transcription initiation factor TFIID subunit 2

Overview
Nametranscription initiation factor TFIID subunit 2
Smed IDSMED30035970
Length (bp)2876
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of transcription initiation factor TFIID subunit 2 (SMED30035970) t-SNE clustered cells

Violin plots show distribution of expression levels for transcription initiation factor TFIID subunit 2 (SMED30035970) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of transcription initiation factor TFIID subunit 2 (SMED30035970) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for transcription initiation factor TFIID subunit 2 (SMED30035970) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035970

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30035970SMESG000037189.1 Contig5205newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035970SMESG000037189.1 Contig5205uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035970SMESG000080138.1 Contig5205newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035970SMESG000080138.1 Contig5205uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
protonephridiaSMED30035970SMESG000037189.1 dd_Smed_v4_15494_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30035970SMESG000037189.1 dd_Smed_v4_15494_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30035970SMESG000037189.1 dd_Smed_v4_15494_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035970SMESG000037189.1 dd_Smed_v4_15494_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035970SMESG000037189.1 dd_Smed_v4_15494_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30035970SMESG000037189.1 dd_Smed_v4_15494_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035970SMESG000037189.1 dd_Smed_v4_15494_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035970SMESG000037189.1 dd_Smed_v4_15494_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30035970SMESG000037189.1 dd_Smed_v4_15494_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30035970SMESG000037189.1 dd_Smed_v4_15494_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of transcription initiation factor TFIID subunit 2 vs. Ensembl Human
Match: TAF2 (TATA-box binding protein associated factor 2 [Source:HGNC Symbol;Acc:HGNC:11536])

HSP 1 Score: 118.242 bits (295), Expect = 2.704e-26
Identity = 133/647 (20.56%), Postives = 254/647 (39.26%), Query Frame = 3
