTHDNPL---ETRNIAFFSTNCVEGTARGIVINTGDHTVMGRIATLASGLEGGRTPINIEIEHFIHIITGVAVFLGVSFFILSL------ILGYSWLEAVIFL----IGIIVANVPEGLLATVTVCLTLTAKRMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTAFDKSSP-----------------TWTALARVASLCN 427          
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Match: PMR1 (High affinity Ca2+/Mn2+ P-type ATPase; required for Ca2+ and Mn2+ transport into Golgi; involved in Ca2+ dependent protein sorting, processing; D53A mutant (Mn2+ transporting) is rapamycin sensitive, Q783A mutant (Ca2+ transporting) is rapamycin resistant; Mn2+ transport into Golgi lumen required for rapamycin sensitivity; mutations in human homolog ATP2C1 cause acantholytic skin condition Hailey-Hailey disease; human ATP2C1 can complement yeast null mutant [Source:SGD;Acc:S000003135])

HSP 1 Score: 410.609 bits (1054), Expect = 7.149e-127
Identity = 306/995 (30.75%), Postives = 509/995 (51.16%), Query Frame = 3
Query:  366 TVDEVLNYFNVDEEVGL-SDEQVKRQVERFGFNEMPAEETKALWQLILEQF-DDLLVKXXXXXXXXSFVLALFEEH-EDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAI--------PDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGSPKMFCKGAPEGILD-RCAFVRVGSKKI-PMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYE--TNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGS-GTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARK 3302
            +VDE L   + D+  GL S  +   +   +G NE+  E+ ++L++  L  F +D ++    L  I S V++LF  + +D+++  +  F+++        VG  QE  +E ++EAL +  P    + R   +    + A  LVPGD+    +GD++PADIRI  I +  + ID+S LTGE+  V K S  I        P+      ++  + + GT V  G  +G+V+GTG +T  G +   M   E+ +TPLQ  +D+ G+ LS V  I+   +  + I        G SW+      F+I+V+LAVAAIPEGLP ++T  LALG  RMAK+ AIVR LPSVETLG  +VICSDKTGTLT+N M+V++++   +++  +++    +         G    N +   T D    L I N   +CN++S  +++  + +  +G  T+ AL                   +QL       I+   +K   L F+  RK M+  +    +    ++ KGA E IL+   ++++   KK   +T A K+ I        +  + LR    A         ++ L DS+     +   ++TF G++GM DPPR  V  +I +    G+ +I+ITGD++ TA  I ++IG+   +        +G + D++S++     +    +FAR  P HK  IV  L+  G+V AMTGDGVNDAPALK ++IG++MG  GT VAK AS+MVL DD+FSTI+ A+EEG+ I+NN++ F+ + +S++V  +  + L+ A  +P  L  +Q+LW+N++ DG PA +LG  P D ++M KPPR   + ++T  +  R +     +            T+Y     +   ++    +  A+++                TM  +  V  +M NA+      +S+ ++  + N     ++ LS+      + + F   +F+   L + +   ++ IS  V ++DE+ KL  RK
Sbjct:   42 SVDEALEKLDTDKNGGLRSSNEANNRRSLYGPNEITVEDDESLFKKFLSNFIEDRMI----LLLIGSAVVSLFMGNIDDAVSITLAIFIVV-------TVGFVQEYRSEKSLEALNKLVPAECHLMRCGQE--SHVLASTLVPGDLVHFRIGDRIPADIRI--IEAIDLSIDESNLTGENEPVHKTSQTIEKSSFNDQPNSIVPISERSCIAYMGTLVKEGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSLVSFIVIGMICLVGI------IQGRSWLE----MFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMS-NKLNVLSLDKNKKTKNSNG----NLKNYLTEDVRETLTIGN---LCNNAS--FSQEHAIF--LGNPTDVALL------------------EQLANFEMPDIRNTVQKVQELPFNSKRKLMATKILNPVDNKCTVYVKGAFERILEYSTSYLKSKGKKTEKLTEAQKATINECANSMAS--EGLRVFGFA---------KLTLSDSSTPLTEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGIPVIDPKL--SVLSGDKLDEMSDDQLANVIDHVNIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVALSTAFKLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTHDVMKRLLTTAACIIVG---------TVY-----IFVKEMAEDGKVTARDT----------------TMTFTCFVFFDMFNALACRHNTKSIFEIGFFTNKMFNYAVGLSLLGQMCAIYIPFFQSIFKTEKLGISDILLLLLISSSVFIVDELRKLWTRK 938          
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Match: ENA2 (P-type ATPase sodium pump; involved in Na+ efflux to allow salt tolerance; likely not involved in Li+ efflux [Source:SGD;Acc:S000002446])

HSP 1 Score: 325.479 bits (833), Expect = 1.230e-94
Identity = 277/915 (30.27%), Postives = 453/915 (49.51%), Query Frame = 3
Query:  357 HVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQ-LILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRI--TKIFSTTIRIDQSILTGESVSVIKHSDAI--PDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKI--------------------RNQMMETEQER---------TPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFV--FSNIT-----------ETEIS-THQFEITGSKYAPEGEV-FLNGQKVRTGD-----------YETLLE---IANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNV-HN-LSKAGLTKK-----QLGMACNHHIQGFWKKEFTLEFSRD---RKSMSCYVNPAKEGSPKMFCKGAPEGILDRCA--FVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLED----SNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKS------YTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPE-------ALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLIT 2822
            H  T +E   +       GL+ ++  R+++  G N +  ++TK  ++ ++L Q  + ++ +L+++  ISF +       D IT  V  FVI +    N ++G+ QE  A   + +LK      A V R N K  + I ++++VPGDIC + VGD +PAD+R+  TK F T    D+S+LTGES+ V K ++ +   +      D+ NL FS + V  G+ +G+VI T L++EIGKI                    +N  + T++           TPL +KL +    L  +  +  I V A      +         R AIY    A+ +A++ IP  L  V+T  +++G   M  +N IVR L S+E LG  + ICSDKTGTLT  +M   ++++  F  IT           E  +S   +F      +  +G+V  L   K R  +           ++  LE   +ANI  +  D + D       ++  G+ TE A+     KM++ HN L+    T +     Q  ++ ++   G  + E   EF  D   ++  S Y N   E +  ++ KGA E I+  C+  + + G K  P+T      I +    Y    + LR L  A+    F K+Q+N +     ++     E+++ F+G++G+ DPPR E   ++ K   AGI V ++TGD   TA+AI + +G+   N   + +        TG +FD LSEE   +      + AR  P  K +++E L    +  AMTGDGVND+P+LK A +GIAMG +G+ V+K AS++VL+DDNF++I+ AVEEGR + +N+++F+  L++ NV +  +++L   L   +        L PV++LW+ +VT   PA  LG      D+M +PP  +   + T
Sbjct:   18 HTLTTEEAAEFIGTSLTEGLTQDESLRRLKAVGENTL-GDDTKIDYKAMVLHQVCNAMIMVLVISMAISFAV------RDWITGGVISFVIAV----NVLIGLVQEYKATKTMNSLKNLSSPNAHVIR-NGKS-ETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDT----DESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDK--------RVAIY----AICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATD------CWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNE-TYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRK--NVYSLSNEGLRVLGFAS--KSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQ--ALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFT 890          
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Match: ENA5 (Protein with similarity to P-type ATPase sodium pumps; member of the Na+ efflux ATPase family [Source:SGD;Acc:S000002445])

HSP 1 Score: 324.709 bits (831), Expect = 1.802e-94
Identity = 277/915 (30.27%), Postives = 453/915 (49.51%), Query Frame = 3
Query:  357 HVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQ-LILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRI--TKIFSTTIRIDQSILTGESVSVIKHSDAI--PDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKI--------------------RNQMMETEQER---------TPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFV--FSNIT-----------ETEIS-THQFEITGSKYAPEGEV-FLNGQKVRTGD-----------YETLLE---IANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNV-HN-LSKAGLTKK-----QLGMACNHHIQGFWKKEFTLEFSRD---RKSMSCYVNPAKEGSPKMFCKGAPEGILDRCA--FVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLED----SNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKS------YTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPE-------ALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLIT 2822
            H  T +E   +       GL+ ++  R+++  G N +  ++TK  ++ ++L Q  + ++ +L+++  ISF +       D IT  V  FVI +    N ++G+ QE  A   + +LK      A V R N K  + I ++++VPGDIC + VGD +PAD+R+  TK F T    D+S+LTGES+ V K ++ +   +      D+ NL FS + V  G+ +G+VI T L++EIGKI                    +N  + T++           TPL +KL +    L  +  +  I V A      +         R AIY    A+ +A++ IP  L  V+T  +++G   M  +N IVR L S+E LG  + ICSDKTGTLT  +M   ++++  F  IT           E  +S   +F      +  +G+V  L   K R  +           ++  LE   +ANI  +  D + D       ++  G+ TE A+     KM++ HN L+    T +     Q  ++ ++   G  + E   EF  D   ++  S Y N   E +  ++ KGA E I+  C+  + + G K  P+T      I +    Y    + LR L  A+    F K+Q+N +     ++     E+++ F+G++G+ DPPR E   ++ K   AGI V ++TGD   TA+AI + +G+   N   + +        TG +FD LSEE   +      + AR  P  K +++E L    +  AMTGDGVND+P+LK A +GIAMG +G+ V+K AS++VL+DDNF++I+ AVEEGR + +N+++F+  L++ NV +  +++L   L   +        L PV++LW+ +VT   PA  LG      D+M +PP  +   + T
Sbjct:   18 HTLTTEEAAEFIGTSLTEGLTQDESLRRLKAVGENTL-GDDTKIDYKAMVLHQVCNAMIMVLVISMAISFAV------RDWITGGVISFVIAV----NVLIGLVQEYKATKTMNSLKNLSSPNAHVIR-NGKS-ETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDT----DESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDK--------RVAIY----AICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATD------CWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNE-TYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRK--NVYSLSNEGLRVLGFAS--KSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQ--ALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPNDSEVGIFT 890          
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Match: ENA1 (P-type ATPase sodium pump; involved in Na+ and Li+ efflux to allow salt tolerance [Source:SGD;Acc:S000002447])

