Mitochondrial 39S ribosomal protein L27 L27mt

Overview
NameMitochondrial 39S ribosomal protein L27 L27mt
Smed IDSMED30035984
Length (bp)500
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Mitochondrial 39S ribosomal protein L27 L27mt (SMED30035984) t-SNE clustered cells

Violin plots show distribution of expression levels for Mitochondrial 39S ribosomal protein L27 L27mt (SMED30035984) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Mitochondrial 39S ribosomal protein L27 L27mt (SMED30035984) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Mitochondrial 39S ribosomal protein L27 L27mt (SMED30035984) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035984

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30035984h1SMcG0007472 dd_Smed_v4_1828_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30035984h1SMcG0007472 dd_Smed_v4_1828_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035984h1SMcG0007472 dd_Smed_v4_1828_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035984h1SMcG0007472 dd_Smed_v4_1828_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30035984h1SMcG0007472 dd_Smed_v4_1828_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035984h1SMcG0007472 dd_Smed_v4_1828_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035984h1SMcG0007472 dd_Smed_v4_1828_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Mitochondrial 39S ribosomal protein L27 L27mt vs. Ensembl Human
Match: MRPL27 (mitochondrial ribosomal protein L27 [Source:HGNC Symbol;Acc:HGNC:14483])

HSP 1 Score: 46.9802 bits (110), Expect = 1.160e-6
Identity = 30/103 (29.13%), Postives = 51/103 (49.51%), Query Frame = 2
Query:  176 RGFQVNDGEYVYKNDILVIQAGMEVYPGKNVCIH----GSNWELRAITSGYAIITTETLNPYP-DSPIYDLVT---SGKIVKKPFIHVLEDHKDDYFRLKYLL 460
            +G +  +G YV+  +I+  Q     +PG +VC+     G N  L A+  G    T E   P+P ++   DL+T    G ++ K F+HV+    +  F+L  +L
Sbjct:   34 QGIKKMEGHYVHAGNIIATQRHFRWHPGAHVCVLQVGVGKNKCLYALEEGIVRYTKEVYVPHPRNTEAVDLITRLPKGAVLYKTFVHVVPAKPEGTFKLVAML 136          
BLAST of Mitochondrial 39S ribosomal protein L27 L27mt vs. Ensembl Human
Match: MRPL27 (mitochondrial ribosomal protein L27 [Source:HGNC Symbol;Acc:HGNC:14483])

HSP 1 Score: 44.669 bits (104), Expect = 9.050e-6
Identity = 29/99 (29.29%), Postives = 50/99 (50.51%), Query Frame = 2
Query:  176 RGFQVNDGEYVYKNDILVIQAGMEVYPGKNVCIHGSNWELRAITSGYAIITTETLNPYP-DSPIYDLVT---SGKIVKKPFIHVLEDHKDDYFRLKYLL 460
            +G +  +G YV+  +I+  Q     +PG +V + G N  L A+  G    T E   P+P ++   DL+T    G ++ K F+HV+    +  F+L  +L
Sbjct:   51 QGIKKMEGHYVHAGNIIATQRHFRWHPGAHVGV-GKNKCLYALEEGIVRYTKEVYVPHPRNTEAVDLITRLPKGAVLYKTFVHVVPAKPEGTFKLVAML 148          
BLAST of Mitochondrial 39S ribosomal protein L27 L27mt vs. Ensembl Fly
Match: mRpL27 (gene:FBgn0053002 transcript:FBtr0345633)

HSP 1 Score: 46.9802 bits (110), Expect = 5.077e-7
Identity = 37/123 (30.08%), Postives = 54/123 (43.90%), Query Frame = 2
Query:   89 LYIPVRNRGVKKKLNPDNVKPKRIANSLIRGFQVNDGEYVYKNDILVIQAGMEVYPGKNVCIHGSNWELRAITSGYAIITTETLNPYPDSPIYDLVTSGKI---VKKPFIHVLEDHKDDYFRL 448
            L   VRN    KK        K  A    RG++V DG +V +  IL  Q     +PG NV   G N  L A+  G   +T E ++P  D        +G+    + K F +V+ +++   FRL
Sbjct:   15 LMTTVRN--ASKKTGGSTRNKKGHARPKHRGWRVQDGHHVSEGTILATQLTTRFHPGLNVGF-GRNGTLFAMEHGKVYVTCEAIDPNWDHTWIQRNYAGRQGQNIYKKFFNVVPENQHQRFRL 134          
BLAST of Mitochondrial 39S ribosomal protein L27 L27mt vs. Ensembl Fly
Match: mRpL27 (gene:FBgn0053002 transcript:FBtr0077451)

