Homeobox domain-containing protein

Overview
NameHomeobox domain-containing protein
Smed IDSMED30035975
Length (bp)934
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Homeobox domain-containing protein (SMED30035975) t-SNE clustered cells

Violin plots show distribution of expression levels for Homeobox domain-containing protein (SMED30035975) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035975

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30035975h1SMcG0002721 dd_Smed_v4_44424_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035975h1SMcG0002721 dd_Smed_v4_44424_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035975h1SMcG0002721 dd_Smed_v4_44424_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30035975h1SMcG0002721 dd_Smed_v4_44424_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035975h1SMcG0002721 dd_Smed_v4_44424_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035975h1SMcG0002721 dd_Smed_v4_44424_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30035975h1SMcG0002721 dd_Smed_v6_44424_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: NKX6-2 (NK6 homeobox 2 [Source:HGNC Symbol;Acc:HGNC:19321])

HSP 1 Score: 73.9442 bits (180), Expect = 1.520e-14
Identity = 43/73 (58.90%), Postives = 53/73 (72.60%), Query Frame = 2
Query:  428 KQDKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQENITTVLAQQ 646
            K  KKK SR TFSG+QI  LEK FE  KYL+  ERA LA SL +TE+QVK+WFQNRRTKW+K+  +    A++
Sbjct:  144 KDGKKKHSRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKRHAVEMASAKK 216          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: NKX6-1 (NK6 homeobox 1 [Source:HGNC Symbol;Acc:HGNC:7839])

HSP 1 Score: 74.3294 bits (181), Expect = 2.525e-14
Identity = 45/96 (46.88%), Postives = 61/96 (63.54%), Query Frame = 2
Query:  362 ITSPPLNNINVYC-EKKKRVRNSKQDKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQENITTVLAQQ 646
            + SPP  +  + C   +  +   K  K+K +R TFSG+QI  LEK FE  KYL+  ERA LA SL +TE+QVK+WFQNRRTKW+K+       A++
Sbjct:  209 MQSPPWRDARLACTPHQGSILLDKDGKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKHAAEMATAKK 304          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: NKX6-3 (NK6 homeobox 3 [Source:HGNC Symbol;Acc:HGNC:26328])

HSP 1 Score: 72.4034 bits (176), Expect = 4.471e-14
Identity = 59/152 (38.82%), Postives = 75/152 (49.34%), Query Frame = 2
Query:  248 DFCSRPVIS--DELLTSYGHANQLTTGTQTGDGENTNQNQITSPPLNNIN-VYCEKKKRVRNSKQD-----------------------KKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQENI 625
            D  SRPV +  + LL+ Y H          G G  ++Q    SP + N +    E   R RN   D                       KKK +R TF+G QI  LEK FE  KYL+  ERA LA SL +TE+QVK+WFQNRRTKW+K+  +
Sbjct:   57 DILSRPVAAPNNSLLSGYPHV--------AGFGGLSSQGVYYSPQVGNFSKAGNEYPTRTRNCWADTGQDWRGGRQCSNTPDPLSDSIHKKKHTRPTFTGHQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKSAL 200          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: TLX3 (T cell leukemia homeobox 3 [Source:HGNC Symbol;Acc:HGNC:13532])

HSP 1 Score: 70.8626 bits (172), Expect = 1.961e-13
Identity = 42/65 (64.62%), Postives = 51/65 (78.46%), Query Frame = 2
Query:  422 NSKQDKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQ 616
            N    K+KK RT+FS  QICELEK+F  +KYL+SAERA LA SL +T+ QVK WFQNRRTKW++Q
Sbjct:  160 NRTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQ 224          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: TLX1 (T cell leukemia homeobox 1 [Source:HGNC Symbol;Acc:HGNC:5056])

HSP 1 Score: 70.0922 bits (170), Expect = 4.749e-13
Identity = 41/65 (63.08%), Postives = 51/65 (78.46%), Query Frame = 2
Query:  422 NSKQDKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQ 616
            N    KKKK RT+F+  QICELEK+F  +KYL+SAERA LA +L +T+ QVK WFQNRRTKW++Q
Sbjct:  195 NRTPPKKKKPRTSFTRLQICELEKRFHRQKYLASAERAALAKALKMTDAQVKTWFQNRRTKWRRQ 259          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: ceh-9 (Homeobox protein ceh-9 [Source:UniProtKB/Swiss-Prot;Acc:P56407])

HSP 1 Score: 81.6481 bits (200), Expect = 7.495e-19
Identity = 49/73 (67.12%), Postives = 62/73 (84.93%), Query Frame = 2
Query:  404 KKKRVRNSKQDKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQEN 622
            K+  +   ++ K+KK+RTTFSG+Q+ ELEKQFE KKYLSS++R+ELA  L+VTETQVKIWFQNRRTKWKK E+
Sbjct:   58 KESPIEKCQKTKRKKARTTFSGKQVFELEKQFEAKKYLSSSDRSELAKRLDVTETQVKIWFQNRRTKWKKIES 130          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: cog-1 (COG-1B [Source:UniProtKB/TrEMBL;Acc:G5EGF2])

HSP 1 Score: 70.4774 bits (171), Expect = 3.682e-15
Identity = 41/75 (54.67%), Postives = 58/75 (77.33%), Query Frame = 2
Query:  422 NSKQDKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQENITTVLAQQ 646
            NS   +KK+SR TF+G QI +LE++FE  KYL+ A+RA+LA  LN++E+QVK+WFQNRRTKW+K+E     L ++
Sbjct:   13 NSLNMQKKQSRPTFTGHQIYQLERKFEQTKYLAGADRAQLAQELNMSESQVKVWFQNRRTKWRKKEAADNALVKR 87          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: cog-1 (COG-1B [Source:UniProtKB/TrEMBL;Acc:G5EGF2])

HSP 1 Score: 72.4034 bits (176), Expect = 1.597e-14
Identity = 41/75 (54.67%), Postives = 58/75 (77.33%), Query Frame = 2
Query:  422 NSKQDKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQENITTVLAQQ 646
            NS   +KK+SR TF+G QI +LE++FE  KYL+ A+RA+LA  LN++E+QVK+WFQNRRTKW+K+E     L ++
Sbjct:  163 NSLNMQKKQSRPTFTGHQIYQLERKFEQTKYLAGADRAQLAQELNMSESQVKVWFQNRRTKWRKKEAADNALVKR 237          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: mls-2 (Mesodermal Lineage Specification [Source:UniProtKB/TrEMBL;Acc:Q18533])

HSP 1 Score: 66.6254 bits (161), Expect = 3.033e-12
Identity = 39/65 (60.00%), Postives = 51/65 (78.46%), Query Frame = 2
Query:  422 NSKQDKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQ 616
            +  Q++KKK+RT FS  Q+ +LE  FE K+YLSS ER+ LA  L++TETQVKIWFQNRR K+K+Q
Sbjct:  195 DPSQNRKKKTRTVFSRSQVSQLEMMFECKRYLSSQERSNLAQKLHLTETQVKIWFQNRRNKFKRQ 259          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: ceh-19 (Homeobox protein ceh-19 [Source:UniProtKB/Swiss-Prot;Acc:P26797])