HSP 1 Score: 321.627 bits (823), Expect = 2.288e-93
Identity = 277/915 (30.27%), Postives = 452/915 (49.40%), Query Frame = 3
Query:  357 HVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQ-LILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRI--TKIFSTTIRIDQSILTGESVSVIKHSDAI--PDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKI--------------------RNQMMETEQER---------TPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFV--FSNIT-----------ETEIS-THQFEITGSKYAPEGEV-FLNGQKVRTGD-----------YETLLE---IANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNV-HN-LSKAGLTKK-----QLGMACNHHIQGFWKKEFTLEFSRD---RKSMSCYVNPAKEGSPKMFCKGAPEGILDRCA--FVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLED----SNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKS------YTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPE-------ALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLIT 2822
            H  T +E   +       GL+ ++   +++  G N +  ++TK  ++ ++L Q  + ++ +LL++ IISF +       D IT  V  FVI +    N ++G+ QE  A   + +LK      A V R N K  + I ++++VPGDIC + VGD +PAD+R+  TK F T    D+S+LTGES+ V K ++ +   +      D+ NL FS + V  G+ +G+VI T L++EIGKI                    +N  + T++           TPL +KL +    L  +  +  I V A      +         R AIY    A+ +A++ IP  L  V+T  +++G   M  +N IVR L S+E LG  + ICSDKTGTLT  +M   ++++  F  IT           E  +S   +F      +  +G+V  L   K R  +           ++  LE   +ANI  +  D + D       ++  G+ TE A+     KM++ HN L+    T +     Q  ++ ++   G  + E   EF  D   ++  S Y N   E +  ++ KGA E I+  C+  + + G K  P+T      I +    Y    + LR L  A+    F K+Q+N +     ++     E+++ F+G++G+ DPPR E   ++ K   AGI V ++TGD   TA+AI + +G+   N   + +        TG +FD LSEE   +      + AR  P  K +++E L    +   MTGDGVND+P+LK A +GIAMG +G+ V+K AS++VL+DDNF++I+ AVEEGR + +N+++F+  L++ NV +  +++L   L   +        L PV++LW+ +VT   PA  LG      D+M +PP  +   + T
Sbjct:   18 HTLTAEEAAEFIGTSLTEGLTQDEFVHRLKTVGENTL-GDDTKIDYKAMVLHQVCNAMIMVLLISMIISFAM------HDWITGGVISFVIAV----NVLIGLVQEYKATKTMNSLKNLSSPNAHVIR-NGKS-ETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDT----DESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDK--------RVAIY----AICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATD------CWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNE-TYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRK--NVYSLSNEGLRVLGFAS--KSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQ--ALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFT 890          
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Match: PMC1 (Vacuolar Ca2+ ATPase involved in depleting cytosol of Ca2+ ions; prevents growth inhibition by activation of calcineurin in the presence of elevated concentrations of calcium; similar to mammalian PMCA1a [Source:SGD;Acc:S000002974])

HSP 1 Score: 180.259 bits (456), Expect = 1.649e-46
Identity = 122/364 (33.52%), Postives = 194/364 (53.30%), Query Frame = 3
Query: 1794 TLEFSRDRKSMSCYVNPAKEGSPK-----MFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGE--YGTGRDTLRCLALATLD----NPFKKEQMNLEDS------NQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKS-YTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEA--LIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLIT 2822
            T+ F   RK     V   KEG  K      F KGA E +   C++ R     +     I  +  + T +       D LR +++A  D    + +  EQ+  +DS      +  +  +  +   G++G+ DP R  V +S+ +C+ AG+ V ++TGDN  TA+AI R   + S + ++   S   G EF  L++  +   +   ++ AR  P  K  +VE L+  G+V A+TGDG NDAPALK A++G +MG SGT VA+ AS+++L  D+FS IV A++ GR +  ++K+FI++ +  N+  V+  F+++     E   L  VQLLW+NL+ D L A AL  + PD +IM + PR     LI+
Sbjct:  612 TIPFESSRKWAGLVVK-YKEGKNKKPFYRFFIKGAAEIVSKNCSYKRNSDDTL---EEINEDNKKETDDEIKNLASDALRAISVAHKDFCECDSWPPEQLRDKDSPNIAALDLLFNSQKGLILDGLLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNILTAKAIARNCAILSTDISSEAYSAMEGTEFRKLTKNERIRILPNLRVLARSSPEDKRLLVETLKGMGDVVAVTGDGTNDAPALKLADVGFSMGISGTEVAREASDIILMTDDFSAIVNAIKWGRCVSVSIKKFIQFQLIVNITAVILTFVSSVASSDETSVLTAVQLLWINLIMDTLAALALATDKPDPNIMDRKPRGRSTSLIS 971          

HSP 2 Score: 134.035 bits (336), Expect = 4.189e-32
Identity = 115/410 (28.05%), Postives = 187/410 (45.61%), Query Frame = 3
Query:  372 DEVLNYFNVDEEVGLSDEQVK--RQVERF---GFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFE-----------EHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIK------------------HSDAIP-DPRAVNQDKKN----LLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAI-----------NIGHFND--PAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMF 1445
            + +  Y   D+  G+S  ++   R+  R+   G N +P    K+  QL+   F+D  +++L +AA++SFVL L+E            ++     ++E   IM+ +    +V    +   E     L + +     +  +N + +  I    ++ GD+  +  GD VPAD     + S     D+S +TGES ++ K                  H+ + P D   VN+D       +L SG+ + SG  RGV+   G+++  G+    +   E E TPLQ  L +    +S    +  I ++ +             G F+D  PA  GS     +  F  ++ + V A+PEGLP  +T  LA  T RM K   +VR L S ET+G  + +CSDKTGTLT N M+V R F
Sbjct:   60 NSLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLPERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGNKIKQVDWIEGVAIMIAVFVVVLVSAANDYQKELQFAKLNKKKENRKIIVIRNDQEIL-ISIHHVLVGDVISLQTGDVVPAD---CVMISGKCEADESSITGESNTIQKFPVDNSLRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGSRILSGLGRGVITSVGINSVYGQTMTSL-NAEPESTPLQLHLSQLADNISVYGCVSAIILFLVLFTRYLFYIIPEDGRFHDLDPAQKGSKF---MNIFITSITVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKTGTLTENVMTVVRGF 461          
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Match: EDO47465 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM93])

HSP 1 Score: 1401.34 bits (3626), Expect = 0.000e+0
Identity = 708/1007 (70.31%), Postives = 823/1007 (81.73%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAK-------EGSPKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKF-TDGKNKHVHYTD 3341
            M+ +H K V E+L YFNV E  GL   QVK+  ++FG NE+PAE+ K LW+L+LEQFDDLLVKILL+AA+ISFVLALFEE ED  TAFVEP VI++ILI NAI+GVWQERNAESAIEALKEYEPEIAKV R++  G+Q IKAR+LVPGDI ++AVGDKVPADIRIT I STT+R+DQSILTGES+SV+KH+DAIPD RAVNQDK N+LFSGTN+ASGKC GVV+GTGL T+IGKIR+QM+ ++ ERTPLQQKLDEFG+QLSKVITIICIAVWAINIGHFNDP HGGSW++GAIYYFKIAVALAVAAIPEGLPAV+T CLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV + FV  +I+      H+FE+ G+ Y P G++  +G+ V T DYE L E A IC++CNDSS+DYN  + +YEKVGE+TETAL  LVEK+NV N+   G TK QL   CN  I+  + KEFTLEFSRDRKSMS Y  P K       +G PKMF KGAPEGILDRC FVRVG+KK PMT  +K++I+ +   YGTG DTLRCLALAT+D+P    +M+LE S +F  YE++MTFVGV GMLDPPR EV D+I  C  AGIRVIVITGDNKATAEAICRRI VF ++E T G SY+GREFDDL+   ++EA  RA+LF+RVEP+HKSKIV YLQ +GE+SAMTGDGVNDAPALKKAEIG+AMGSGTAVAK+ASEM+LADDNFSTIVAAVEEGR+IY+N KQFIRYLISSN+GEVVSIFLTAALGMPEALIPVQLLWVNL+TDG PATAL FNPPD DIMSKPPRS R+PLI+GWLFFRY+A+G YVG ATVGA+AWWF  Y  GP+++YYQLTH  QC    S   G+DC++F    PMTMALSVLV IEM NA+NSL+EN+SLL MPPW N  L+ ++  S  +HFLIL     + +F+ITPL+  EW AV+K SFPVILLDEVLK I+R F       H H  D
Sbjct:    1 MDLAHTKPVPEILKYFNVSESKGLDPAQVKQFQKKFGPNELPAEDGKPLWKLVLEQFDDLLVKILLVAAVISFVLALFEEGEDQTTAFVEPIVILVILILNAIIGVWQERNAESAIEALKEYEPEIAKVQRQDKSGIQMIKARDLVPGDIVEVAVGDKVPADIRITTIKSTTLRVDQSILTGESISVVKHTDAIPDERAVNQDKTNMLFSGTNIASGKCSGVVVGTGLSTQIGKIRDQMIPSDDERTPLQQKLDEFGEQLSKVITIICIAVWAINIGHFNDPIHGGSWLKGAIYYFKIAVALAVAAIPEGLPAVVTICLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVHKFFVMKDISRGRAEFHEFEVEGTTYDPVGDITKDGRNVTTSDYEVLPEFATICSLCNDSSVDYNNVRDSYEKVGESTETALIVLVEKLNVLNVDLEGKTKAQLATICNESIKNHFNKEFTLEFSRDRKSMSVYCVPQKDGPNSFLDGKPKMFVKGAPEGILDRCDFVRVGNKKHPMTPKMKAQILDLIKAYGTGADTLRCLALATVDDPIAPSKMDLEASEKFVNYESHMTFVGVAGMLDPPRPEVTDAIKLCAKAGIRVIVITGDNKATAEAICRRIEVFGQDEDTTGLSYSGREFDDLTPSEQREACLRARLFSRVEPSHKSKIVTYLQEEGEISAMTGDGVNDAPALKKAEIGVAMGSGTAVAKTASEMILADDNFSTIVAAVEEGRSIYDNTKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLMTDGPPATALSFNPPDSDIMSKPPRSPRQPLISGWLFFRYLAIGVYVGCATVGASAWWFMFYENGPKVSYYQLTHHMQCGTDPSF--GLDCAVFGDLHPMTMALSVLVTIEMFNALNSLAENESLLTMPPWRNPSLLTAIAASFLMHFLILYFPITNTIFRITPLNWVEWMAVLKFSFPVILLDEVLKFISRTFVVHSAPLHKHKVD 1005          
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Match: EDO35616 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL15])