HSP 1 Score: 46.9802 bits (110), Expect = 5.077e-7
Identity = 37/123 (30.08%), Postives = 54/123 (43.90%), Query Frame = 2
Query:   89 LYIPVRNRGVKKKLNPDNVKPKRIANSLIRGFQVNDGEYVYKNDILVIQAGMEVYPGKNVCIHGSNWELRAITSGYAIITTETLNPYPDSPIYDLVTSGKI---VKKPFIHVLEDHKDDYFRL 448
            L   VRN    KK        K  A    RG++V DG +V +  IL  Q     +PG NV   G N  L A+  G   +T E ++P  D        +G+    + K F +V+ +++   FRL
Sbjct:   15 LMTTVRN--ASKKTGGSTRNKKGHARPKHRGWRVQDGHHVSEGTILATQLTTRFHPGLNVGF-GRNGTLFAMEHGKVYVTCEAIDPNWDHTWIQRNYAGRQGQNIYKKFFNVVPENQHQRFRL 134          
BLAST of Mitochondrial 39S ribosomal protein L27 L27mt vs. Ensembl Fly
Match: mRpL27 (gene:FBgn0053002 transcript:FBtr0335135)

HSP 1 Score: 46.9802 bits (110), Expect = 5.077e-7
Identity = 37/123 (30.08%), Postives = 54/123 (43.90%), Query Frame = 2
Query:   89 LYIPVRNRGVKKKLNPDNVKPKRIANSLIRGFQVNDGEYVYKNDILVIQAGMEVYPGKNVCIHGSNWELRAITSGYAIITTETLNPYPDSPIYDLVTSGKI---VKKPFIHVLEDHKDDYFRL 448
            L   VRN    KK        K  A    RG++V DG +V +  IL  Q     +PG NV   G N  L A+  G   +T E ++P  D        +G+    + K F +V+ +++   FRL
Sbjct:   15 LMTTVRN--ASKKTGGSTRNKKGHARPKHRGWRVQDGHHVSEGTILATQLTTRFHPGLNVGF-GRNGTLFAMEHGKVYVTCEAIDPNWDHTWIQRNYAGRQGQNIYKKFFNVVPENQHQRFRL 134          
BLAST of Mitochondrial 39S ribosomal protein L27 L27mt vs. TrEMBL
Match: A0A504YS14 (Mitochondrial 39S ribosomal protein L27 L27mt OS=Fasciola gigantica OX=46835 GN=FGIG_04593 PE=4 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 9.627e-33
Identity = 62/147 (42.18%), Postives = 93/147 (63.27%), Query Frame = 2
Query:   32 SFMSLISKFNFITKNLNAVLYIPVRNRGVKKKLN----PDNVKPKRIANSLIRGFQVNDGEYVYKNDILVIQAGMEVYPGKNVCIHGSNWELRAITSGYAIITTETLNPYPDSPIYDLVTSGKIVKKPFIHVLEDHKDDYFRLKYLL 460
             F +  +    I++    +L  P R  GVKKK N    P  VKP  +  +L RGFQ NDG++VYK DILV Q G+E+YPG++V +    W+L A+ +G   I+TETL+P+PDSP+Y+ V  G+ + +PF+HV+ +  +  +RLK +L
Sbjct:    8 GFRAFFTNLGGISRPNTVILDPPRRCAGVKKKFNLEDNPKKVKPSVLVKTL-RGFQFNDGDFVYKGDILVRQIGLEIYPGESVKLDRETWDLIAMCNGRFTISTETLSPFPDSPLYEAVHRGEQIVRPFVHVISEPIEPVYRLKRML 153          
BLAST of Mitochondrial 39S ribosomal protein L27 L27mt vs. TrEMBL
Match: A0A183AZI5 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS12370 PE=4 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 4.114e-32
Identity = 63/132 (47.73%), Postives = 89/132 (67.42%), Query Frame = 2
Query:   80 NAV-LYIPVRNRGVKKKL----NPDNVKPKRIANSLIRGFQVNDGEYVYKNDILVIQAGMEVYPGKNVCIHGSNWELRAITSGYAIITTETLNPYPDSPIYDLVTSGKIVKKPFIHVLEDHKDDYFRLKYLL 460
            NAV L  P R  G+KKK     NP  VKP  +  +L RGFQ NDG+YVY+ DILV Q G+E+YPG++V ++   W+L A+ +G   I+TETL+P+PDSP+Y  V  G+ + +PF+HV+ D  +  +RLK +L