HSP 1 Score: 62.7734 bits (151), Expect = 1.625e-11
Identity = 39/91 (42.86%), Postives = 57/91 (62.64%), Query Frame = 2
Query:  356 NQITSPPLNNINVYCEKKKRVRNSKQDKK----KKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQ 616
            N + +P L  + +      R  + K+ +K    +K R  +S RQ+  LE +F+  KYLS  +R +L+ +LN+TETQ+K WFQNRRTKWKKQ
Sbjct:   62 NDLRTPTLVELQMLLGVSARKHDYKRSRKSVCERKPRQAYSARQLDRLETEFQTDKYLSVNKRIQLSQTLNLTETQIKTWFQNRRTKWKKQ 152          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: NK7.1 (gene:FBgn0024321 transcript:FBtr0306742)

HSP 1 Score: 89.7373 bits (221), Expect = 1.366e-19
Identity = 51/74 (68.92%), Postives = 61/74 (82.43%), Query Frame = 2
Query:  437 KKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQENITTVLAQQFRQS 658
            +KKK+RTTF+GRQI ELEK FE KKYLS++ER E+A  L VTETQVKIWFQNRRTKWKKQ+N+T   A + + S
Sbjct:  392 RKKKARTTFTGRQIFELEKMFENKKYLSASERTEMAKLLMVTETQVKIWFQNRRTKWKKQDNVTNNEAAEHKSS 465          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: NK7.1 (gene:FBgn0024321 transcript:FBtr0347151)

HSP 1 Score: 89.7373 bits (221), Expect = 1.366e-19
Identity = 51/74 (68.92%), Postives = 61/74 (82.43%), Query Frame = 2
Query:  437 KKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQENITTVLAQQFRQS 658
            +KKK+RTTF+GRQI ELEK FE KKYLS++ER E+A  L VTETQVKIWFQNRRTKWKKQ+N+T   A + + S
Sbjct:  392 RKKKARTTFTGRQIFELEKMFENKKYLSASERTEMAKLLMVTETQVKIWFQNRRTKWKKQDNVTNNEAAEHKSS 465          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: NK7.1 (gene:FBgn0024321 transcript:FBtr0082942)

HSP 1 Score: 89.7373 bits (221), Expect = 1.366e-19
Identity = 51/74 (68.92%), Postives = 61/74 (82.43%), Query Frame = 2
Query:  437 KKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQENITTVLAQQFRQS 658
            +KKK+RTTF+GRQI ELEK FE KKYLS++ER E+A  L VTETQVKIWFQNRRTKWKKQ+N+T   A + + S
Sbjct:  392 RKKKARTTFTGRQIFELEKMFENKKYLSASERTEMAKLLMVTETQVKIWFQNRRTKWKKQDNVTNNEAAEHKSS 465          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: NK7.1 (gene:FBgn0024321 transcript:FBtr0082941)

HSP 1 Score: 89.7373 bits (221), Expect = 1.366e-19
Identity = 51/74 (68.92%), Postives = 61/74 (82.43%), Query Frame = 2
Query:  437 KKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQENITTVLAQQFRQS 658
            +KKK+RTTF+GRQI ELEK FE KKYLS++ER E+A  L VTETQVKIWFQNRRTKWKKQ+N+T   A + + S
Sbjct:  392 RKKKARTTFTGRQIFELEKMFENKKYLSASERTEMAKLLMVTETQVKIWFQNRRTKWKKQDNVTNNEAAEHKSS 465          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: HGTX (gene:FBgn0040318 transcript:FBtr0075720)

HSP 1 Score: 73.559 bits (179), Expect = 3.470e-14
Identity = 42/88 (47.73%), Postives = 58/88 (65.91%), Query Frame = 2
Query:  383 NINVYCEKKKRVRNSKQDKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQENITTVLAQQ 646
            + N+    +    N K  KKK +R TFSG+QI  LEK FE  KYL+  ERA+LA +L ++E+QVK+WFQNRRTKW+K+       A++
Sbjct:  373 SANLSQSHQHHPSNDKDGKKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWRKRHAAEMATAKR 460          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: nkx6.2 (NK6 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-070626-1])

HSP 1 Score: 77.411 bits (189), Expect = 6.157e-16
Identity = 55/131 (41.98%), Postives = 72/131 (54.96%), Query Frame = 2
Query:  374 PLNNINVYCEKKKRVRNSKQDKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQENITTVLA--------QQFRQSIDNNRSIDLMSELESNGSENQYYDTKIT 742
            P  +  V C  +  +   K  KKK SR TFSG+QI  LEK FE  KYL+  ERA LA SL +TE+QVK+WFQNRRTKW+K+       A        ++ ++S DN+   +    L+ N       D KIT
Sbjct:  129 PWRDPRVPCAAQANMMLDKDGKKKHSRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKRHAAEMATAKKKHDSETEKMKESSDNDEDDEYNKPLDPNSD-----DEKIT 254          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: nkx6.3 (NK6 homeobox 3 [Source:ZFIN;Acc:ZDB-GENE-070810-7])

HSP 1 Score: 68.5514 bits (166), Expect = 5.433e-14
Identity = 51/108 (47.22%), Postives = 62/108 (57.41%), Query Frame = 2
Query:  437 KKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQENITTVLAQQFRQSIDNNRSIDLMSELESNGSENQYYDTKITNKITNP 760
            KKK +R TFSG QI  LEK FE  KYL+  ERA LA SL +TE+QVK+WFQNRRTKW+K+        Q  R             E   +GSEN+  D +  NK  +P
Sbjct:    4 KKKHTRPTFSGHQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKSATEPSSTQTSR------------GESAGDGSENEVEDEEY-NKPLDP 98          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: hmx3b (H6 family homeobox 3b [Source:ZFIN;Acc:ZDB-GENE-130603-102])

HSP 1 Score: 68.9366 bits (167), Expect = 1.605e-13
Identity = 45/73 (61.64%), Postives = 58/73 (79.45%), Query Frame = 2
Query:  398 CEKKKRVRNSKQDKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQ 616
            CE+  R +  K  +KKK+RT FS  Q+ +LE  F+LK+YLSS+ERA LA+SL++TETQVKIWFQNRR KWK+Q
Sbjct:   87 CEEA-RAQVKKLCRKKKTRTVFSRAQVFQLESTFDLKRYLSSSERAGLAASLHLTETQVKIWFQNRRNKWKRQ 158          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: tlx3b (T cell leukemia homeobox 3b [Source:ZFIN;Acc:ZDB-GENE-021021-1])

HSP 1 Score: 70.4774 bits (171), Expect = 1.806e-13
Identity = 41/65 (63.08%), Postives = 51/65 (78.46%), Query Frame = 2
Query:  422 NSKQDKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQ 616
            N    K+KK RT+FS  QICELEK+F  +KYL+SAERA LA +L +T+ QVK WFQNRRTKW++Q
Sbjct:  168 NRTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKTLKMTDAQVKTWFQNRRTKWRRQ 232          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: nkx6.3 (NK6 homeobox 3 [Source:ZFIN;Acc:ZDB-GENE-070810-7])