Query:   30 YKIKRQDLSIENIDFSKQSFEGITKFFIFPLECDFKSILLNCNGPIIKKIIFN---------------------------LENSSTDGFNAIYDRFNDDIISIYIPNELISAVYKLEPFFLLIYFSSQGNQCGLQFFISST----GSKTDYMYMAPYNNCSGSSFPCIE-FGQSCEWFIEIASPCGSMTVICSGCLKFI---DDNNYLFH--IERPTTACKISFAVGQFEYFHDPDNPRFQYYFPASFNQYVKFYIDILIKALKFLQSNVKFGYPFGIYKSVFVDFLLDEFYTASSLTLFNINLLLQYGESHKLFQPNHVLIAGFCEQYFGAYVETAQWKDSWICWGFAEYMAWEMLNEFFPIERSDESIYEIMEKMNHLVEYEYRNGGILLDASF-------SKSENFDFDPFNPRKMPIRYKRFYRIKSGLVFRSWTLCISFVGLCDVIRYYLKHEHFVDEKILESY-----------YLGNWTN--------LIEGTVKRRGHIDIIAKAHYLKERKNIELIVYQG-RNILSFLYSGDMECDIRESGEVVSRIVELSPKVFNH-------IEIGLCLKVSLLK-TDYKLLTSRMGETKGPPIGWINLDPNLMVIGRVQVLLDESQAELMFHDDNRFTGKLIGLQ 1754
            YK+  Q + I NI+F ++S  G  +  IFP   +   I LN     I ++  N                             N+     +A+     +  + I +P+EL   V +L+   + I FS    + GL F + S       +  +++   Y N +   FPC++ + + C W +E       + V     ++ +   D     FH  +  PT A  IS A+G FE   DP      ++        +K     L +  +F +  +   YP+  +K+VF+D    E    +S+++F+ NLL       +       L     +Q+FG ++    W D W+  G + Y+    + + F +   +E  + I E+++ +V YE + GG+LL   F       + + +  F   +P  +   Y   ++ K+ LV R     IS   +  V    L        +  +S+           +L + +N        LI+  V + G +       + ++R  +EL + Q   +  +  Y G ++  ++E     +  +++      H              K+ L+   +  +  S M      P+ WI +DP++ V+ +V+      QA+ M+    R+   ++  Q
Sbjct:   26 YKLTHQVVCINNINFQRKSVVGFVELTIFPTVANLNRIKLNSKQCRIYRVRINDLEAAFIYNDPTLEVCHSESKQRNLNYFSNAYAAAVSAVDPDAGNGELCIKVPSELWKHVDELKVLKIHINFSLDQPKGGLHFVVPSVEGSMAERGAHVFSCGYQNSTRFWFPCVDSYSELCTWKLEFTVDAAMVAVSNGDLVETVYTHDMRKKTFHYMLTIPTAASNISLAIGPFEILVDPYMHEVTHFCLPQLLPLLKHTTSYLHEVFEFYEEILTCRYPYSCFKTVFIDEAYVEVAAYASMSIFSTNLLHSAMIIDETPLTRRCLAQSLAQQFFGCFISRMSWSDEWVLKGISGYIYGLWMKKTFGV---NEYRHWIKEELDKIVAYELKTGGVLLHPIFGGGKEKDNPASHLHFSIKHPHTLSWEYYSMFQCKAHLVMRLIENRISMEFMLQVFNKLLSLASTASSQKFQSHMWSQMLVSTSGFLKSISNVSGKDIQPLIKQWVDQSGVVKFYGSFAFNRKRNVLELEIKQDYTSPGTQKYVGPLKVTVQELDGSFNHTLQIEENSLKHDIPCHSKSRRNKKKKIPLMNGEEVDMDLSAMDADS--PLLWIRIDPDMSVLRKVEF----EQADFMWQYQLRYERDVVAQQ 663          
BLAST of transcription initiation factor TFIID subunit 2 vs. Ensembl Celegans
Match: taf-2 (Transcription initiation factor TFIID subunit 2 [Source:UniProtKB/Swiss-Prot;Acc:Q9TYN3])

HSP 1 Score: 81.6481 bits (200), Expect = 2.008e-15
Identity = 132/624 (21.15%), Postives = 231/624 (37.02%), Query Frame = 3