Sbjct:   24 NAVSLNAPCRFAGIKKKYDLEDNPKKVKPAVLVKTL-RGFQFNDGDYVYEGDILVRQLGLEIYPGESVKLNRDTWDLIAMCNGRFTISTETLSPFPDSPLYSAVQRGEQIVRPFVHVISDPPEPIYRLKRML 154          
BLAST of Mitochondrial 39S ribosomal protein L27 L27mt vs. TrEMBL
Match: A0A4S2M1R9 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003434 PE=4 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 5.246e-32
Identity = 62/133 (46.62%), Postives = 88/133 (66.17%), Query Frame = 2
Query:   77 LNAVLYIPVRNRGVKKKLN----PDNVKPKRIANSLIRGFQVNDGEYVYKNDILVIQAGMEVYPGKNVCIHGSNWELRAITSGYAIITTETLNPYPDSPIYDLV-TSGKIVKKPFIHVLEDHKDDYFRLKYLL 460
            L+A    PVRN GVKKK N    P  ++P     +L RGFQ NDG+YVYK DI+V Q G+++YPG++V ++   W+L A+ +G   I+TE L+P+PDSP+Y LV   G  + KPF+HV+ED  +  + LK +L
Sbjct:   16 LSASFVQPVRNAGVKKKKNHTDQPAKIRPSVQVKTL-RGFQFNDGDYVYKGDIVVRQLGLDIYPGESVKLNPETWDLVALCNGRFTISTEILSPFPDSPLYSLVHQKGHTISKPFVHVIEDRMEPVYTLKRML 147          
BLAST of Mitochondrial 39S ribosomal protein L27 L27mt vs. TrEMBL
Match: A0A430QRS2 (Large subunit ribosomal protein L27 OS=Schistosoma bovis OX=6184 GN=DC041_0012358 PE=4 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 1.190e-31
Identity = 60/125 (48.00%), Postives = 84/125 (67.20%), Query Frame = 2
Query:   98 PVRNRGVKKKLN----PDNVKPKRIANSLIRGFQVNDGEYVYKNDILVIQAGMEVYPGKNVCIHGSNWELRAITSGYAIITTETLNPYPDSPIYDLVTSGKIVKKPFIHVLEDHKDDYFRLKYLL 460
            P R  GVKKK N    P   +P  +  +L RGFQ NDG+YVYK DILV Q GME+YPG++V +    W L A+++G   I+TE L+P+PDSP+YD V  G+++ KPF+HV+ D  +  ++LK +L
Sbjct:   20 PFRCAGVKKKKNYAETPSRYRPSVLVKTL-RGFQFNDGDYVYKGDILVRQLGMEIYPGESVKLDPETWNLVALSNGRFTISTEKLSPFPDSPLYDKVKDGEVIYKPFVHVIGDSIEPLYKLKRIL 143          
BLAST of Mitochondrial 39S ribosomal protein L27 L27mt vs. TrEMBL
Match: A0A094ZY14 (Uncharacterized protein OS=Schistosoma haematobium OX=6185 GN=MS3_06449 PE=4 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 9.587e-31
Identity = 58/125 (46.40%), Postives = 84/125 (67.20%), Query Frame = 2
Query:   98 PVRNRGVKKKLN----PDNVKPKRIANSLIRGFQVNDGEYVYKNDILVIQAGMEVYPGKNVCIHGSNWELRAITSGYAIITTETLNPYPDSPIYDLVTSGKIVKKPFIHVLEDHKDDYFRLKYLL 460
            P R  GVKKK N    P   +P  +  + +RGFQ NDG++VYK DILV Q GME+YPG++V +    W L A+++G   I+TE L+P+PDSP+YD V  G+++ KPF+HV+ D  +  ++LK +L
Sbjct:   20 PFRCAGVKKKKNYAETPSRYRPSVLVKT-VRGFQFNDGDFVYKGDILVRQLGMEIYPGESVKLDPETWNLVALSNGRFTISTEKLSPFPDSPLYDKVKDGEVIYKPFVHVIGDPIEPLYKLKRIL 143          
BLAST of Mitochondrial 39S ribosomal protein L27 L27mt vs. Ensembl Nematostella
Match: EDO35492 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLC3])