HSP 1 Score: 484.567 bits (1246), Expect = 1.466e-154
Identity = 337/999 (33.73%), Postives = 520/999 (52.05%), Query Frame = 3
Query:  369 VDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQD-----KKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWV--RGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSID----YNE-TKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGSPKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRI-TGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTDGKNK 3323
            V+EVL  FN D+  GLS+++++R+    G+NE    E KALW+  L+QF + ++ +LL +  +S  +  F++   SIT      V +LI++  A V   QE  ++ ++EA+ +  P      R  A  +    AR LVPGD+  I++GD+VPADIR+T+  +  + ID+S  TGE     K +  IP   AVN       ++N+ F GT V SG+ +GVVIGTG ++E G+I   M   E  +TPLQ+ +D  G+QLS     +CI    + +G          W+  R  +  F I V+LAVAAIPEGLP V+T  LALG  RMAK+NAIV+ LP VETLGC+SVICSDKTGTLT N+M+V+++F               E TG  Y+P GEV LN   +      ++ +      +CN++SI     Y + T+ A   V +   T  TC ++ + V     +   KK + + C        +     E +RD                  + KGAPE ++ +C         +PMTA    ++ RI           LR +A A           + ED  Q       +T++G++G+LDPPR  V +++     +G++V +ITGD++ TA  I   +G+  +   T     +G E + L        + +  +F RV P HK  IV+ LQ  G V AMTGDGVNDA ALK+A+IGIAMG SGT V+K A+EM+L DD+F+TI+AA+EEG+ I+ N+K F+R+ +S+++  +  I ++  L +P  L  +Q+LW+N++ DG PA +LG  P D D+M +PPR+ + P+IT  L  + +          V    W F                      +E R         I P+  TM  +  V  +M NA++  S+ +S+ ++    N   + ++  S+   FL++    L  VFQ   L + +   ++ +S  V ++DE+ K I  + +  + +
Sbjct:   16 VEEVLKQFNTDQSRGLSNDEIERRRMLHGWNEFDVVEEKALWKKYLDQFKEPMILLLLASGFVSICMGQFDDAF-SIT------VAILIVVTVAFV---QEYRSDKSVEAITKLVPPQCHCVR--AGKMFNFLARCLVPGDLVCISIGDRVPADIRLTE--AVDLEIDESSFTGEMEPASKTTLPIP---AVNSGSGVSARRNIAFMGTLVRSGRGKGVVIGTGENSEFGEIFKLMKAEETPKTPLQKSMDSLGKQLS--FYSLCIIGLIVLLG----------WIQKRAILEMFTIGVSLAVAAIPEGLPIVVTVTLALGVMRMAKRNAIVKKLPIVETLGCSSVICSDKTGTLTKNEMTVSQIFTADGFYA--------EATGVGYSPLGEVILNEDPITYTSNSSIAKTVEAGYLCNNASIRNGVLYGQPTEGAIVTVAQKAST-FTCGIDFVRVDERPFSS-EKKLMAVKCRRK----HRSSAMAEIARD----------------IYYVKGAPENVMRQCTSYYKNGSAVPMTA---KDVERIGDAVLAMSSRGLRVIAFA-----------HGEDLQQ-------LTYLGIMGLLDPPRNGVREAVRTLLDSGVQVKMITGDSRETAITIAELLGIHFKGRPTL----SGEELEALDGLQLSTIIDQVSVFYRVSPRHKVAIVKALQQHGHVVAMTGDGVNDAVALKRADIGIAMGKSGTDVSKEAAEMILVDDDFNTIMAAIEEGKGIFYNIKNFVRFQLSTSIAAISLITISTFLKLPNPLNAMQILWINIIMDGPPAQSLGVEPVDSDVMRRPPRNVKSPMITKTLIAKVI----SAALLIVCGTLWVFW---------------------REMRDN------IITPRDTTMTFTCFVFFDMFNALSCRSQEKSIFQVGFLTNRMFLYAVGGSLIGQFLVIYFAPLQAVFQTEALHITDILLLLAVSSSVFIVDEIRKFITYRVSKRRRQ 899          
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Match: EDO40680 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6M1])

HSP 1 Score: 353.599 bits (906), Expect = 2.055e-104
Identity = 267/848 (31.49%), Postives = 421/848 (49.65%), Query Frame = 3
Query:  357 HVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQ----FDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQ-DKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKM--NVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGSPKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLE---DSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSEN------------------ETTFGKSYT--GREFDDLSEEMKKEAV---RRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPR 2798
            H  TV+E++   + + + GL+DE+   +++R G N +    T   W   ++Q    F  LL    +L  I   ++   EE       ++   V+  ++I   I   +QE  +   +E+ K   P+ A V R  + G + + A  LV GD+  +  GD++P DIRI +  S   ++D S LTGES    +     PD    N  + +NL F  T    G   GVV+ TG +T +G+I N        +TP+  +++ F   ++ V   + +  + I             W+   I+     + + VA +PEGL A +T CL L  +RMA KN +V++L +VETLG TS ICSDKTGTLT N+M+VA ++  +NI E + S  Q + +G K              ++  +  L  +A +C      +   ++     E  G+A+E+AL   VE    NV +  K      ++     +  Q     E   E   D +  S      K     +  KGAPE ILDRC+ + V  K+  +    K    +   + G   +  R L       P ++  +  E   + N  +  E  + FVG++ M+DPPR  V D++ KCR AGI+VI++TGD+  TA+AI + +G+ SE                   + T  K+    G +  D  +E K + +       +FAR  P  K  IVE  Q  G + A+TGDGVND+PALKKA+IG+AMG +G+ V+K A++M+L DDNF++IV  VEEGR I++N+K+ I Y ++SN+ E+    +   L +P  L  V +L ++L TD +PA +L +   + DIM + PR
Sbjct:   72 HRITVEELMTRLDTNVQTGLTDEEAAIRLKRDGPNALTPPPTTPEWVKFMKQMFGGFAMLLWIGAILCFIAQGIMEATEEEPLRDNLYL-GIVLAFVVIVTGIFSYYQESKSSKIMESFKNLVPQEANVLR--SGGRKTVGAENLVIGDVVSVKGGDRLPGDIRILECKS--FKVDNSSLTGES----EPQSRGPDCTHENPLETRNLAFFSTYALEGNATGVVVQTGDNTVMGRIANLASGLGSGKTPIAVEIEHFIHIITGVAVFLGVTFFIIAF------ILKYKWLEAVIFL----IGIIVANVPEGLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHLWYDNNIVEADTSEDQKQASGEK--------------KSTTWYALSRVATLCNRAEFKADQEDKPVLKRECTGDASESALLKYVELAIGNVISFRKNHKKVCEIPFNSTNKYQ-VSIHEIPDEPEHDIEEGSDVDEREKNSKHILVMKGAPERILDRCSTILVNGKEQALDDKEKENFNQAYLDLGGLGE--RVLGFCHFYLPTEQFPLGFEFDPEDNPNFPLE-GLCFVGLMSMIDPPRAAVPDAVSKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGTETVEDIAERLNIPVEEVDETKAKAIVVHGSQLKDYDQE-KIDGILCNHTEIVFARTSPQQKLIIVEGCQRMGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEISPFLMFIILDIPLPLGTVTILCIDLGTDMVPAISLAYEHAENDIMKRQPR 881          
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Match: EDO36455 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SII2])

HSP 1 Score: 347.051 bits (889), Expect = 4.621e-102
Identity = 296/1044 (28.35%), Postives = 483/1044 (46.26%), Query Frame = 3
Query:  357 HVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFV---LALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQ-DKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKV----GEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGSPKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEI-MRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETN--------MTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTF--------------GKSYT------GREFDDLSEEMKKEAVRRAK--LFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTR-EPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTI-----YPKGPQLNYYQLTH------------QAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTDG 3314
            H   ++ ++N  +   E GLS E+ + ++ER G N +    T   W   L+        +L + AI  ++   + +  E E           +  +++  A    +QE  +   +++ K   P+ A + R   K V+   A ++V GDI  +A+GD+VPADIR+  I S   ++D S LTGES    +     P+    N  + KNL F  TN   G C G+V+ TG +T +G+I          +TP+  ++  F   ++ V   + +  + I++        G + ++  I+     + + VA +PEGL A +T CL L  +RMA KN +V++L +VETLG TS ICSDKTGTLT N+M+VA M+  +   E + +  Q      K                   ET   +  I  +CN +     +   A  +     G A+E AL   VE + V +++K    +++             K   ++    D  S   +          +  KGAPE +LDRC+ + +  +  P+   +K    M      G G   L           F +  ++ E+    +++ET+        + FVG++ M+DPPR  V D++ KCR AGI+V ++TGD+  TA+AI + +G+ SE   T                KS        G E  D++++   + ++  K  +FAR  P  K  IVE  Q +G + A+TGDGVND+PALKKA+IGIAMG SG+ V+K A++M+L DDNF++IV  VEEGR I++N+K+ I Y ++SN+ E+    +    G+P+ L  + +L ++L TD +PA +L +   + DIM + PR  R E L+   L    M  G             +F I     +  G   N   L              Q    AQ    E    S F            +V+++  + +   +   S++      ++ ++G ++   +L   +L    LS    +  L+   WF  V  S  + + DEV + I RK+  G
Sbjct:   79 HKVPLEALVNRLDSSVEKGLSQEEAEVRLERDGPNCLTPPPTTPEWVKFLKLLFGGFSLLLWVGAIFCYIVYSIKMSVEEEPPQDDLYLGVTLTFVVVVTACFSYYQESKSSKIMDSFKNMVPQEATILRDGKKVVKN--AEQVVIGDIIFVAIGDRVPADIRV--IESKGFKVDNSSLTGESEPQARG----PEFTHENPLETKNLAFFSTNAVEGTCTGIVVQTGDNTVMGRIAGLASGLGSGKTPIAIEIGHFIHIITGVAVALGVTFFIISL------VLGYTILQAVIFL----IGIIVANVPEGLLATVTVCLTLTAKRMAAKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKTFEADTTEDQSGTAMEKT------------------ETWTALGRIAGLCNRAEFVSGQDNVAVLRRDTMGGNASEAALLKCVE-LQVGSVTK---MREEFHRVAEIPFNSTNKYHVSIHEINDENSTYSH---------HLLMKGAPERVLDRCSTILIKGELKPLDDDMKQAFEMAYLDLGGMGERVLG----------FAQHYLDKENFPIGFEFETDEPNFPVEGLCFVGLMSMIDPPRAAVPDAVAKCRSAGIKVFMVTGDHPITAKAIAQGVGIISEGTETVEDISLRLEIPVEEVDKSQADAIVVHGGELKDMTDKDIDDILKNHKEIVFARTSPQQKLIIVEGCQRNGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLMFIVAGIPQPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRMPRDPRTEKLVNERLI--SMTYGQIGFMQASAGFLTYFVIMAENGFLPGDLFNIRGLWEDKTNNTLLDSYGQEWGYAQRKVLEFTCHSAF---------FVSIVVVQWADLIICKTRRNSIITQKMNNHILIIG-LIFETALAAFLLYTPGLSTALSLYGLNASWWFIGVPYSILIFVYDEVRRYILRKYPGG 1051          
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Match: EDO41775 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3I0])