Query:   30 YKIKRQDLSIENIDFSKQSFEGITKFFIFPLECDFK---------SILLNCNGPIIKKIIFN----------------LENSSTDGFNAIYDRF--NDDIISIYIPNELISAVYKLEPFFLLIYFSSQGNQCGLQFFISSTGSKTDYMYMAPYNNCSGSSFPCI-EFGQSCEWFIEIA-SPCGSMTVICSGCL---KFIDDN---NYLFHIERPTTACKISFAVGQFEYFHDPDNPR-FQYYFPA--SFNQYVKFYIDILIKALKFLQSNVKFGYPFGIYKSVFVDFLLDEFYTASSLTLFNINLLLQYGESHKLFQPNHVLIAGFCEQYFGAYVETAQWKDSWICWGFAEYMAWEMLNEFFPIERSDESIYEIMEKMNHLVEYEYRNGGILLD-ASFSKSENFDFDPFNPRKMPIRYKRFYRIKSGLVFRSWTLCISFVGLCDVIRYYLKHEHFVDEKILESYYLGNWTNLIEGT----------------------VKRRGHIDIIAKAHYLKERKNIELIVYQ------GRNILSFLYSGDMECDIRESGEVVSRIVELSPKVFNHIEIGLCLK-VSLLKTDYKLLTSRMGE------TKGPPIGWINLDPNLMVIGRVQV 1679
            ++I  Q + I N++ S +SF   T+  + P E             S+L N       K+  N                 E S +     +Y++   ND  + I IP E+   +   +   L +    +    GLQF   +      + Y  P+ + +     C+ E  Q   W +     P   +  + SG L   + + +N    Y FH   PT+AC I +A+G+F+    P++P  + +  P    F  +   Y+D   K ++FL+  +   +P+   K VFVD   +E    SSL +    +L        + +    LI     Q+FG  +  AQW   WI    A ++    +        + E+ +++   M+ + +YE++ G I+L     +K      DP +       Y      K  L  R     I       V+   L     + EK         W +L+  T                      V+  GH     K  + ++R  +E+ + Q      GR      Y+G +   ++E     +  +++   V +H EI    K     K    LLT    E          PI W+ +DP+ ++I  + +
Sbjct:   71 FRILSQQVEISNLNISTRSFNVRTEIVLLPCEKSLYQLDLHIGKCSLLPNEVPGSASKVTLNGVECEYSRRDFWKDLAQEKSISSLEPVLYEKLAENDYELQILIPKEVRKKIKHRKAVRLRVDTVVRDPPRGLQFVDFNEHDCHVFTYHTPHISGAREWTVCLDEPDQLALWELTFELEP--HLVPVASGELEEKREVSENGKIRYKFHQTVPTSACNIGWAIGRFKLEPHPESPTIYTFSLPGLEPFVNHTTMYLD---KMVEFLEEKLSCRFPYPTLKVVFVDQCTEEIQVYSSLLIVPTAMLYHKKIIDVVQEARQKLIFSIALQFFGCLISPAQWWHWWIPVSIARFLTSLYVETKL---GTAEARWQLKRAMDDVCDYEHQWGKIVLSPPEPTKKLPLHVDPRHEYTASPLYVEAMLKKGFLTMRMLQRRIGLEPFMRVLHRVLTVGLDMSEK---KTTPAAWRHLLTTTESFFRSVISVTGKEIPSFLSQFVRTGGHAAFAVKFDFNRKRNIVEIEIKQDDTEGNGRT----QYTGPLSVVVQEVDGAFTHTIQIDGAV-SHAEISCHSKGRKQRKKKVPLLTGEEIEIDLTNMDAESPILWLRIDPDYLLIREITI 678          
BLAST of transcription initiation factor TFIID subunit 2 vs. Ensembl Fly
Match: Taf2 (gene:FBgn0011836 transcript:FBtr0332688)

HSP 1 Score: 125.561 bits (314), Expect = 8.759e-29
Identity = 101/398 (25.38%), Postives = 169/398 (42.46%), Query Frame = 3
Query:   30 YKIKRQDLSIENIDFSKQSFEGITKFFIFPLECDFKSILLNCNGPIIKKIIFN-------------------------LENSSTDGFNAIY---DRFNDDIISIYIPNELISAVYKLEPFFLLIYFSSQGNQCGLQFFI--SSTGSKTD----YMYMAPYNNCSGSSFPCIE-FGQSCEWFIEIASPCGSMTVICSGCLKFI---DDNNYLFH--IERPTTACKISFAVGQFEYFHDPDNPRFQYYFPASFNQYVKFYIDILIKALKFLQSNVKFGYPFGIYKSVFVDFLLDEFYTASSLTLFNINLLLQYGESHKLFQPNHVLIAGFCEQYFGAYVETAQWKDSWICWGFAEYMAWEMLNEFFPIERSDESIYEIMEKMNHLVEYEYRNGGILLDAS 1103