HSP 1 Score: 70.0922 bits (170), Expect = 1.879e-13
Identity = 51/108 (47.22%), Postives = 62/108 (57.41%), Query Frame = 2
Query:  437 KKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQENITTVLAQQFRQSIDNNRSIDLMSELESNGSENQYYDTKITNKITNP 760
            KKK +R TFSG QI  LEK FE  KYL+  ERA LA SL +TE+QVK+WFQNRRTKW+K+        Q  R             E   +GSEN+  D +  NK  +P
Sbjct:  150 KKKHTRPTFSGHQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKSATEPSSTQTSR------------GESAGDGSENEVEDEEY-NKPLDP 244          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: zfand1 (zinc finger AN1-type containing 1 [Source:Xenbase;Acc:XB-GENE-1217582])

HSP 1 Score: 74.3294 bits (181), Expect = 8.884e-15
Identity = 45/91 (49.45%), Postives = 58/91 (63.74%), Query Frame = 2
Query:  374 PLNNINVYCEKKKRVRNSKQDKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQENITTVLAQQ 646
            P  +  + C  +  +   K  KKK SR TFSG+QI  LEK FE  KYL+  ERA LA SL +TE+QVK+WFQNRRTKW+K+       A++
Sbjct:  132 PWRDPRLGCPSQAGMVLDKDGKKKHSRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKRHAAEMATAKK 222          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: meis1 (Meis homeobox 1 [Source:Xenbase;Acc:XB-GENE-479439])

HSP 1 Score: 73.9442 bits (180), Expect = 2.542e-14
Identity = 46/96 (47.92%), Postives = 61/96 (63.54%), Query Frame = 2
Query:  362 ITSPPLNNINVYC-EKKKRVRNSKQDKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQENITTVLAQQ 646
            + SPP  +  + C   +  V   K  K+K +R TFSG+QI  LEK FE  KYL+  ERA LA SL +TE+QVK+WFQNRRTKW+K+       A++
Sbjct:  194 MQSPPWRDARLACGPHQGSVLLDKDGKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKHAAEMATAKK 289          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: soga1 (suppressor of glucose, autophagy associated 1 [Source:Xenbase;Acc:XB-GENE-6049995])

HSP 1 Score: 70.8626 bits (172), Expect = 8.409e-14
Identity = 48/115 (41.74%), Postives = 71/115 (61.74%), Query Frame = 2
Query:  281 LLTSYGHANQLTTGTQTGDGENTNQNQITSPPLNNINVYCEKKK---RVRNSKQDKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQ 616
            ++ S+  A  +   T +   + TN N   +P       +C  ++     +N    K+KK RT+FS  QICELEK+F  +KYL+SAERA LA +L ++++QVK WFQNRRTKW++Q
Sbjct:   57 VVPSFPVAPAVPVSTCSFSYKGTNGNPTVTP-------FCATRRIGHPYQNRTPPKRKKPRTSFSRLQICELEKRFHRQKYLASAERASLAKALRMSDSQVKTWFQNRRTKWRRQ 164          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: jup (junction plakoglobin [Source:Xenbase;Acc:XB-GENE-489397])

HSP 1 Score: 70.4774 bits (171), Expect = 2.302e-13
Identity = 42/65 (64.62%), Postives = 51/65 (78.46%), Query Frame = 2
Query:  422 NSKQDKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQ 616
            N    K+KK RT+FS  QICELEK+F  +KYL+SAERA LA SL +T+ QVK WFQNRRTKW++Q
Sbjct:  161 NRTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQ 225          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000011915.1 (T cell leukemia homeobox 1 [Source:NCBI gene;Acc:100494864])

HSP 1 Score: 70.0922 bits (170), Expect = 4.124e-13
Identity = 41/66 (62.12%), Postives = 52/66 (78.79%), Query Frame = 2
Query:  419 RNSKQDKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQ 616
            +N    KKKK RT+F+  QICELEK+F  +KYL+SAERA LA +L +T+ QVK WFQNRRTKW++Q
Sbjct:  175 QNRTPPKKKKPRTSFTRLQICELEKRFHRQKYLASAERAALAKALKMTDAQVKTWFQNRRTKWRRQ 240          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Nkx6-1 (NK6 homeobox 1 [Source:MGI Symbol;Acc:MGI:1206039])

HSP 1 Score: 74.7146 bits (182), Expect = 1.233e-14
Identity = 45/96 (46.88%), Postives = 61/96 (63.54%), Query Frame = 2
Query:  362 ITSPPLNNINVYC-EKKKRVRNSKQDKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQENITTVLAQQ 646
            + SPP  +  + C   +  +   K  K+K +R TFSG+QI  LEK FE  KYL+  ERA LA SL +TE+QVK+WFQNRRTKW+K+       A++
Sbjct:  210 MQSPPWRDARLACTPHQGSILLDKDGKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKHAAEMATAKK 305          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Nkx6-2 (NK6 homeobox 2 [Source:MGI Symbol;Acc:MGI:1352738])

HSP 1 Score: 72.4034 bits (176), Expect = 3.891e-14
Identity = 43/73 (58.90%), Postives = 52/73 (71.23%), Query Frame = 2
Query:  428 KQDKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQENITTVLAQQ 646
            K  KKK SR TFSG+QI  LEK FE  KYL+  ERA LA SL +TE+QVK+WFQNRRTKW+K+       A++
Sbjct:  144 KDGKKKHSRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKRHAAEMASAKK 216          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Nkx6-2 (NK6 homeobox 2 [Source:MGI Symbol;Acc:MGI:1352738])

HSP 1 Score: 72.4034 bits (176), Expect = 3.891e-14
Identity = 43/73 (58.90%), Postives = 52/73 (71.23%), Query Frame = 2
Query:  428 KQDKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQENITTVLAQQ 646
            K  KKK SR TFSG+QI  LEK FE  KYL+  ERA LA SL +TE+QVK+WFQNRRTKW+K+       A++
Sbjct:  144 KDGKKKHSRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKRHAAEMASAKK 216          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Nkx1-1 (NK1 homeobox 1 [Source:MGI Symbol;Acc:MGI:109346])

HSP 1 Score: 72.7886 bits (177), Expect = 6.767e-14
Identity = 46/109 (42.20%), Postives = 62/109 (56.88%), Query Frame = 2
Query:  290 SYGHANQLTTGTQTGDGENTNQNQITSPPLNNINVYCEKKKRVRNSKQDKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQ 616
            S G      T T  G   +T Q          +    ++K+   +SK  K +++RT F+  Q+  LE +F+  +YLS  ER  LA SL++TETQVKIWFQNRRTKWKKQ
Sbjct:  207 SPGAPGPPATATGAGSAGSTPQGAA-------VTTKPKRKRTGSDSKSGKPRRARTAFTYEQLVALENKFKATRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQ 308          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Tlx3 (T cell leukemia, homeobox 3 [Source:MGI Symbol;Acc:MGI:1351209])