HSP 1 Score: 276.559 bits (706), Expect = 4.034e-77
Identity = 275/1046 (26.29%), Postives = 468/1046 (44.74%), Query Frame = 3
Query:  423 EQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHE----DSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALK---EYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMET----------------------------------------------EQERTPLQQKLDEFGQQL------SKVITIICIAVWAINIGHFNDPAHGGSW----VRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTL----EFSRDRKSMSCYVNPAKEGSPKMFCKGAPEGILDRCAFV--RVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNP--FKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDL--------SEEMKKEAVRRAKLFARVEPAHKSKIVE-----YLQMDGEVSAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNS-LSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARK 3302
            E ++ +   FG N +P +  K  W+ +++   D  + IL +AA++S +L +F   E    ++ T +++ F I++ +   A+V    +   E     L+   E E +   +   +AK   +I   E+V GD+C I  GD +PAD  + +  S  +++D+S LTGES  V K             +K  L  +GT++  G  + +V   GL+++ G I   +  T                                              +QE++ LQ KL +    +      + ++TII +A+      +  + A   SW    +   +  F   + + V A+PEGLP  +T  LA   ++M   N +VR L + ET+G  + ICSDKTGTLTTN+M+V +++      +T     +      +++PE                 LLEI     +C    I  N + ++   V    E      +  M V N ++  L    L +   +        E T      F+  RKSMS  +    +G  ++F KGA E +L RC  +  R G  +   +    S +  +     +  D LR + +A  D P   K       D +      + MT + + G+ DP R EV  +I KC+ AGI V ++TGDN  TA +I  + G+   ++        G+EF+ L        S++   E   R ++ AR  P  K  +V+      L    E+ A+TGDG ND PALKKA++G AMG +GT VAK AS+++L DDNF +IV AV  GR +Y+++ +F+++ ++ N+  +V  F+ A +     L   QLLWVNL+ D   + AL   PP  +++++ P    +PLIT  +    +  G Y            F +  KG +  ++ +        ++   E   C    H     +  +  VL+++ N +NS +   +  +    + N   VG M  +  +  LI+E+    K F +  L+ E+W   + + F  +L  +++  I ++
Sbjct:   76 EDIENRKRVFGPNVIPPKPPKTFWEFLVDACKDTTLIILTVAAVVSLLLGIFAPEECGGSEANTGWIDGFAILIAVCIVALVTAVNDYQKEQQFRGLQSKIELEHKFTVIRNGDAK---EILNSEIVVGDLCQIKYGDLLPADGVVVQ--SNDLKVDESSLTGESDMVKKG------------EKDPLFLAGTHIMEGSGKMIVTAVGLNSQSGIIFTLLGATHPDKIDSGDDAPPQSPAIKGAPGDDFEDVNLDDDQESSENGKERKDKQEKSVLQAKLTKLAVTIGWFGVAAALLTIIVMALQFSIRKYVKEKA---SWQNTHLNAYVNAFITGLTVLVVAVPEGLPLAVTISLAYSVKKMLDDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQLYTMGQHHKTIPENPK------EFSPE-----------------LLEI-----LCK--GIALNSSYASNCVVNGGRE------ILPMQVGNKTECALLGLVLDLGDTYQDYRDNNPESTFVKVYTFNSSRKSMSTAIR-MPDGGYRLFSKGASEILLSRCTSIIGRNGQPEPFSSQDCLSLVQSVIEPMAS--DGLRTICMAYRDFPPTGKDHDDTPPDWDDEAGILSEMTAIAIAGIEDPVRQEVPAAIKKCQQAGIVVRMVTGDNVNTARSIAGKCGILEPDKDFL--VLDGKEFNKLIRDSNGRVSQKKFDEIWPRLRVLARSSPEDKYTLVKGIIDSKLNPAREIVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFRSIVMAVMWGRNVYDSISKFLQFQLTVNLVAIVIAFVGACVVEVSPLTGTQLLWVNLIMDSFASLALATEPPTEELLTRKPYGRTKPLITRTMIRNILGHGVYQIIVL-------FVLVFKGAE--FFDI--------EDGFLEETRCKPTQHS---AVIFNTFVLMQLFNEINSRMVHGERNVFKGIFRNPIFVGIMGGTFIVQILIIEL--TGKAFHVVGLNWEQWMWCIFLGFTELLWGQLVLTIPKE 1038          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: atp2a1 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1 [Source:NCBI gene;Acc:101160483])

HSP 1 Score: 1443.71 bits (3736), Expect = 0.000e+0
Identity = 715/995 (71.86%), Postives = 836/995 (84.02%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEG----SPKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTDGK 3317
            MEN+H K   EVL +F V E+ GLS +QVKR +E++GFNE+PAEE K++W L++EQF+DLLV+ILLLAA ISFVLA FEE E+++TAFVEPFVI+LILIANAIVGVWQERNAESAIEALKEYEPE+ KVYR + K VQ+IKARE+VPGD+ +++VGDKVPADIRI  I STT+R+DQSILTGESVSVIKH+DA+PDPRAVNQDKKN+LFSGTN+A+GK  G+ + TG+ TEIGKIR+QM  TEQE+TPLQQKLDEFG+QLSKVI++IC+AVW INIGHFNDP HGGSW+RGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM V +MF+   +    ++  QF+I+GSKY PEGEV  N   V+ G Y+ L+E+A ICA+CNDSS+DYNE+K  YEKVGEATETAL CLVEKMNV N    GL+K +    C   I+   KKEFTLEFSRDRKSMS Y  PAK        KMF KGAPEG++DRC++VRVG+ +IP+T+ +K  IM +  E+GTGRDTLRCLALAT D P +KE+MNLEDSN F  YET++TFVG VGMLDPPR EV  SI  CR AGIRVI+ITGDNK TA AICRRIG+F+E E   GK++TGREFDDLS   +K AVR+A  FARVEP+HKSKIVE+LQ   E++AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFS+IV+AVEEGRAIYNNMKQFIRYLISSNVGEVV IFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM K PRS +EPLI+GWLFFRY+A+G YVG+ATV AAAWWF    +GP + +YQL+H  QC      F+G+ C +F    PMTMALSVLV IEM NA+NSLSENQSL++MPPW NLWL+G+M LSMSLHF+I+ VD L  +F++T L++E+W  V+K+SFPVIL+DE+LK +AR + +GK
Sbjct:    1 MENAHSKESAEVLAHFGVTEDTGLSPDQVKRNLEKYGFNELPAEEGKSIWDLVVEQFEDLLVRILLLAACISFVLAWFEEGEETVTAFVEPFVILLILIANAIVGVWQERNAESAIEALKEYEPEMGKVYRADRKSVQRIKAREIVPGDVVEVSVGDKVPADIRIISIKSTTLRVDQSILTGESVSVIKHTDAVPDPRAVNQDKKNMLFSGTNIAAGKATGIAVATGVTTEIGKIRDQMAATEQEKTPLQQKLDEFGEQLSKVISLICVAVWIINIGHFNDPVHGGSWMRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMCVTKMFIIDKVEGDNVALGQFDISGSKYTPEGEVTRNSSLVKCGQYDGLVELATICALCNDSSLDYNESKGIYEKVGEATETALCCLVEKMNVFNTDVRGLSKVERANTCCSVIKQLMKKEFTLEFSRDRKSMSVYCTPAKSAKAPVGSKMFVKGAPEGVIDRCSYVRVGTNRIPLTSPVKDHIMSVIKEWGTGRDTLRCLALATRDTPPRKEEMNLEDSNHFVDYETDLTFVGCVGMLDPPRKEVTSSIELCRAAGIRVIMITGDNKGTAVAICRRIGIFTEEEDVTGKAFTGREFDDLSLYEQKNAVRKACCFARVEPSHKSKIVEFLQGFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMGKAPRSPKEPLISGWLFFRYLAIGGYVGSATVAAAAWWFLYCDEGPMVTFYQLSHFMQCSEDNEDFDGIRCEVFESAPPMTMALSVLVTIEMCNALNSLSENQSLVRMPPWSNLWLMGAMSLSMSLHFMIIYVDPLPMIFKLTHLNLEQWLMVLKLSFPVILIDELLKFVARTYLEGK 995          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: atp2a1l (sarcoplasmic/endoplasmic reticulum calcium ATPase 1 [Source:NCBI gene;Acc:101171864])