            +K+  Q +S+  I F ++S  G+ +  I P   + + I LN     I  ++ N                         LE  S     A        N+  + I +P E  S + + +   + I FS +  +CG+ F I  +ST  +T     +M+   Y N S   FPC++ F   C W +E         V C   L+ I   D     FH  +  P  A  I+ AVGQFE + DP      ++        +K  +  L +A +F +  +   YPF  YK VFVD L  +    +++++ ++NLL       + +     +     EQ+FG ++ +  W D+W+  G AEY+      + F    ++E    +  ++  +V YE + GGI+LD S
Sbjct:   15 FKLAHQVVSLTGISFERRSIIGVVELTIVPNSENLRLIRLNAKQLRIYSVVLNDVCQADFTYFDPFQNICYKEHKSRALEVYSKHHLTAAQYTDPDVNNGELLIQVPPEGYSMIQEGQGLRIRIEFSLENPKCGVHFVIPPASTDEETQMNSSHMFTNCYENSSRLWFPCVDSFADPCTWRLEFTVDKNMTAVSCGELLEVIMTPDLRKKTFHYSVSTPVCAPNIALAVGQFEIYVDPHMHEVTHFCLPGLLPLLKNTVRYLHEAFEFYEETLSTRYPFSCYKQVFVDELDTDISAYATMSIASVNLLHSIAIIDQTYISRTFMSRAVAEQFFGCFITSHHWSDTWLAKGIAEYLCGLYSRKCF---GNNEYRAWVQSELARVVRYEEQYGGIILDCS 409          
BLAST of transcription initiation factor TFIID subunit 2 vs. Ensembl Fly
Match: Taf2 (gene:FBgn0011836 transcript:FBtr0076361)

HSP 1 Score: 125.561 bits (314), Expect = 8.759e-29
Identity = 101/398 (25.38%), Postives = 169/398 (42.46%), Query Frame = 3
Query:   30 YKIKRQDLSIENIDFSKQSFEGITKFFIFPLECDFKSILLNCNGPIIKKIIFN-------------------------LENSSTDGFNAIY---DRFNDDIISIYIPNELISAVYKLEPFFLLIYFSSQGNQCGLQFFI--SSTGSKTD----YMYMAPYNNCSGSSFPCIE-FGQSCEWFIEIASPCGSMTVICSGCLKFI---DDNNYLFH--IERPTTACKISFAVGQFEYFHDPDNPRFQYYFPASFNQYVKFYIDILIKALKFLQSNVKFGYPFGIYKSVFVDFLLDEFYTASSLTLFNINLLLQYGESHKLFQPNHVLIAGFCEQYFGAYVETAQWKDSWICWGFAEYMAWEMLNEFFPIERSDESIYEIMEKMNHLVEYEYRNGGILLDAS 1103
            +K+  Q +S+  I F ++S  G+ +  I P   + + I LN     I  ++ N                         LE  S     A        N+  + I +P E  S + + +   + I FS +  +CG+ F I  +ST  +T     +M+   Y N S   FPC++ F   C W +E         V C   L+ I   D     FH  +  P  A  I+ AVGQFE + DP      ++        +K  +  L +A +F +  +   YPF  YK VFVD L  +    +++++ ++NLL       + +     +     EQ+FG ++ +  W D+W+  G AEY+      + F    ++E    +  ++  +V YE + GGI+LD S
Sbjct:   15 FKLAHQVVSLTGISFERRSIIGVVELTIVPNSENLRLIRLNAKQLRIYSVVLNDVCQADFTYFDPFQNICYKEHKSRALEVYSKHHLTAAQYTDPDVNNGELLIQVPPEGYSMIQEGQGLRIRIEFSLENPKCGVHFVIPPASTDEETQMNSSHMFTNCYENSSRLWFPCVDSFADPCTWRLEFTVDKNMTAVSCGELLEVIMTPDLRKKTFHYSVSTPVCAPNIALAVGQFEIYVDPHMHEVTHFCLPGLLPLLKNTVRYLHEAFEFYEETLSTRYPFSCYKQVFVDELDTDISAYATMSIASVNLLHSIAIIDQTYISRTFMSRAVAEQFFGCFITSHHWSDTWLAKGIAEYLCGLYSRKCF---GNNEYRAWVQSELARVVRYEEQYGGIILDCS 409          
BLAST of transcription initiation factor TFIID subunit 2 vs. Ensembl Zebrafish