HSP 1 Score: 71.2478 bits (173), Expect = 1.178e-13
Identity = 42/65 (64.62%), Postives = 51/65 (78.46%), Query Frame = 2
Query:  422 NSKQDKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQ 616
            N    K+KK RT+FS  QICELEK+F  +KYL+SAERA LA SL +T+ QVK WFQNRRTKW++Q
Sbjct:  160 NRTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQ 224          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|P56407|HM09_CAEEL (Homeobox protein ceh-9 OS=Caenorhabditis elegans OX=6239 GN=ceh-9 PE=3 SV=2)

HSP 1 Score: 81.6481 bits (200), Expect = 9.534e-18
Identity = 49/73 (67.12%), Postives = 62/73 (84.93%), Query Frame = 2
Query:  404 KKKRVRNSKQDKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQEN 622
            K+  +   ++ K+KK+RTTFSG+Q+ ELEKQFE KKYLSS++R+ELA  L+VTETQVKIWFQNRRTKWKK E+
Sbjct:   58 KESPIEKCQKTKRKKARTTFSGKQVFELEKQFEAKKYLSSSDRSELAKRLDVTETQVKIWFQNRRTKWKKIES 130          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9C056|NKX62_HUMAN (Homeobox protein Nkx-6.2 OS=Homo sapiens OX=9606 GN=NKX6-2 PE=1 SV=2)

HSP 1 Score: 73.9442 bits (180), Expect = 7.298e-14
Identity = 43/73 (58.90%), Postives = 53/73 (72.60%), Query Frame = 2
Query:  428 KQDKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQENITTVLAQQ 646
            K  KKK SR TFSG+QI  LEK FE  KYL+  ERA LA SL +TE+QVK+WFQNRRTKW+K+  +    A++
Sbjct:  144 KDGKKKHSRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKRHAVEMASAKK 216          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|Q99MA9|NKX61_MOUSE (Homeobox protein Nkx-6.1 OS=Mus musculus OX=10090 GN=Nkx6-1 PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 8.625e-14
Identity = 45/96 (46.88%), Postives = 61/96 (63.54%), Query Frame = 2
Query:  362 ITSPPLNNINVYC-EKKKRVRNSKQDKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQENITTVLAQQ 646
            + SPP  +  + C   +  +   K  K+K +R TFSG+QI  LEK FE  KYL+  ERA LA SL +TE+QVK+WFQNRRTKW+K+       A++
Sbjct:  210 MQSPPWRDARLACTPHQGSILLDKDGKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKHAAEMATAKK 305          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|O35762|NKX61_RAT (Homeobox protein Nkx-6.1 OS=Rattus norvegicus OX=10116 GN=Nkx6-1 PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 9.127e-14
Identity = 45/96 (46.88%), Postives = 61/96 (63.54%), Query Frame = 2
Query:  362 ITSPPLNNINVYC-EKKKRVRNSKQDKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQENITTVLAQQ 646
            + SPP  +  + C   +  +   K  K+K +R TFSG+QI  LEK FE  KYL+  ERA LA SL +TE+QVK+WFQNRRTKW+K+       A++
Sbjct:  210 MQSPPWRDARLACTPHQGSILLDKDGKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKHAAEMATAKK 305          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|Q60554|NKX61_MESAU (Homeobox protein Nkx-6.1 OS=Mesocricetus auratus OX=10036 GN=NKX6-1 PE=1 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 9.973e-14
Identity = 45/96 (46.88%), Postives = 61/96 (63.54%), Query Frame = 2
Query:  362 ITSPPLNNINVYC-EKKKRVRNSKQDKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQENITTVLAQQ 646
            + SPP  +  + C   +  +   K  K+K +R TFSG+QI  LEK FE  KYL+  ERA LA SL +TE+QVK+WFQNRRTKW+K+       A++
Sbjct:  209 MQSPPWRDARLACTPHQGSILLDKDGKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKHAAEMATAKK 304          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: Q9GP46 (NK7 subclass protein (Fragment) OS=Discocelis tigrina OX=52060 GN=NKB PE=2 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 3.381e-22
Identity = 63/94 (67.02%), Postives = 72/94 (76.60%), Query Frame = 2
Query:  434 DKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQENITTVLAQQFRQSIDNNRSIDLMSELESNGSE 715
            ++KKKSRTTFSGRQI ELE+QFE KKYLSS ERAE+A+ LNVTETQVKIWFQNRRTKWKKQENI+   AQ  RQ  ++   I     L+   SE
Sbjct:   35 ERKKKSRTTFSGRQIFELERQFEQKKYLSSGERAEMANQLNVTETQVKIWFQNRRTKWKKQENISNTEAQSIRQQTESQAKIAETVTLKREDSE 128          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: R7TCH5 (NK-like homeobox protein 7 (Fragment) OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_79123 PE=4 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 4.999e-22
Identity = 58/70 (82.86%), Postives = 65/70 (92.86%), Query Frame = 2
Query:  431 QDKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQENITTVLA 640
            +DKKKK+RTTF+GRQI ELEKQFELKKYLSS+ERAE+A+ LNVTETQVKIWFQNRRTKWKKQENI+   A
Sbjct:   18 RDKKKKARTTFTGRQIFELEKQFELKKYLSSSERAEMATLLNVTETQVKIWFQNRRTKWKKQENISNTEA 87          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: C4MLF2 (NK-like homeobox protein 7 OS=Capitella teleta OX=283909 GN=NKx7 PE=2 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 1.454e-21
Identity = 60/84 (71.43%), Postives = 71/84 (84.52%), Query Frame = 2
Query:  431 QDKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQENITTVLAQQFRQSIDNNRSID 682
            +DKKKK+RTTF+GRQI ELEKQFELKKYLSS+ERAE+A+ LNVTETQVKIWFQNRRTKWKKQENI+   A  ++  I   + +D
Sbjct:   18 RDKKKKARTTFTGRQIFELEKQFELKKYLSSSERAEMATLLNVTETQVKIWFQNRRTKWKKQENISNTEAADYK--IGGEKHVD 99          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: A0A210QAG5 (Homeobox protein ceh-9 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT01528 PE=4 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 3.528e-21
Identity = 60/78 (76.92%), Postives = 68/78 (87.18%), Query Frame = 2
Query:  431 QDKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQENITTVLAQQFRQSID 664
            Q KKKK+RTTF+GRQI ELEKQFELKKYLSSAERAE+A+ LNVTETQVKIWFQNRRTKWKKQENI+   A + +  +D
Sbjct:  141 QAKKKKARTTFTGRQIFELEKQFELKKYLSSAERAEMAALLNVTETQVKIWFQNRRTKWKKQENISNAEAAEHKVHVD 218          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: C3Y453 (Nk homeobox 7 OS=Branchiostoma floridae OX=7739 GN=Tlx PE=4 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 1.251e-19
Identity = 71/159 (44.65%), Postives = 97/159 (61.01%), Query Frame = 2
Query:  233 SSQGKDFCSRPVISDELLTSYGHANQLTTGTQTGDGENTNQNQITSPPLNNINVYCEKKKRVRNSKQD---KKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQENITTVLAQQFRQSIDNNRSIDLMSELE 700
            SS G    +R     E  +S    +Q  +G ++GD +  N  +           Y +  K   +  Q+   KKKK+RTTF+GRQI ELEKQFE+KKYLS++ERA+LA+ LNVT+TQVKIWFQNRRTKWKKQ+ I+   A + +  I  +R ID + + E
Sbjct:   85 SSTGAASSTREDSDSEARSSDSGRDQDESGHESGDAKANNSTK---------RKYEDGDKNATDGNQEDKPKKKKARTTFTGRQIFELEKQFEVKKYLSASERADLAALLNVTDTQVKIWFQNRRTKWKKQDGISNAEAAEHK--IGGSRHIDTVRQRE 232          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: nkx6.2 (NK6 homeobox 2 [Source:NCBI gene;Acc:103044611])