HSP 1 Score: 47.3654 bits (111), Expect = 2.034e-7
Identity = 29/81 (35.80%), Postives = 43/81 (53.09%), Query Frame = 2
Query:  179 GFQVNDGEYVYKNDILVIQAGMEVYPGKNVCIHGSNWELRAITSGYAIITTETLNPYPDSPIYDLVTSGKIVKKPFIHVLE 421
            G +  +GE V    ILV Q G + +PG NV + G +  L A++ G      E L+PYP    + L   G + ++ F+HVLE
Sbjct:   53 GIKRREGEDVIPGTILVRQRGYKYHPGVNVGV-GRDHTLFALSEGMVQFKRELLDPYP----WGLGRKGPLHERKFVHVLE 128          
BLAST of Mitochondrial 39S ribosomal protein L27 L27mt vs. Ensembl Medaka
Match: mrpl27 (mitochondrial ribosomal protein L27 [Source:NCBI gene;Acc:101159300])

HSP 1 Score: 51.2174 bits (121), Expect = 1.825e-8
Identity = 31/94 (32.98%), Postives = 49/94 (52.13%), Query Frame = 2
Query:  179 GFQVNDGEYVYKNDILVIQAGMEVYPGKNVCIHGSNWELRAITSGYAIITTETLNPYPDSP----IYDLVTSGKIVKKPFIHVLEDHKDDYFRL 448
            GF+  DG +V+  +IL  Q  +  +PG +V + G+N  L A+  G+   T E   P P SP    I   +  G ++ K FI+V+   ++  FRL
Sbjct:   51 GFKKQDGNFVHAGNILATQRQLRFHPGAHVGM-GTNNTLFALEDGHVRFTKEVYIPPPRSPEASAIIPKLPKGAVLYKTFINVMPVQQEAKFRL 143          
BLAST of Mitochondrial 39S ribosomal protein L27 L27mt vs. Planmine SMEST
Match: SMESG000071293.1 (SMESG000071293.1)