Match: taf2 (TAF2 RNA polymerase II, TATA box binding protein (TBP)-associated factor [Source:NCBI gene;Acc:324486])

HSP 1 Score: 119.398 bits (298), Expect = 8.631e-27
Identity = 99/436 (22.71%), Postives = 182/436 (41.74%), Query Frame = 3
Query:   30 YKIKRQDLSIENIDFSKQSFEGITKFFIFPLECDFKSILLNCNGPIIKKIIFN---------------------------LENSSTDGFNAIYDRFNDDIISIYIPNELISAVYKLEPFFLLIYFSSQGNQCGLQFFISST----GSKTDYMYMAPYNNCSGSSFPCIE-FGQSCEWFIEIASPCGSMTVICSGCLKFI-----DDNNYLFHIERPTTACKISFAVGQFEYFHDPDNPRFQYYFPASFNQYVKFYIDILIKALKFLQSNVKFGYPFGIYKSVFVDFLLDEFYTASSLTLFNINLLLQYGESHKLFQPNHVLIAGFCEQYFGAYVETAQWKDSWICWGFAEYMAWEMLNEFFPIERSDESIYEIMEKMNHLVEYEYRNGGILLDASFSKSENFD-------FDPFNPRKMPIRYKRFYRIKSGLVFR 1205
            YK+  Q + I N++F ++S  G  +  IFP   +   I LN     I ++  N                             ++ T   +A+     +  +SI +P+EL     +++   + I FS    + GL F +         +  +++     N S   FPC++ + + C W +E       + V C   ++ +         Y + +  PT A  IS AVG FE   DP      ++        +K  +  L +  +F +  +   YP+  +K+VFVD    +  + +S+++F+ NLL       +       L     +Q+FG ++    W D W+  G + Y+    L + F +   +E  + I E+++ +VEYE + GG+LL  +FS  +  D       F   +P  +   Y + ++ K+ LV R
Sbjct:   15 YKLTHQVVCINNVNFQRKSVIGYVELTIFPTVVNLNRIKLNSKQCRIYRVRVNDLEAPFIYNDPTLEVCHHESKQRNLNYFSSAYTAAVSAVDPDAGNGELSIKVPSELWKQGDEMKVMKVYIEFSLDQPKGGLHFVVPDVEGNMAERAAHVFSFGNQNSSRFWFPCVDSYSELCTWKLEFTVDASMVAVSCGDLVETVYTHDMRKKTYHYMLPIPTAAPNISMAVGPFEILVDPYMHEVTHFCLPQLLPLLKHTMSYLHEIFEFYEEILTCRYPYSCFKTVFVDEAYVQVSSYASMSIFSTNLLHSGLIIDQTPMTRSFLAQALAQQFFGCFISRMSWADEWVLKGISGYIYGLYLKKTFGV---NEYRHWIKEELDKIVEYELKIGGVLLHPTFSGGKEKDNPTPHLHFSIKHPHTLSWEYYKMFQCKAHLVMR 447          
BLAST of transcription initiation factor TFIID subunit 2 vs. Ensembl Xenopus
Match: TAF2 (uncharacterized loc100125055 [Source:Xenbase;Acc:XB-GENE-5962512])

HSP 1 Score: 116.316 bits (290), Expect = 1.100e-25
Identity = 133/646 (20.59%), Postives = 253/646 (39.16%), Query Frame = 3
Query:   30 YKIKRQDLSIENIDFSKQSFEGITKFFIFPLECDFKSILLNCNGPIIKKIIFN---------------------------LENSSTDGFNAIYDRFNDDIISIYIPNELISAVYKLEPFFLLIYFSSQGNQCGLQFFI----SSTGSKTDYMYMAPYNNCSGSSFPCIE-FGQSCEWFIEIASPCGSMTVICSGCLKFID------DNNYLFHIERPTTACKISFAVGQFEYFHDPDNPRFQYYFPASFNQYVKFYIDILIKALKFLQSNVKFGYPFGIYKSVFVDFLLDEFYTASSLTLFNINLLLQYGESHKLFQPNHVLIAGFCEQYFGAYVETAQWKDSWICWGFAEYMAWEMLNEFFPIERSDESIYEIMEKMNHLVEYEYRNGGILLDASFSKSENFD-------FDPFNPRKMPIRYKRFYRIKSGLVFRSWTLCISFVGLCDVIRYYLKHEHFVDEKILESY-----------YLGNWTN--------LIEGTVKRRGHIDIIAKAHYLKERKNIELIVYQGRNIL-SFLYSGDMECDIRESGEVVSRIVELSPKVFNH-------IEIGLCLKVSLLK-TDYKLLTSRMGETKGPPIGWINLDPNLMVIGRVQVLLDESQAELMFHDDNRFTGKLIG 1748