HSP 1 Score: 77.0258 bits (188), Expect = 7.887e-16
Identity = 46/91 (50.55%), Postives = 58/91 (63.74%), Query Frame = 2
Query:  374 PLNNINVYCEKKKRVRNSKQDKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQENITTVLAQQ 646
            P  +  V C  +  +   K  KKK SR TFSG+QI  LEK FE  KYL+  ERA LA SL +TE+QVK+WFQNRRTKW+K+       A++
Sbjct:  130 PWRDPRVPCPSQASLMLDKDGKKKHSRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKHAAEMATAKK 220          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: tlx3b (T cell leukemia homeobox 3b [Source:ZFIN;Acc:ZDB-GENE-021021-1])

HSP 1 Score: 70.4774 bits (171), Expect = 1.302e-13
Identity = 41/65 (63.08%), Postives = 51/65 (78.46%), Query Frame = 2
Query:  422 NSKQDKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQ 616
            N    K+KK RT+FS  QICELEK+F  +KYL+SAERA LA +L +T+ QVK WFQNRRTKW++Q
Sbjct:  151 NRTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKTLKMTDAQVKTWFQNRRTKWRRQ 215          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000055288.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000111.1:341656:348959:-1 gene:ENSAMXG00000038858.1 transcript:ENSAMXT00000055288.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.0922 bits (170), Expect = 1.601e-13
Identity = 42/65 (64.62%), Postives = 51/65 (78.46%), Query Frame = 2
Query:  422 NSKQDKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQ 616
            N    K+KK RT+FS  QICELEK+F  +KYL+SAERA LA SL +T+ QVK WFQNRRTKW++Q
Sbjct:  137 NRTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQ 201          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: tlx1 (T cell leukemia homeobox 1 [Source:NCBI gene;Acc:103034137])

HSP 1 Score: 70.0922 bits (170), Expect = 1.907e-13
Identity = 41/65 (63.08%), Postives = 51/65 (78.46%), Query Frame = 2
Query:  422 NSKQDKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQ 616
            N    KKKK RT+F+  QICELEK+F  +KYL+SAERA LA +L +T+ QVK WFQNRRTKW++Q
Sbjct:  168 NRTPPKKKKPRTSFTRLQICELEKRFHRQKYLASAERAALAKALKMTDAQVKTWFQNRRTKWRRQ 232          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: tlx2 (T cell leukemia homeobox 2 [Source:NCBI gene;Acc:103046147])

HSP 1 Score: 69.707 bits (169), Expect = 2.713e-13
Identity = 41/65 (63.08%), Postives = 51/65 (78.46%), Query Frame = 2
Query:  422 NSKQDKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQ 616
            N    K+KK RT+FS  QICELEK+F  +KYL+SAERA LA +L +T+ QVK WFQNRRTKW++Q
Sbjct:  174 NRTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERATLAKALKMTDAQVKTWFQNRRTKWRRQ 238          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: HMX1 (H6 family homeobox 1 [Source:HGNC Symbol;Acc:HGNC:5017])

HSP 1 Score: 65.4698 bits (158), Expect = 1.413e-13
Identity = 41/59 (69.49%), Postives = 51/59 (86.44%), Query Frame = 2
Query:  440 KKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQ 616
            KKK+RT FS  Q+ +LE  F++K+YLSSAERA LA+SL++TETQVKIWFQNRR KWK+Q
Sbjct:    1 KKKTRTVFSRSQVFQLESTFDMKRYLSSAERAGLAASLHLTETQVKIWFQNRRNKWKRQ 59          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: tlx1 (T cell leukemia homeobox 1 [Source:ZFIN;Acc:ZDB-GENE-021021-2])

HSP 1 Score: 67.3958 bits (163), Expect = 3.254e-13
Identity = 39/63 (61.90%), Postives = 49/63 (77.78%), Query Frame = 2
Query:  422 NSKQDKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWK 610
            N    K+KK RT+F+  QICELEK+F  +KYL+SAERA LA +L +T+ QVK WFQNRRTKW+
Sbjct:  224 NRTPPKRKKPRTSFTRLQICELEKRFHRQKYLASAERAALAKALKMTDAQVKTWFQNRRTKWR 286          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: barhl2 (BarH-like homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-050913-153])

HSP 1 Score: 62.7734 bits (151), Expect = 9.636e-13
Identity = 36/66 (54.55%), Postives = 51/66 (77.27%), Query Frame = 2
Query:  428 KQDKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQENI 625
            +  K +K+RT FS  Q+ +LE+ FE +KYLS  +R ELASSL++++TQVK W+QNRRTKWK+Q  +
Sbjct:    1 RAKKPRKARTAFSDHQLTQLERSFERQKYLSVQDRMELASSLSLSDTQVKTWYQNRRTKWKRQTAV 66          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: barhl2 (BarH-like homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-050913-153])

HSP 1 Score: 62.7734 bits (151), Expect = 1.411e-12
Identity = 36/66 (54.55%), Postives = 51/66 (77.27%), Query Frame = 2
Query:  428 KQDKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQENI 625
            +  K +K+RT FS  Q+ +LE+ FE +KYLS  +R ELASSL++++TQVK W+QNRRTKWK+Q  +
Sbjct:    1 RAKKPRKARTAFSDHQLTQLERSFERQKYLSVQDRMELASSLSLSDTQVKTWYQNRRTKWKRQTAV 66          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001141.1 (pep scaffold:Pmarinus_7.0:GL478075:36995:38394:-1 gene:ENSPMAG00000001023.1 transcript:ENSPMAT00000001141.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.151 bits (139), Expect = 2.601e-11
Identity = 33/59 (55.93%), Postives = 46/59 (77.97%), Query Frame = 2
Query:  437 KKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKK 613
            K ++ RT FS +Q+ ELE+ F  ++YLS  +R ++AS+L +TETQVKIWFQNRR KWK+
Sbjct:    2 KCRRPRTAFSSQQLLELERHFSRQRYLSRPQRFQVASALMLTETQVKIWFQNRRMKWKR 60          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: ANTH.HBXC.NV (NK-like 20; Predicted protein [Source:UniProtKB/TrEMBL;Acc:Q0N4G2])