HSP 1 Score: 1438.71 bits (3723), Expect = 0.000e+0
Identity = 720/996 (72.29%), Postives = 832/996 (83.53%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAK-EGSPKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTDGKN-KH 3326
            MEN+H KT  E L +F V+E  GL+ +Q K+ +E++G+NE+PAEE K++W+LI+EQF+DLLV+ILLLAA ISFVLA FEE E+++TAFVEPFVI+LILIANAIVGVWQERNAESAIEALKEYEPE+ KVYR + K VQ IKARE+VPGDI +++VGDKVPADIRIT I STT+R+DQSILTGESVSVIKH++ +PD RAVNQDKKN+LFSGTN+A+GK  GV I TG+ TEIGKIR+QM  TEQE+TPLQ KLDEFG+QLSKVI++IC+AVWAINIGHFNDP HGGSW+RGA+YYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM V +MFV  N     +    F+I+GSKY PEGEV   G +     Y+ L+E+A ICA+CNDSS+DYNE+K  YEKVGEATETAL CLVEKMNV N +   L++ +   AC   I+   KK FTLEFSRDRKSMS Y  PAK +G  KMF KGAPEG++DRCA+VRVG+ ++P+T AIK +IM +  E+GTGRDTLRCLALAT D P K E+M LEDS +F  YET++TFVG VGMLDPPR EV  SI  CR AGIRVI+ITGDNK TA AICRRIG+FSE+E   GK+YTGREFDDL    + EAVRRA  FARVEPAHKSKIVE+LQ   +++AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFS+IVAAVEEGRAIYNNMKQFIRYLISSNVGEVV IFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM KPPRS +EPLI+GWLFFRYMA+G YVGAATVG AAWWF   P GP++ YYQL+H  QC A    F G+DC IF    PMTMALSVLV IEM NA+NSLSENQSL++MPPW N WL+ +M LSMSLHF+I+ VD L  +F++  LSV++W  V+K+SFPVIL+DEVLK +AR + +  + KH
Sbjct:    1 MENAHAKTPAECLAHFGVNENTGLTPDQFKKNLEKYGYNELPAEEGKSIWELIIEQFEDLLVRILLLAACISFVLAWFEEGEETVTAFVEPFVILLILIANAIVGVWQERNAESAIEALKEYEPEMGKVYRSDRKSVQMIKAREIVPGDIVEVSVGDKVPADIRITSIKSTTLRVDQSILTGESVSVIKHTEVVPDMRAVNQDKKNMLFSGTNIAAGKAIGVAIATGVGTEIGKIRDQMAATEQEKTPLQAKLDEFGEQLSKVISLICVAVWAINIGHFNDPVHGGSWIRGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMCVTKMFVIKNADGDHVDLDAFDISGSKYTPEGEVTQGGARTNCSQYDGLVELATICALCNDSSLDYNESKKIYEKVGEATETALCCLVEKMNVFNTNVKNLSRVERANACCSVIKQLMKKNFTLEFSRDRKSMSVYCTPAKGDGGAKMFVKGAPEGVIDRCAYVRVGTTRVPLTNAIKDKIMAVIKEWGTGRDTLRCLALATRDTPLKVEEMVLEDSTKFVDYETDLTFVGCVGMLDPPRKEVTSSIELCRNAGIRVIMITGDNKGTAIAICRRIGIFSEDEDVSGKAYTGREFDDLPLHEQAEAVRRACCFARVEPAHKSKIVEFLQGFDDITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSSIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMGKPPRSPKEPLISGWLFFRYMAIGGYVGAATVGGAAWWFLYDPTGPEITYYQLSHFMQCHADNEDFAGIDCEIFEECPPMTMALSVLVTIEMCNALNSLSENQSLVRMPPWSNFWLLAAMTLSMSLHFMIIYVDPLPMIFKLKHLSVDQWMVVLKLSFPVILIDEVLKFVARNYVESSDVKH 996          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: atp2a1l (sarcoplasmic/endoplasmic reticulum calcium ATPase 1 [Source:NCBI gene;Acc:101171864])

HSP 1 Score: 1437.55 bits (3720), Expect = 0.000e+0
Identity = 718/990 (72.53%), Postives = 829/990 (83.74%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAK-EGSPKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTD 3311
            MEN+H KT  E L +F V+E  GL+ +Q K+ +E++G+NE+PAEE K++W+LI+EQF+DLLV+ILLLAA ISFVLA FEE E+++TAFVEPFVI+LILIANAIVGVWQERNAESAIEALKEYEPE+ KVYR + K VQ IKARE+VPGDI +++VGDKVPADIRIT I STT+R+DQSILTGESVSVIKH++ +PD RAVNQDKKN+LFSGTN+A+GK  GV I TG+ TEIGKIR+QM  TEQE+TPLQ KLDEFG+QLSKVI++IC+AVWAINIGHFNDP HGGSW+RGA+YYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM V +MFV  N     +    F+I+GSKY PEGEV   G +     Y+ L+E+A ICA+CNDSS+DYNE+K  YEKVGEATETAL CLVEKMNV N +   L++ +   AC   I+   KK FTLEFSRDRKSMS Y  PAK +G  KMF KGAPEG++DRCA+VRVG+ ++P+T AIK +IM +  E+GTGRDTLRCLALAT D P K E+M LEDS +F  YET++TFVG VGMLDPPR EV  SI  CR AGIRVI+ITGDNK TA AICRRIG+FSE+E   GK+YTGREFDDL    + EAVRRA  FARVEPAHKSKIVE+LQ   +++AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFS+IVAAVEEGRAIYNNMKQFIRYLISSNVGEVV IFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM KPPRS +EPLI+GWLFFRYMA+G YVGAATVG AAWWF   P GP++ YYQL+H  QC A    F G+DC IF    PMTMALSVLV IEM NA+NSLSENQSL++MPPW N WL+ +M LSMSLHF+I+ VD L  +F++  LSV++W  V+K+SFPVIL+DEVLK +AR + +
Sbjct:    1 MENAHAKTPAECLAHFGVNENTGLTPDQFKKNLEKYGYNELPAEEGKSIWELIIEQFEDLLVRILLLAACISFVLAWFEEGEETVTAFVEPFVILLILIANAIVGVWQERNAESAIEALKEYEPEMGKVYRSDRKSVQMIKAREIVPGDIVEVSVGDKVPADIRITSIKSTTLRVDQSILTGESVSVIKHTEVVPDMRAVNQDKKNMLFSGTNIAAGKAIGVAIATGVGTEIGKIRDQMAATEQEKTPLQAKLDEFGEQLSKVISLICVAVWAINIGHFNDPVHGGSWIRGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMCVTKMFVIKNADGDHVDLDAFDISGSKYTPEGEVTQGGARTNCSQYDGLVELATICALCNDSSLDYNESKKIYEKVGEATETALCCLVEKMNVFNTNVKNLSRVERANACCSVIKQLMKKNFTLEFSRDRKSMSVYCTPAKGDGGAKMFVKGAPEGVIDRCAYVRVGTTRVPLTNAIKDKIMAVIKEWGTGRDTLRCLALATRDTPLKVEEMVLEDSTKFVDYETDLTFVGCVGMLDPPRKEVTSSIELCRNAGIRVIMITGDNKGTAIAICRRIGIFSEDEDVSGKAYTGREFDDLPLHEQAEAVRRACCFARVEPAHKSKIVEFLQGFDDITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSSIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMGKPPRSPKEPLISGWLFFRYMAIGGYVGAATVGGAAWWFLYDPTGPEITYYQLSHFMQCHADNEDFAGIDCEIFEECPPMTMALSVLVTIEMCNALNSLSENQSLVRMPPWSNFWLLAAMTLSMSLHFMIIYVDPLPMIFKLKHLSVDQWMVVLKLSFPVILIDEVLKFVARNYVE 990          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: ENSORLT00000013512.2 (sarcoplasmic/endoplasmic reticulum calcium ATPase 2 [Source:NCBI gene;Acc:101161069])

HSP 1 Score: 1425.61 bits (3689), Expect = 0.000e+0
Identity = 718/991 (72.45%), Postives = 831/991 (83.85%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGSP--KMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTD 3311
            M+N+H KTV+EVL++FNV+E  GLS E+V++Q +RFG NE+PAEE K+LW+L+LEQF+DLLV+ILLLAA ISF LA FEE E++ITAFVEPFVI+LILIANAIVGVWQERNAE+AIEALKEYEPE+ KVYR++ K VQ+IKAR++VPGDI +IAVGDKVPADIR+  I STT+R+DQSILTGESVSVIKH+D +PDPRAVNQDKKN+LFSGTN+A+GK  GVV+ T  +TEIGKIR++M  TEQERTPLQQKLDEFGQQLSKVI++ICIAVW INIGHF+DP HGGSW+RGA+YYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV RMF+            +F ITGS YAP+G VF N + V+   Y+ L+E+A ICA+CNDS++DYNE K  YEKVGEATETALTCLVEKMNV +     L+K +   ACN  I+   KKEFTLEFSRDRKSMS Y  P K  S   KMF KGAPEG++DRC  +RVGS K+PMT AIK +IM +  EYGTGRDTLRCLALAT D P  K+++ LEDS +F +YET++TFVG VGMLDPPR EV  SI  CR+AGIRVI+ITGDNK TA AICRRIG+F E +     ++TGREFDDLS   ++EAV +A+ FARVEPAHKSKIVEYLQ   E++AMTGDGVNDAPALKK+EIGIAMGSGTAVAKSASEMVLADDNF+TIVAAVEEGRAIYNNMKQFIRYLISSNVGEVV IFLTAALG PEALIPVQLLWVNLVTDG PATALGFNPPDLDIM+KPPR+ REPLI+GWLFFRY+ +G YVGAATVGAAAWWF     GP++ +YQL+H  QC      +  VDC +F  P PMTMALSVLV IEM NA+NS+SENQSLL+MPPW N+WL+GS+ LSM+LHFLIL V+ L  +FQITPL++ +W  V+KIS PVILLDE+LK  AR + +
Sbjct:    1 MDNAHTKTVEEVLSFFNVNESTGLSLEEVRKQRDRFGPNELPAEEGKSLWELVLEQFEDLLVRILLLAACISFALAWFEEGEETITAFVEPFVILLILIANAIVGVWQERNAENAIEALKEYEPEMGKVYRQDRKSVQRIKARDIVPGDIVEIAVGDKVPADIRLVSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAVGVVVATAGNTEIGKIRDEMASTEQERTPLQQKLDEFGQQLSKVISLICIAVWIINIGHFSDPVHGGSWIRGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFIVDKAGSDHCFLKEFTITGSTYAPDGAVFHNEKPVKCSQYDGLVELATICALCNDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTDLKSLSKVERANACNSVIKQLMKKEFTLEFSRDRKSMSVYCTPNKARSSLGKMFVKGAPEGVIDRCTHIRVGSTKMPMTPAIKDKIMSVIREYGTGRDTLRCLALATRDEPLHKDRLVLEDSTRFIEYETDLTFVGCVGMLDPPRAEVAASIRLCRLAGIRVIMITGDNKGTAVAICRRIGIFGEEDDVSSMAFTGREFDDLSPAAQREAVVKARCFARVEPAHKSKIVEYLQSYDEITAMTGDGVNDAPALKKSEIGIAMGSGTAVAKSASEMVLADDNFATIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNLVTDGFPATALGFNPPDLDIMTKPPRNAREPLISGWLFFRYLIIGCYVGAATVGAAAWWFVAAEDGPRITFYQLSHFLQCAPDNPDYLNVDCKVFESPYPMTMALSVLVTIEMCNALNSVSENQSLLRMPPWENVWLLGSICLSMALHFLILYVEPLPMIFQITPLNLTQWLMVLKISLPVILLDELLKFAARNYVE 991          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: ENSORLT00000013513.2 (sarcoplasmic/endoplasmic reticulum calcium ATPase 2 [Source:NCBI gene;Acc:101161069])