HSP 1 Score: 286.96 bits (733), Expect = 4.727e-101
Identity = 140/142 (98.59%), Postives = 141/142 (99.30%), Query Frame = 2
Query:   38 MSLISKFNFITKNLNAVLYIPVRNRGVKKKLNPDNVKPKRIANSLIRGFQVNDGEYVYKNDILVIQAGMEVYPGKNVCIHGSNWELRAITSGYAIITTETLNPYPDSPIYDLVTSGKIVKKPFIHVLEDHKDDYFRLKYLLK 463
            MSLISKFNFITKNLNAVLYIPVRNRGVKKKLNPDNVKPK IANSLIRGFQVNDGEYVYKNDILVIQAGMEVYPGKNVCIHGSNWELRA+TSGYAIITTETLNPYPDSPIYDLVTSGKIVKKPFIHVLEDHKDDYFRLKYLLK
Sbjct:    1 MSLISKFNFITKNLNAVLYIPVRNRGVKKKLNPDNVKPKTIANSLIRGFQVNDGEYVYKNDILVIQAGMEVYPGKNVCIHGSNWELRALTSGYAIITTETLNPYPDSPIYDLVTSGKIVKKPFIHVLEDHKDDYFRLKYLLK 142          
The following BLAST results are available for this feature:
BLAST of Mitochondrial 39S ribosomal protein L27 L27mt vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
MRPL271.160e-629.13mitochondrial ribosomal protein L27 [Source:HGNC S... [more]
MRPL279.050e-629.29mitochondrial ribosomal protein L27 [Source:HGNC S... [more]
back to top
BLAST of Mitochondrial 39S ribosomal protein L27 L27mt vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mitochondrial 39S ribosomal protein L27 L27mt vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
mRpL275.077e-730.08gene:FBgn0053002 transcript:FBtr0345633[more]
mRpL275.077e-730.08gene:FBgn0053002 transcript:FBtr0077451[more]
mRpL275.077e-730.08gene:FBgn0053002 transcript:FBtr0335135[more]
back to top
BLAST of Mitochondrial 39S ribosomal protein L27 L27mt vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mitochondrial 39S ribosomal protein L27 L27mt vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mitochondrial 39S ribosomal protein L27 L27mt vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mitochondrial 39S ribosomal protein L27 L27mt vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mitochondrial 39S ribosomal protein L27 L27mt vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YS149.627e-3342.18Mitochondrial 39S ribosomal protein L27 L27mt OS=F... [more]
A0A183AZI54.114e-3247.73Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A4S2M1R95.246e-3246.62Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A430QRS21.190e-3148.00Large subunit ribosomal protein L27 OS=Schistosoma... [more]
A0A094ZY149.587e-3146.40Uncharacterized protein OS=Schistosoma haematobium... [more]
back to top
BLAST of Mitochondrial 39S ribosomal protein L27 L27mt vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mitochondrial 39S ribosomal protein L27 L27mt vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mitochondrial 39S ribosomal protein L27 L27mt vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mitochondrial 39S ribosomal protein L27 L27mt vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO354922.034e-735.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Mitochondrial 39S ribosomal protein L27 L27mt vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrpl271.825e-832.98mitochondrial ribosomal protein L27 [Source:NCBI g... [more]
back to top
BLAST of Mitochondrial 39S ribosomal protein L27 L27mt vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000071293.14.727e-10198.59SMESG000071293.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035984 ID=SMED30035984|Name=Mitochondrial 39S ribosomal protein L27 L27mt|organism=Schmidtea mediterranea sexual|type=transcript|length=500bp
ATTTTGTTTGTCTTACATAATTCAAAATTAAAGTTTCATGTCTTTAATTA
GCAAATTCAATTTTATTACTAAAAATTTAAATGCTGTTTTGTATATTCCC
GTGAGAAATAGAGGAGTTAAAAAGAAACTAAATCCTGATAATGTCAAACC
AAAAAGAATTGCTAATTCACTTATACGCGGATTTCAAGTTAATGATGGTG
AATATGTTTATAAAAATGATATATTAGTCATTCAGGCTGGTATGGAAGTA
TATCCTGGGAAAAATGTATGTATTCACGGAAGTAATTGGGAATTACGAGC
AATAACAAGTGGATATGCAATTATAACGACGGAAACACTAAATCCATATC
CGGATAGTCCAATTTACGATTTAGTTACCAGCGGTAAAATAGTTAAAAAA
CCATTTATACATGTTTTGGAAGATCATAAAGACGATTATTTTAGATTAAA
ATATTTGTTAAAATAAATCGTTTCTTCCATTGTAAATTATAGATAATCTG
back to top

protein sequence of SMED30035984-orf-1

>SMED30035984-orf-1 ID=SMED30035984-orf-1|Name=SMED30035984-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=143bp
MSLISKFNFITKNLNAVLYIPVRNRGVKKKLNPDNVKPKRIANSLIRGFQ
VNDGEYVYKNDILVIQAGMEVYPGKNVCIHGSNWELRAITSGYAIITTET
LNPYPDSPIYDLVTSGKIVKKPFIHVLEDHKDDYFRLKYLLK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000429neoblast
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR001684Ribosomal_L27
Vocabulary: cellular component
TermDefinition
GO:0005840ribosome
GO:0005622intracellular
Vocabulary: molecular function
TermDefinition
GO:0003735structural constituent of ribosome
Vocabulary: biological process
TermDefinition
GO:0006412translation