HSP 1 Score: 85.1149 bits (209), Expect = 2.057e-21
Identity = 49/60 (81.67%), Postives = 56/60 (93.33%), Query Frame = 2
Query:  440 KKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQE 619
            KKK+RTTF+GRQI ELEKQFE KKYL++ ER+++AS LNVTETQVKIWFQNRRTKWKKQE
Sbjct:    1 KKKARTTFTGRQIFELEKQFEAKKYLTATERSDMASLLNVTETQVKIWFQNRRTKWKKQE 60          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: EDO48767 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI78])

HSP 1 Score: 64.6994 bits (156), Expect = 9.038e-14
Identity = 40/60 (66.67%), Postives = 51/60 (85.00%), Query Frame = 2
Query:  437 KKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQ 616
            +KKK+RT FS  Q+ +LE  F++K+YLSS+ERA LAS L++TETQVKIWFQNRR KWK+Q
Sbjct:    1 RKKKTRTVFSRSQVYQLESTFDMKRYLSSSERAGLASQLHLTETQVKIWFQNRRNKWKRQ 60          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: EDO30887 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZI0])

HSP 1 Score: 65.0846 bits (157), Expect = 2.003e-13
Identity = 39/60 (65.00%), Postives = 47/60 (78.33%), Query Frame = 2
Query:  437 KKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQ 616
            K+K +R TFSG QI  LEK FE  KYL+  ERA LA SL +TE+QVK+WFQNRRTKW+K+
Sbjct:    5 KRKHTRPTFSGHQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKR 64          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: EDO42243 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S290])

HSP 1 Score: 62.003 bits (149), Expect = 1.051e-12
Identity = 35/59 (59.32%), Postives = 46/59 (77.97%), Query Frame = 2
Query:  437 KKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKK 613
            + ++ RT FS  Q+  LE+QF+L KYL+  +R ELA+SL +TETQVKIWFQNRR KWK+
Sbjct:    6 RHRRPRTAFSSHQLLALERQFQLHKYLTRPQRYELATSLMLTETQVKIWFQNRRMKWKR 64          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: ANTH-HBXE (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1J1])

HSP 1 Score: 61.6178 bits (148), Expect = 3.087e-12
Identity = 31/63 (49.21%), Postives = 50/63 (79.37%), Query Frame = 2
Query:  440 KKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQENIT 628
            +++ RT F+ +Q+ +LE++F  KKY+S  ER+ +A++LN+TE QVKIWFQNRR KWK+  +++
Sbjct:    5 RRRKRTAFTSKQLLQLEREFHNKKYVSLEERSVIATNLNLTEVQVKIWFQNRRAKWKRVRSLS 67          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: nkx6.2 (NK6 homeobox 2 [Source:NCBI gene;Acc:101156349])

HSP 1 Score: 76.6406 bits (187), Expect = 9.453e-16
Identity = 46/91 (50.55%), Postives = 58/91 (63.74%), Query Frame = 2
Query:  374 PLNNINVYCEKKKRVRNSKQDKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQENITTVLAQQ 646
            P  +  V C  +  +   K  KKK SR TFSG+QI  LEK FE  KYL+  ERA LA SL +TE+QVK+WFQNRRTKW+K+       A++
Sbjct:  134 PWRDPRVPCPAQANIMLDKDGKKKHSRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKRHAAEMASAKK 224          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: tlx1 (T cell leukemia homeobox 1 [Source:NCBI gene;Acc:101163994])

HSP 1 Score: 70.4774 bits (171), Expect = 1.348e-13
Identity = 48/109 (44.04%), Postives = 64/109 (58.72%), Query Frame = 2
Query:  368 SPPLNNINV----YCEKKKRV----------------------RNSKQDKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQ 616
            +PP+NN+N     + E  +R                       +N    K+KK RT+FS  QICELEK+F  +KYL+SAERA LA +L +T+ QVK WFQNRRTKW++Q
Sbjct:  116 APPMNNLNALTFPWMESNRRYTKDRFTVSLSPLTVTRRIGHPYQNRTPPKRKKPRTSFSRLQICELEKRFHRQKYLASAERAALAKALKMTDAQVKTWFQNRRTKWRRQ 224          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000004940.2 (T cell leukemia homeobox 3 [Source:NCBI gene;Acc:101161249])

HSP 1 Score: 70.0922 bits (170), Expect = 1.792e-13
Identity = 42/65 (64.62%), Postives = 51/65 (78.46%), Query Frame = 2
Query:  422 NSKQDKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQ 616
            N    K+KK RT+FS  QICELEK+F  +KYL+SAERA LA SL +T+ QVK WFQNRRTKW++Q
Sbjct:  160 NRTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQ 224          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: nkx6.1 (NK6 homeobox 1 [Source:NCBI gene;Acc:101156548])

HSP 1 Score: 70.0922 bits (170), Expect = 2.299e-13
Identity = 41/73 (56.16%), Postives = 52/73 (71.23%), Query Frame = 2
Query:  428 KQDKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQENITTVLAQQ 646
            K  K+K +R TFSG+QI  LEK FE  KYL+  ERA LA SL +TE+QVK+WFQNRRTKW+K+       A++
Sbjct:  160 KDGKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKHAAEMASAKK 232          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000007626.2 (transcription factor SOHo [Source:NCBI gene;Acc:100049513])

HSP 1 Score: 68.9366 bits (167), Expect = 2.346e-13
Identity = 50/102 (49.02%), Postives = 67/102 (65.69%), Query Frame = 2
Query:  338 GENTNQNQITSPPLNNINVYCEKKKRVRNSKQDK----KKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQENITT 631
            GE     +++ P L  ++   EKK++ +          KKK+RT FS RQI +LE  F++K+YLSS+ERA LASSL +TETQVKIWFQNRR K K+Q +  T
Sbjct:   62 GEKATPTEVSFPVLQGVHASSEKKQQQQQQDAPTENRVKKKTRTIFSKRQIYQLEATFDMKRYLSSSERACLASSLQLTETQVKIWFQNRRNKLKRQLSTDT 163          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000021901.1 (SMESG000021901.1)

HSP 1 Score: 486.108 bits (1250), Expect = 2.988e-175
Identity = 273/273 (100.00%), Postives = 273/273 (100.00%), Query Frame = 2
Query:    2 MNKSSNKIFSFDIHDHNSSAGTRKWFQLIENIQRSFFEGQCHNIIRQQFIXXXXXXXXXXXXXXXXXXXXFMIKDLLSSQGKDFCSRPVISDELLTSYGHANQLTTGTQTGDGENTNQNQITSPPLNNINVYCEKKKRVRNSKQDKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQENITTVLAQQFRQSIDNNRSIDLMSELESNGSENQYYDTKITNKITNPRLNEVLEKDLCPSINIENDA 820
            MNKSSNKIFSFDIHDHNSSAGTRKWFQLIENIQRSFFEGQCHNIIRQQFISLPPNSWPLSSNNDSTKSSSFMIKDLLSSQGKDFCSRPVISDELLTSYGHANQLTTGTQTGDGENTNQNQITSPPLNNINVYCEKKKRVRNSKQDKKKKSRTTFSGRQICELEKQFELKKYLSSAERAELASSLNVTETQVKIWFQNRRTKWKKQENITTVLAQQFRQSIDNNRSIDLMSELESNGSENQYYDTKITNKITNPRLNEVLEKDLCPSINIENDA
Sbjct:    1 MNKSSNKIFSFDIHDHNSSAGTRKWFQLIENIQRSFFEGQCHNIIRQQFISLPPNSWPLSSNNDSTKSSSFMIKDLLSSQGKDFCSRPVISDELLTSYGHANQLTTGTQTGDGENTNQNQITSPPLNNINVYCEKKKRVRNSKQDKKKKSRTTFSGRQICELEKQFELKKYLSSAERAELASSLNVTETQVKIWFQNRRTKWKKQENITTVLAQQFRQSIDNNRSIDLMSELESNGSENQYYDTKITNKITNPRLNEVLEKDLCPSINIENDA 273          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000022963.1 (SMESG000022963.1)