HSP 1 Score: 1424.84 bits (3687), Expect = 0.000e+0
Identity = 718/991 (72.45%), Postives = 831/991 (83.85%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGSP--KMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTD 3311
            M+N+H KTV+EVL++FNV+E  GLS E+V++Q +RFG NE+PAEE K+LW+L+LEQF+DLLV+ILLLAA ISF LA FEE E++ITAFVEPFVI+LILIANAIVGVWQERNAE+AIEALKEYEPE+ KVYR++ K VQ+IKAR++VPGDI +IAVGDKVPADIR+  I STT+R+DQSILTGESVSVIKH+D +PDPRAVNQDKKN+LFSGTN+A+GK  GVV+ T  +TEIGKIR++M  TEQERTPLQQKLDEFGQQLSKVI++ICIAVW INIGHF+DP HGGSW+RGA+YYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV RMF+            +F ITGS YAP+G VF N + V+   Y+ L+E+A ICA+CNDS++DYNE K  YEKVGEATETALTCLVEKMNV +     L+K +   ACN  I+   KKEFTLEFSRDRKSMS Y  P K  S   KMF KGAPEG++DRC  +RVGS K+PMT AIK +IM +  EYGTGRDTLRCLALAT D P  K+++ LEDS +F +YET++TFVG VGMLDPPR EV  SI  CR+AGIRVI+ITGDNK TA AICRRIG+F E +     ++TGREFDDLS   ++EAV +A+ FARVEPAHKSKIVEYLQ   E++AMTGDGVNDAPALKK+EIGIAMGSGTAVAKSASEMVLADDNF+TIVAAVEEGRAIYNNMKQFIRYLISSNVGEVV IFLTAALG PEALIPVQLLWVNLVTDG PATALGFNPPDLDIM+KPPR+ REPLI+GWLFFRY+ +G YVGAATVGAAAWWF     GP++ +YQL+H  QC      +  VDC +F  P PMTMALSVLV IEM NA+NS+SENQSLL+MPPW N+WL+GS+ LSM+LHFLIL V+ L  +FQITPL++ +W  V+KIS PVILLDE+LK  AR + +
Sbjct:    1 MDNAHTKTVEEVLSFFNVNESTGLSLEEVRKQRDRFGPNELPAEEGKSLWELVLEQFEDLLVRILLLAACISFALAWFEEGEETITAFVEPFVILLILIANAIVGVWQERNAENAIEALKEYEPEMGKVYRQDRKSVQRIKARDIVPGDIVEIAVGDKVPADIRLVSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAVGVVVATAGNTEIGKIRDEMASTEQERTPLQQKLDEFGQQLSKVISLICIAVWIINIGHFSDPVHGGSWIRGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFIVDKAGSDHCFLKEFTITGSTYAPDGAVFHNEKPVKCSQYDGLVELATICALCNDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTDLKSLSKVERANACNSVIKQLMKKEFTLEFSRDRKSMSVYCTPNKARSSLGKMFVKGAPEGVIDRCTHIRVGSTKMPMTPAIKDKIMSVIREYGTGRDTLRCLALATRDEPLHKDRLVLEDSTRFIEYETDLTFVGCVGMLDPPRAEVAASIRLCRLAGIRVIMITGDNKGTAVAICRRIGIFGEEDDVSSMAFTGREFDDLSPAAQREAVVKARCFARVEPAHKSKIVEYLQSYDEITAMTGDGVNDAPALKKSEIGIAMGSGTAVAKSASEMVLADDNFATIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNLVTDGFPATALGFNPPDLDIMTKPPRNAREPLISGWLFFRYLIIGCYVGAATVGAAAWWFVAAEDGPRITFYQLSHFLQCAPDNPDYLNVDCKVFESPYPMTMALSVLVTIEMCNALNSVSENQSLLRMPPWENVWLLGSICLSMALHFLILYVEPLPMIFQITPLNLTQWLMVLKISLPVILLDELLKFAARNYVE 991          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000050554.1 (SMESG000050554.1)

HSP 1 Score: 1996.48 bits (5171), Expect = 0.000e+0
Identity = 989/989 (100.00%), Postives = 989/989 (100.00%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGSPKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTD 3311
            MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKILLLAAIISFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGSPKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMAVGTYVGAATVGAAAWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTD
Sbjct:    1 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKILLLAAIISFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGSPKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMAVGTYVGAATVGAAAWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTD 989          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000050554.1 (SMESG000050554.1)

HSP 1 Score: 1974.52 bits (5114), Expect = 0.000e+0
Identity = 978/989 (98.89%), Postives = 981/989 (99.19%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGSPKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTD 3311
            MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKILLLAAIISFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGSPKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMAVGTYVGAATVGAAAWWFTIYPKGPQLNYYQLTH  QCLA+   F G+DC IF +PKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTD
Sbjct:    1 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKILLLAAIISFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGSPKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMAVGTYVGAATVGAAAWWFTIYPKGPQLNYYQLTHHMQCLAETESFNGIDCKIFQNPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTD 989          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000050554.1 (SMESG000050554.1)

HSP 1 Score: 1813.51 bits (4696), Expect = 0.000e+0
Identity = 899/910 (98.79%), Postives = 902/910 (99.12%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGSPKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMN 3074
            MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKILLLAAIISFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGSPKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMAVGTYVGAATVGAAAWWFTIYPKGPQLNYYQLTH  QCLA+   F G+DC IF +PKPMTMALSVLVLIEMLNAMN
Sbjct:    1 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKILLLAAIISFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAKEGSPKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMAVGTYVGAATVGAAAWWFTIYPKGPQLNYYQLTHHMQCLAETESFNGIDCKIFQNPKPMTMALSVLVLIEMLNAMN 910          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000039058.1 (SMESG000039058.1)

HSP 1 Score: 1518.06 bits (3929), Expect = 0.000e+0
Identity = 745/993 (75.03%), Postives = 860/993 (86.61%), Query Frame = 3
Query:  345 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAK----EGSPKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTD 3311
            ME  H +TV EVL Y+ + EE GLS++ +K   +++G+NE+P E++K+L  L+LEQFDDLLVKILLLAA+ISF+LALFE+ ED+  AFVEPFVI+LILIANA+VGVWQERNAESAIEALKEYE + AKV R + +G+QKIKARELVPGD+ +I++GDKVPADIRIT I STTIR+DQSILTGES+SVIKH+DAI D RAVNQDKKN+LFSGTN+ASGKCRGVVI  GL+TEIGKIR Q+  +E ++TPLQQKLDEFG+QLSKVI+IIC+AVWAINIGHFNDPAHGGSW+RGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V+++FV +N    EI+T  F+ITGSKYAPEGE++  G+ V+T D++ L+E++NICAMCNDS+IDYNETK  YEKVGEATETAL CLVEK+N +N+ K GL+K  L M  N+ +Q  W K+FTLEFSRDRKSMS ++ P          +MF KGAPEG++DRC FVRV  +   MT  IKSEI+R    YGTGRDTLRCLALAT+DNP K E+M+L DS +F  YET MT VGVVGMLDPPR+EV DSI KC  AGIRVIVITGDNKATAEAICRRIGVF ENETTFGKS+TGREFD+LS EM+ +A R+AKLFARVEPAHKSKI+EYLQ DG +SAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAS+MVL+DDNFS+IV+AVEEGRAIYNNMKQFIRYLISSN+GEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM + PR   +PLI+ WLFFRYM +G YVG ATVG+AAWWF  Y +GPQLNYYQLTHQAQCLAQE  F+ +DC+IF+HPKPM+MALSVLV+IEMLNA+NSLSENQSL  MPPW NLWL+G+M LS  LHF+ILEVD LSK+FQITPL++ EW AV+KIS PVI++DE +K I+RK  D
Sbjct:    1 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNELPPEKSKSLLSLVLEQFDDLLVKILLLAAVISFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADIRITSILSTTIRVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMD 993          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000039058.1 (SMESG000039058.1)