HSP 1 Score: 66.6254 bits (161), Expect = 9.485e-13
Identity = 40/83 (48.19%), Postives = 56/83 (67.47%), Query Frame = 2
Query:  431 QDKKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQENITTVLAQQFRQSIDNNRSI 679
            + + +K+RT F+ +Q+CELEK F+  KYLS  +R ELA+ L +T+TQVK W+QNRRTKWK+Q +    L  +     D  RSI
Sbjct:   63 EKRPRKARTAFTEKQLCELEKSFDKHKYLSVQDRLELANYLELTDTQVKTWYQNRRTKWKRQTSTGVDLLTEGSNVTDLRRSI 145          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000019482.1 (SMESG000019482.1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.018e-12
Identity = 40/60 (66.67%), Postives = 50/60 (83.33%), Query Frame = 2
Query:  437 KKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQ 616
            +KKK+RT FS  Q+ +LE  F+LK+YLSS+ERA LA +L +TETQVKIWFQNRR KWK+Q
Sbjct:  211 RKKKTRTVFSRNQVFQLESTFDLKRYLSSSERASLAHALQLTETQVKIWFQNRRNKWKRQ 270          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000033792.1 (SMESG000033792.1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.151e-12
Identity = 38/60 (63.33%), Postives = 50/60 (83.33%), Query Frame = 2
Query:  437 KKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQ 616
            +KKK+RT FS  Q+ +LE  F++K+YLSS+ER+ LA +L +TETQVKIWFQNRR KWK+Q
Sbjct:  189 RKKKTRTVFSRNQVFQLESTFDMKRYLSSSERSSLAHALQLTETQVKIWFQNRRNKWKRQ 248          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000051002.1 (SMESG000051002.1)

HSP 1 Score: 67.3958 bits (163), Expect = 1.730e-12
Identity = 49/112 (43.75%), Postives = 65/112 (58.04%), Query Frame = 2
Query:  437 KKKKSRTTFSGRQICELEKQFELKKYXXXXXXXXXXXXXNVTETQVKIWFQNRRTKWKKQENITTVLAQQFRQSIDNNRSID--LMSELES--NGSENQYYDTKITNKITNP 760
            K +++RT+F+  Q+  LE +F++ +YLS  ER  LA SLN+TETQVKIWFQNRRTKWKKQ     V +        N R  D  LMS   +  N    Q  D+ + N +  P
Sbjct:  162 KPRRARTSFTYDQLVALENKFKITRYLSVCERLNLAFSLNLTETQVKIWFQNRRTKWKKQNPGLDVNSTTITPPSTNPRYYDHSLMSNFANFLNNRSYQAIDSSLHNNLIGP 273          
The following BLAST results are available for this feature:
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NKX6-21.520e-1458.90NK6 homeobox 2 [Source:HGNC Symbol;Acc:HGNC:19321][more]
NKX6-12.525e-1446.88NK6 homeobox 1 [Source:HGNC Symbol;Acc:HGNC:7839][more]
NKX6-34.471e-1438.82NK6 homeobox 3 [Source:HGNC Symbol;Acc:HGNC:26328][more]
TLX31.961e-1364.62T cell leukemia homeobox 3 [Source:HGNC Symbol;Acc... [more]
TLX14.749e-1363.08T cell leukemia homeobox 1 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ceh-97.495e-1967.12Homeobox protein ceh-9 [Source:UniProtKB/Swiss-Pr... [more]
cog-13.682e-1554.67COG-1B [Source:UniProtKB/TrEMBL;Acc:G5EGF2][more]
cog-11.597e-1454.67COG-1B [Source:UniProtKB/TrEMBL;Acc:G5EGF2][more]
mls-23.033e-1260.00Mesodermal Lineage Specification [Source:UniProtK... [more]
ceh-191.625e-1142.86Homeobox protein ceh-19 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NK7.11.366e-1968.92gene:FBgn0024321 transcript:FBtr0306742[more]
NK7.11.366e-1968.92gene:FBgn0024321 transcript:FBtr0347151[more]
NK7.11.366e-1968.92gene:FBgn0024321 transcript:FBtr0082942[more]
NK7.11.366e-1968.92gene:FBgn0024321 transcript:FBtr0082941[more]
HGTX3.470e-1447.73gene:FBgn0040318 transcript:FBtr0075720[more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nkx6.26.157e-1641.98NK6 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-070626-1][more]
nkx6.35.433e-1447.22NK6 homeobox 3 [Source:ZFIN;Acc:ZDB-GENE-070810-7][more]
hmx3b1.605e-1361.64H6 family homeobox 3b [Source:ZFIN;Acc:ZDB-GENE-13... [more]
tlx3b1.806e-1363.08T cell leukemia homeobox 3b [Source:ZFIN;Acc:ZDB-G... [more]
nkx6.31.879e-1347.22NK6 homeobox 3 [Source:ZFIN;Acc:ZDB-GENE-070810-7][more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zfand18.884e-1549.45zinc finger AN1-type containing 1 [Source:Xenbase;... [more]
meis12.542e-1447.92Meis homeobox 1 [Source:Xenbase;Acc:XB-GENE-479439... [more]
soga18.409e-1441.74suppressor of glucose, autophagy associated 1 [Sou... [more]
jup2.302e-1364.62junction plakoglobin [Source:Xenbase;Acc:XB-GENE-4... [more]
ENSXETT00000011915.14.124e-1362.12T cell leukemia homeobox 1 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nkx6-11.233e-1446.88NK6 homeobox 1 [Source:MGI Symbol;Acc:MGI:1206039][more]
Nkx6-23.891e-1458.90NK6 homeobox 2 [Source:MGI Symbol;Acc:MGI:1352738][more]
Nkx6-23.891e-1458.90NK6 homeobox 2 [Source:MGI Symbol;Acc:MGI:1352738][more]
Nkx1-16.767e-1442.20NK1 homeobox 1 [Source:MGI Symbol;Acc:MGI:109346][more]
Tlx31.178e-1364.62T cell leukemia, homeobox 3 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P56407|HM09_CAEEL9.534e-1867.12Homeobox protein ceh-9 OS=Caenorhabditis elegans O... [more]
sp|Q9C056|NKX62_HUMAN7.298e-1458.90Homeobox protein Nkx-6.2 OS=Homo sapiens OX=9606 G... [more]
sp|Q99MA9|NKX61_MOUSE8.625e-1446.88Homeobox protein Nkx-6.1 OS=Mus musculus OX=10090 ... [more]
sp|O35762|NKX61_RAT9.127e-1446.88Homeobox protein Nkx-6.1 OS=Rattus norvegicus OX=1... [more]
sp|Q60554|NKX61_MESAU9.973e-1446.88Homeobox protein Nkx-6.1 OS=Mesocricetus auratus O... [more]
back to top
BLAST of Homeobox domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q9GP463.381e-2267.02NK7 subclass protein (Fragment) OS=Discocelis tigr... [more]
R7TCH54.999e-2282.86NK-like homeobox protein 7 (Fragment) OS=Capitella... [more]
C4MLF21.454e-2171.43NK-like homeobox protein 7 OS=Capitella teleta OX=... [more]
A0A210QAG53.528e-2176.92Homeobox protein ceh-9 OS=Mizuhopecten yessoensis ... [more]
C3Y4531.251e-1944.65Nk homeobox 7 OS=Branchiostoma floridae OX=7739 GN... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nkx6.27.887e-1650.55NK6 homeobox 2 [Source:NCBI gene;Acc:103044611][more]
tlx3b1.302e-1363.08T cell leukemia homeobox 3b [Source:ZFIN;Acc:ZDB-G... [more]
ENSAMXT00000055288.11.601e-1364.62pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
tlx11.907e-1363.08T cell leukemia homeobox 1 [Source:NCBI gene;Acc:1... [more]
tlx22.713e-1363.08T cell leukemia homeobox 2 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HMX11.413e-1369.49H6 family homeobox 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
tlx13.254e-1361.90T cell leukemia homeobox 1 [Source:ZFIN;Acc:ZDB-GE... [more]
barhl29.636e-1354.55BarH-like homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-050... [more]
barhl21.411e-1254.55BarH-like homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-050... [more]
ENSPMAT00000001141.12.601e-1155.93pep scaffold:Pmarinus_7.0:GL478075:36995:38394:-1 ... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
ANTH.HBXC.NV2.057e-2181.67NK-like 20; Predicted protein [Source:UniProtKB/T... [more]
EDO487679.038e-1466.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308872.003e-1365.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO422431.051e-1259.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
ANTH-HBXE3.087e-1249.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nkx6.29.453e-1650.55NK6 homeobox 2 [Source:NCBI gene;Acc:101156349][more]
tlx11.348e-1344.04T cell leukemia homeobox 1 [Source:NCBI gene;Acc:1... [more]
ENSORLT00000004940.21.792e-1364.62T cell leukemia homeobox 3 [Source:NCBI gene;Acc:1... [more]
nkx6.12.299e-1356.16NK6 homeobox 1 [Source:NCBI gene;Acc:101156548][more]
ENSORLT00000007626.22.346e-1349.02transcription factor SOHo [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000021901.12.988e-175100.00SMESG000021901.1[more]
SMESG000022963.19.485e-1348.19SMESG000022963.1[more]
SMESG000019482.11.018e-1266.67SMESG000019482.1[more]
SMESG000033792.11.151e-1263.33SMESG000033792.1[more]
SMESG000051002.11.730e-1243.75SMESG000051002.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035975 ID=SMED30035975|Name=Homeobox domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=934bp
AATGAATAAATCATCCAATAAAATTTTCAGTTTCGACATTCATGATCACA
ACTCAAGCGCGGGAACTAGGAAATGGTTCCAGTTGATTGAAAATATTCAA
CGTTCGTTTTTTGAAGGACAATGTCATAATATAATTCGACAGCAATTCAT
ATCTCTACCTCCAAATTCCTGGCCTCTTTCATCGAATAATGACTCAACGA
AATCATCCTCATTCATGATCAAAGATCTCCTATCAAGTCAAGGAAAAGAT
TTTTGCAGCCGTCCTGTAATATCTGATGAACTATTAACAAGCTATGGTCA
TGCAAATCAATTGACAACCGGCACACAAACGGGTGACGGTGAAAATACCA
ATCAAAATCAGATTACTTCACCACCATTGAACAATATCAATGTTTATTGT
GAAAAAAAGAAACGGGTTCGAAATTCTAAGCAAGACAAAAAGAAAAAAAG
CAGAACAACATTTTCCGGGAGACAAATTTGTGAATTGGAGAAACAATTCG
AATTGAAAAAGTATTTATCGTCTGCCGAGAGAGCGGAGTTGGCAAGCTCT
TTAAATGTGACTGAGACGCAAGTCAAGATATGGTTCCAAAATCGACGAAC
AAAATGGAAGAAACAGGAGAACATAACTACAGTTTTGGCCCAACAATTCC
GACAAAGCATTGACAATAATAGGTCGATTGATCTTATGTCTGAGCTCGAA
TCCAACGGATCCGAGAATCAGTATTATGATACAAAGATAACCAATAAGAT
CACAAATCCTAGACTCAATGAAGTATTGGAGAAAGATTTATGTCCATCAA
TTAACATTGAAAATGATGCTTGAAAATCGCTGGCAATCACCTTGAAATTG
CGATTCAAATTGGAAAATTATTTCCACGAGATTTTGAATACTTTCCTTTT
GACTTTGGATGAAAAGTTCCCCGAATCTATGAGA
back to top

protein sequence of SMED30035975-orf-1

>SMED30035975-orf-1 ID=SMED30035975-orf-1|Name=SMED30035975-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=274bp
MNKSSNKIFSFDIHDHNSSAGTRKWFQLIENIQRSFFEGQCHNIIRQQFI
SLPPNSWPLSSNNDSTKSSSFMIKDLLSSQGKDFCSRPVISDELLTSYGH
ANQLTTGTQTGDGENTNQNQITSPPLNNINVYCEKKKRVRNSKQDKKKKS
RTTFSGRQICELEKQFELKKYLSSAERAELASSLNVTETQVKIWFQNRRT
KWKKQENITTVLAQQFRQSIDNNRSIDLMSELESNGSENQYYDTKITNKI
TNPRLNEVLEKDLCPSINIENDA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR001356Homeobox_dom
IPR009057Homeobox-like_sf
IPR017970Homeobox_CS
IPR000047HTH_motif
IPR020479Homeobox_metazoa
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0043565sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000047Helix-turn-helix motifPRINTSPR00031HTHREPRESSRcoord: 176..185
score: 48.93
coord: 185..201
score: 57.0
IPR020479Homeobox domain, metazoaPRINTSPR00024HOMEOBOXcoord: 184..194
score: 61.53
coord: 169..180
score: 43.14
coord: 194..203
score: 79.45
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 147..209
e-value: 9.0E-26
score: 101.6
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 148..204
e-value: 3.6E-22
score: 78.0
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 145..205
score: 21.281
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 148..206
e-value: 3.63366E-21
score: 82.2912
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 111..208
e-value: 2.9E-26
score: 93.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 107..127
NoneNo IPR availablePANTHERPTHR24340FAMILY NOT NAMEDcoord: 104..210
NoneNo IPR availablePANTHERPTHR24340:SF70NK7.1, ISOFORM Acoord: 104..210
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 180..203
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 142..209