HSP 1 Score: 1516.13 bits (3924), Expect = 0.000e+0
Identity = 743/989 (75.13%), Postives = 858/989 (86.75%), Query Frame = 3
Query:  357 HVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKXXXXXXXXSFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAK----EGSPKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMXXXXXXXXXXXXXXXWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTD 3311
            H +TV EVL Y+ + EE GLS++ +K   +++G+NE+P E++K+L  L+LEQFDDLLVKILLLAA+ISF+LALFE+ ED+  AFVEPFVI+LILIANA+VGVWQERNAESAIEALKEYE + AKV R + +G+QKIKARELVPGD+ +I++GDKVPADIRIT I STTIR+DQSILTGES+SVIKH+DAI D RAVNQDKKN+LFSGTN+ASGKCRGVVI  GL+TEIGKIR Q+  +E ++TPLQQKLDEFG+QLSKVI+IIC+AVWAINIGHFNDPAHGGSW+RGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V+++FV +N    EI+T  F+ITGSKYAPEGE++  G+ V+T D++ L+E++NICAMCNDS+IDYNETK  YEKVGEATETAL CLVEK+N +N+ K GL+K  L M  N+ +Q  W K+FTLEFSRDRKSMS ++ P          +MF KGAPEG++DRC FVRV  +   MT  IKSEI+R    YGTGRDTLRCLALAT+DNP K E+M+L DS +F  YET MT VGVVGMLDPPR+EV DSI KC  AGIRVIVITGDNKATAEAICRRIGVF ENETTFGKS+TGREFD+LS EM+ +A R+AKLFARVEPAHKSKI+EYLQ DG +SAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAS+MVL+DDNFS+IV+AVEEGRAIYNNMKQFIRYLISSN+GEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM + PR   +PLI+ WLFFRYM +G YVG ATVG+AAWWF  Y +GPQLNYYQLTHQAQCLAQE  F+ +DC+IF+HPKPM+MALSVLV+IEMLNA+NSLSENQSL  MPPW NLWL+G+M LS  LHF+ILEVD LSK+FQITPL++ EW AV+KIS PVI++DE +K I+RK  D
Sbjct:    2 HNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNELPPEKSKSLLSLVLEQFDDLLVKILLLAAVISFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADIRITSILSTTIRVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMD 990          
The following BLAST results are available for this feature:
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP2A20.000e+072.68ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
ATP2A20.000e+072.68ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
ATP2A10.000e+072.54ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
ATP2A10.000e+072.65ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
ATP2A30.000e+067.43ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sca-10.000e+072.83Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
sca-10.000e+072.96Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
sca-10.000e+072.96Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
sca-10.000e+072.96Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
sca-10.000e+072.85Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SERCA0.000e+074.20gene:FBgn0263006 transcript:FBtr0072216[more]
SERCA0.000e+074.20gene:FBgn0263006 transcript:FBtr0072211[more]
SERCA0.000e+074.20gene:FBgn0263006 transcript:FBtr0072214[more]
SERCA0.000e+074.20gene:FBgn0263006 transcript:FBtr0072212[more]
SERCA0.000e+074.20gene:FBgn0263006 transcript:FBtr0072217[more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp2a30.000e+070.72ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
atp2a10.000e+070.97ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
atp2a30.000e+071.70ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
atp2a1l0.000e+071.92ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
atp2a10.000e+071.23ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP2A20.000e+072.98ATPase, Ca++ transporting, cardiac muscle, slow tw... [more]
ATP2A20.000e+072.86ATPase, Ca++ transporting, cardiac muscle, slow tw... [more]
ATP2A20.000e+072.98ATPase, Ca++ transporting, cardiac muscle, slow tw... [more]
ATP2A20.000e+072.98ATPase, Ca++ transporting, cardiac muscle, slow tw... [more]
atp2a10.000e+071.51ATPase, Ca++ transporting, cardiac muscle, fast tw... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atp2a10.000e+072.54ATPase, Ca++ transporting, cardiac muscle, fast tw... [more]
Atp2a20.000e+072.58ATPase, Ca++ transporting, cardiac muscle, slow tw... [more]
Atp2a20.000e+072.32ATPase, Ca++ transporting, cardiac muscle, slow tw... [more]
Atp2a20.000e+072.32ATPase, Ca++ transporting, cardiac muscle, slow tw... [more]
Atp2a30.000e+068.24ATPase, Ca++ transporting, ubiquitous [Source:MGI ... [more]
back to top
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P22700|ATC1_DROME0.000e+074.20Calcium-transporting ATPase sarcoplasmic/endoplasm... [more]
sp|Q7PPA5|ATC1_ANOGA0.000e+074.15Calcium-transporting ATPase sarcoplasmic/endoplasm... [more]
sp|Q292Q0|ATC1_DROPS0.000e+074.22Calcium-transporting ATPase sarcoplasmic/endoplasm... [more]
sp|P35316|ATC_ARTSF0.000e+074.42Calcium-transporting ATPase sarcoplasmic/endoplasm... [more]
sp|P70083|AT2A1_MAKNI0.000e+072.22Sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
back to top
BLAST of Calcium-transporting ATPase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3P5R60.000e+080.90Calcium-transporting ATPase OS=Schistocephalus sol... [more]
A0A5K3FDE60.000e+079.78Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A564ZBV60.000e+080.20Calcium-transporting ATPase OS=Hymenolepis diminut... [more]
A0A158QIZ20.000e+077.64Calcium-transporting ATPase OS=Rodentolepis nana O... [more]
H2KSK60.000e+080.10Calcium-transporting ATPase OS=Clonorchis sinensis... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp2a10.000e+070.77sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
atp2a30.000e+071.12sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
atp2a10.000e+071.10sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
atp2a30.000e+072.11sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
ENSAMXT00000046993.10.000e+072.96sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010373.10.000e+072.78pep scaffold:Pmarinus_7.0:GL481096:3909:20014:1 ge... [more]
atp2c11.897e-6630.63ATPase secretory pathway Ca2+ transporting 1 [Sour... [more]
atp2c14.122e-6130.11ATPase secretory pathway Ca2+ transporting 1 [Sour... [more]
ENSPMAT00000002888.17.592e-5236.01pep scaffold:Pmarinus_7.0:GL478641:194938:205936:1... [more]
ENSPMAT00000009058.11.195e-4428.87pep scaffold:Pmarinus_7.0:GL480374:1:11062:-1 gene... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PMR17.149e-12730.75High affinity Ca2+/Mn2+ P-type ATPase; required fo... [more]
ENA21.230e-9430.27P-type ATPase sodium pump; involved in Na+ efflux ... [more]
ENA51.802e-9430.27Protein with similarity to P-type ATPase sodium pu... [more]
ENA12.288e-9330.27P-type ATPase sodium pump; involved in Na+ and Li+... [more]
PMC11.649e-4633.52Vacuolar Ca2+ ATPase involved in depleting cytosol... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO474650.000e+070.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356161.466e-15433.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406802.055e-10431.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO364554.621e-10228.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO417754.034e-7726.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp2a10.000e+071.86ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
atp2a1l0.000e+072.29sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
atp2a1l0.000e+072.53sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
ENSORLT00000013512.20.000e+072.45sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
ENSORLT00000013513.20.000e+072.45sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000050554.10.000e+0100.00SMESG000050554.1[more]
SMESG000050554.10.000e+098.89SMESG000050554.1[more]
SMESG000050554.10.000e+098.79SMESG000050554.1[more]
SMESG000039058.10.000e+075.03SMESG000039058.1[more]
SMESG000039058.10.000e+075.13SMESG000039058.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30036005 ID=SMED30036005|Name=Calcium-transporting ATPase|organism=Schmidtea mediterranea sexual|type=transcript|length=3457bp
AAGCACGCCAACAAGATAGAGAGAAATAGAAGCATCAAATGTACAATTTC
ACATCCATACAAGTAGTAGCTGTTGGTGAATATGGCTTCAGGTAGTAAGC
TACGGACGAATAAAACAACGCAATATACCAACTGGGCAACAGACTGATTT
CTTCTTTTTCTTTTTTTTGATTTATTCTATTCCACACCATAGATAGAGAT
AATAAAATCCATTCGATTTGGTTGGATTTTGTGGCATTCTTCTTCTGCCT
CGCATTTTCTCGATATTGTCTATTAGAAAGAAATTGTCGTTGAAATATCT
GAAAGTTGATCAAAGTTGTAACAGCTGTTGATTGTTTCGAAATTATGGAG
AACTCTCACGTGAAAACCGTTGACGAAGTGCTCAATTATTTCAATGTCGA
TGAAGAGGTAGGTTTGAGTGATGAACAAGTTAAAAGACAGGTTGAAAGAT
TCGGTTTTAATGAAATGCCAGCAGAGGAGACAAAAGCCTTGTGGCAGTTG
ATTTTGGAACAATTCGATGATTTATTAGTGAAAATCTTACTGCTTGCCGC
GATCATTTCCTTTGTGTTGGCATTATTTGAAGAGCATGAAGACTCGATCA
CAGCGTTTGTAGAACCATTCGTCATCATGCTCATTTTAATTGCTAACGCT
ATTGTCGGTGTATGGCAAGAACGAAATGCCGAATCGGCAATTGAGGCATT
GAAAGAATATGAGCCTGAAATAGCAAAAGTCTATAGAAAGAATGCAAAAG
GAGTTCAAAAAATTAAAGCCAGAGAACTAGTACCAGGAGATATTTGCGAT
ATTGCAGTCGGAGACAAAGTTCCAGCTGACATAAGAATCACCAAGATTTT
CAGTACAACAATTAGAATTGATCAATCAATTTTGACTGGTGAATCGGTCT
CGGTTATCAAACACTCAGACGCCATTCCAGATCCTCGAGCTGTAAATCAA
GACAAAAAGAATTTGTTATTTAGCGGAACAAATGTCGCGTCCGGAAAATG
TAGAGGCGTTGTTATAGGCACTGGATTGGACACTGAAATCGGAAAAATCA
GAAATCAAATGATGGAAACTGAACAAGAAAGAACACCTTTGCAGCAAAAA
CTGGATGAATTTGGACAGCAATTATCAAAGGTCATTACGATCATTTGTAT
CGCTGTTTGGGCAATTAATATCGGTCATTTTAATGATCCTGCTCACGGTG
GTTCATGGGTTCGAGGGGCAATCTATTATTTTAAAATTGCTGTTGCTCTT
GCTGTCGCTGCTATTCCAGAAGGGTTACCGGCTGTTATTACGACTTGTTT
GGCTTTAGGCACTCGCAGAATGGCAAAGAAAAACGCAATTGTCCGATCTC
TGCCTAGTGTTGAAACCCTGGGATGTACAAGTGTAATTTGTTCTGACAAA
ACGGGCACATTGACGACAAACCAAATGAGCGTCGCCAGAATGTTTGTGTT
TTCCAACATAACTGAAACCGAAATTTCCACTCATCAATTTGAAATTACCG
GTTCGAAATATGCGCCCGAAGGAGAAGTATTTCTCAACGGGCAAAAGGTA
AGAACTGGAGACTATGAAACACTTCTAGAGATTGCCAATATTTGTGCCAT
GTGCAACGATTCTTCCATAGACTACAATGAAACAAAAAGTGCGTATGAAA
AAGTCGGCGAAGCAACGGAGACAGCATTGACCTGTTTAGTTGAAAAAATG
AATGTCCATAATTTAAGCAAAGCTGGACTGACTAAAAAGCAATTGGGAAT
GGCCTGTAATCATCACATTCAAGGATTTTGGAAGAAAGAATTCACATTGG
AGTTTTCTCGTGATAGAAAATCAATGAGTTGCTATGTAAATCCTGCAAAA
GAAGGATCACCAAAAATGTTTTGCAAAGGAGCACCAGAAGGAATCTTAGA
CAGATGTGCTTTTGTTCGAGTGGGATCCAAAAAAATACCGATGACCGCTG
CAATCAAATCAGAGATTATGAGAATAACCGGAGAATATGGAACTGGAAGA
GACACGTTGAGATGTCTTGCATTAGCAACTCTAGATAATCCTTTCAAAAA
AGAACAAATGAATTTGGAGGATTCAAATCAATTCTATAAGTATGAGACAA
ATATGACTTTTGTCGGAGTTGTCGGAATGCTTGATCCACCGAGAACCGAA
GTATTTGATAGCATTGTAAAATGTAGAATGGCAGGCATTCGAGTCATCGT
TATTACCGGTGACAATAAGGCAACAGCTGAAGCCATTTGTCGAAGAATTG
GAGTATTTTCTGAAAACGAAACCACATTTGGAAAATCATACACAGGAAGA
GAATTCGACGATTTATCTGAAGAAATGAAGAAAGAAGCTGTTAGAAGAGC
GAAATTGTTTGCTCGAGTTGAGCCTGCTCATAAAAGCAAAATTGTTGAAT
ATTTACAAATGGACGGCGAAGTGTCAGCAATGACTGGTGATGGAGTCAAC
GATGCACCGGCTTTAAAGAAAGCTGAAATAGGAATTGCTATGGGAAGTGG
TACTGCAGTTGCAAAGAGTGCTTCAGAAATGGTCTTAGCTGATGATAATT
TCAGTACAATTGTTGCTGCCGTTGAAGAAGGAAGAGCAATATATAATAAC
ATGAAACAATTTATTAGATATCTGATTTCCTCTAATGTTGGAGAAGTCGT
CAGTATTTTCCTCACTGCAGCATTGGGAATGCCAGAAGCTTTGATTCCAG
TTCAACTACTTTGGGTTAATTTAGTCACTGATGGATTACCAGCAACAGCT
CTAGGATTTAATCCTCCGGACTTAGACATAATGTCAAAACCACCAAGATC
AACAAGAGAGCCTTTAATTACCGGGTGGTTATTCTTTCGATATATGGCCG
TCGGTACATATGTTGGAGCTGCAACCGTTGGCGCCGCAGCTTGGTGGTTT
ACTATCTACCCAAAAGGCCCCCAGTTGAATTACTATCAATTGACTCATCA
GGCCCAATGCCTGGCCCAAGAATCTCGATTTGAGGGAGTTGACTGTTCGA
TTTTCATCCACCCCAAGCCAATGACGATGGCCCTCAGTGTTCTAGTATTA
ATAGAAATGCTAAATGCAATGAACAGTTTGTCAGAAAATCAGTCATTGCT
AAAAATGCCACCATGGGTTAATTTGTGGCTGGTGGGATCCATGGTCCTCA
GTATGTCACTCCATTTTCTTATTTTGGAAGTTGACTTTTTATCGAAAGTA
TTTCAAATAACTCCATTGAGTGTGGAAGAATGGTTTGCAGTGGTAAAGAT
ATCCTTTCCAGTCATTCTCCTTGATGAAGTCTTGAAGCTGATAGCCCGGA
AATTTACTGATGGTAAAAATAAGCATGTTCATTATACTGACTTGAAACAA
ATGGTCGCCATATGGGTTGCTTTTGCATGTTTGGCGGCATTTTTATGAAC
ATAAATTAGGATTTATGAATTTTCCCAATTTTTCATTACCTTATCTGTGA
TAGCCAG
back to top

protein sequence of SMED30036005-orf-1

>SMED30036005-orf-1 ID=SMED30036005-orf-1|Name=SMED30036005-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1018bp
MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALW
QLILEQFDDLLVKILLLAAIISFVLALFEEHEDSITAFVEPFVIMLILIA
NAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDI
CDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAV
NQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQ
QKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAV
ALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICS
DKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQ
KVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVE
KMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNP
AKEGSPKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGT
GRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPR
TEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYT
GREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDG
VNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIY
NNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPA
TALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMAVGTYVGAATVGAAAW
WFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVL
VLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLS
KVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTDGKNKHVHYTDL
KQMVAIWVAFACLAAFL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000074oocyte
PLANA:0000101muscle cell
PLANA:0000231vitelline gland
PLANA:0000420parapharyngeal region
PLANA:0000428musculature system
Vocabulary: INTERPRO
TermDefinition
IPR005782P-type_ATPase_IIA
IPR030332SERCA1/2
IPR036412HAD-like_sf
IPR001757P_typ_ATPase
IPR004014ATPase_P-typ_cation-transptr_N
IPR008250ATPase_P-typ_transduc_dom_A_sf
IPR023299ATPase_P-typ_cyto_dom_N
IPR023298ATPase_P-typ_TM_dom_sf
IPR006068ATPase_P-typ_cation-transptr_C
IPR023214HAD_sf
IPR018303ATPase_P-typ_P_site
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005783endoplasmic reticulum
GO:0016020membrane
GO:0033017sarcoplasmic reticulum membrane
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0000166nucleotide binding
GO:0005388calcium-transporting ATPase activity
GO:0005524ATP binding
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
GO:0006816calcium ion transport
GO:0070588calcium ion transmembrane transport
GO:0099132ATP hydrolysis coupled cation transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001757P-type ATPasePRINTSPR00120HATPASEcoord: 728..753
score: 34.9
coord: 669..685
score: 51.76
coord: 697..713
score: 89.12
IPR001757P-type ATPaseTIGRFAMTIGR01494TIGR01494coord: 223..372
e-value: 2.0E-28
score: 97.0
coord: 665..782
e-value: 1.0E-34
score: 117.7
NoneNo IPR availablePRINTSPR00119CATATPASEcoord: 349..363
score: 78.89
coord: 176..190
score: 61.14
coord: 591..602
score: 54.76
coord: 613..623
score: 66.86
coord: 697..716
score: 83.2
coord: 720..732
score: 52.64
NoneNo IPR availableGENE3DG3DSA:2.70.150.10coord: 1..64
e-value: 1.9E-10
score: 42.7
NoneNo IPR availablePFAMPF13246Cation_ATPasecoord: 418..523
e-value: 1.3E-20
score: 73.3
NoneNo IPR availablePFAMPF00122E1-E2_ATPasecoord: 123..329
e-value: 1.3E-53
score: 181.2
NoneNo IPR availableGENE3DG3DSA:2.70.150.10coord: 98..242
e-value: 1.9E-53
score: 182.6
NoneNo IPR availablePFAMPF08282Hydrolase_3coord: 682..739
e-value: 3.1E-6
score: 27.1
NoneNo IPR availableGENE3DG3DSA:1.20.1110.10coord: 243..985
e-value: 0.0
score: 1251.2
NoneNo IPR availableSFLDSFLDG00002C1.7:_P-type_atpase_likecoord: 330..749
e-value: 0.0
score: 248.5
NoneNo IPR availableSFLDSFLDF00027p-type_atpasecoord: 330..749
e-value: 0.0
score: 248.5
NoneNo IPR availablePANTHERPTHR42861FAMILY NOT NAMEDcoord: 1..995
NoneNo IPR availableCDDcd02083P-type_ATPase_SERCAcoord: 5..985
e-value: 0.0
score: 1914.73
NoneNo IPR availableTMHMMTMhelixcoord: 925..944
NoneNo IPR availableTMHMMTMhelixcoord: 756..778
NoneNo IPR availableTMHMMTMhelixcoord: 60..78
NoneNo IPR availableTMHMMTMhelixcoord: 260..279
NoneNo IPR availableTMHMMTMhelixcoord: 833..855
NoneNo IPR availableTMHMMTMhelixcoord: 88..107
NoneNo IPR availableTMHMMTMhelixcoord: 299..321
IPR004014Cation-transporting P-type ATPase, N-terminalSMARTSM00831Cation_ATPase_N_a_2coord: 3..77
e-value: 7.2E-18
score: 75.4
IPR004014Cation-transporting P-type ATPase, N-terminalPFAMPF00690Cation_ATPase_Ncoord: 5..72
e-value: 1.5E-16
score: 59.8
IPR023214HAD superfamilyGENE3DG3DSA:3.40.50.1000coord: 331..735
e-value: 0.0
score: 1251.2
IPR006068Cation-transporting P-type ATPase, C-terminalPFAMPF00689Cation_ATPase_Ccoord: 780..983
e-value: 1.7E-43
score: 148.4
IPR023299P-type ATPase, cytoplasmic domain NGENE3DG3DSA:3.40.1110.10coord: 359..599
e-value: 0.0
score: 1251.2
IPR023299P-type ATPase, cytoplasmic domain NSUPERFAMILYSSF81660Metal cation-transporting ATPase, ATP-binding domain Ncoord: 356..595
IPR005782P-type ATPase, subfamily IIA, SERCA-typeTIGRFAMTIGR01116TIGR01116coord: 53..851
e-value: 0.0
score: 1039.1
IPR030332Sarcoplasmic/endoplasmic reticulum calcium ATPase 1/2PANTHERPTHR42861:SF18SARCOPLASMIC/ENDOPLASMIC RETICULUM CALCIUM ATPASE 2coord: 1..995
IPR018303P-type ATPase, phosphorylation sitePROSITEPS00154ATPASE_E1_E2coord: 351..357
IPR036412HAD-like superfamilySUPERFAMILYSSF56784HAD-likecoord: 583..745
IPR023298P-type ATPase, transmembrane domain superfamilySUPERFAMILYSSF81665Calcium ATPase, transmembrane domain Mcoord: 2..988
IPR008250P-type ATPase, A domain superfamilySUPERFAMILYSSF81653Calcium ATPase, transduction domain Acoord: 127..237