            YK+  Q + I N++F ++   G  +  I P+      I LN     I ++  N                             N+      A+     +  + I +P+EL   V +L+   + I FS    + GL F +     S   +  +++   Y N S   FPC++ + + C W +E      SM  + +G L  ++         + + +  PT A  IS AVG FE   DP      ++        +K     L +  +F +  +   YP+  +K+VFVD    E  + +S+++F+ NLL       +       L     +Q+FG ++    W D W+  G + Y+    + + F +   ++  + I ++++ +V YE + GG+LL   FS  +  D       F   +P  +   Y   ++ K+ LV R     IS   +  V    L        +  +S+           +L + +N        LI+  V + G +       + ++R  +EL + Q    L +  Y G ++  ++E     +  +++      H              K+ L+   +  +  S M      P+ WI +DP++ V+ +V+      QA+ M+    R+   ++ 
Sbjct:   16 YKLTHQVVCINNVNFQRKCVIGYVELTICPMVTSLNRIKLNSKQCRIYRVRVNDLEAAFIYNDPTLEICHHESKQRNLNYFSNTYAAAVTAVDPDAGNGELCIKVPSELWKQVDELKSLKVYIEFSLDQPKGGLHFVVPNVEGSMAERGAHLFSYGYQNSSRFWFPCVDSYSELCTWKLEFTVD-ASMVAVSNGDLVEVEYTHDMRKKTFRYTLTIPTAAPNISLAVGPFEVLVDPYMHEVTHFCLPQLLPLLKHTTAYLHEVFEFYEEILTCRYPYSCFKTVFVDEAYIEVASYASMSIFSTNLLHSSMIIDQTPVTRRYLAHSLAQQFFGCFISRMSWSDEWVLKGISGYIYGLWMKKTFGV---NQYRHWIKDELDTIVAYELKTGGVLLHPIFSSGKEKDNPASYLHFSIKHPHTLSWEYYNMFQCKAHLVMRLIENRISMEFMLQVFNKLLSLASTASSQKFQSHMWSQMLVSTSGFLKSISNVSGKDIQPLIKQWVDQSGVVKFYGSFAFNRKRNVLELEIKQDYTSLGTQKYVGPIKVTVQELDGSFNHTLQIEENSLKHDIPCHSKSRRNKKKKIPLMNGEEVDMDLSAMDADS--PLLWIRIDPDMSVLRKVEF----EQADFMWQYQLRYERDVVA 651          
BLAST of transcription initiation factor TFIID subunit 2 vs. Ensembl Xenopus
Match: TAF2 (uncharacterized loc100125055 [Source:Xenbase;Acc:XB-GENE-5962512])

HSP 1 Score: 115.931 bits (289), Expect = 1.183e-25
Identity = 133/646 (20.59%), Postives = 253/646 (39.16%), Query Frame = 3
Query:   30 YKIKRQDLSIENIDFSKQSFEGITKFFIFPLECDFKSILLNCNGPIIKKIIFN---------------------------LENSSTDGFNAIYDRFNDDIISIYIPNELISAVYKLEPFFLLIYFSSQGNQCGLQFFI----SSTGSKTDYMYMAPYNNCSGSSFPCIE-FGQSCEWFIEIASPCGSMTVICSGCLKFID------DNNYLFHIERPTTACKISFAVGQFEYFHDPDNPRFQYYFPASFNQYVKFYIDILIKALKFLQSNVKFGYPFGIYKSVFVDFLLDEFYTASSLTLFNINLLLQYGESHKLFQPNHVLIAGFCEQYFGAYVETAQWKDSWICWGFAEYMAWEMLNEFFPIERSDESIYEIMEKMNHLVEYEYRNGGILLDASFSKSENFD-------FDPFNPRKMPIRYKRFYRIKSGLVFRSWTLCISFVGLCDVIRYYLKHEHFVDEKILESY-----------YLGNWTN--------LIEGTVKRRGHIDIIAKAHYLKERKNIELIVYQGRNIL-SFLYSGDMECDIRESGEVVSRIVELSPKVFNH-------IEIGLCLKVSLLK-TDYKLLTSRMGETKGPPIGWINLDPNLMVIGRVQVLLDESQAELMFHDDNRFTGKLIG 1748
            YK+  Q + I N++F ++   G  +  I P+      I LN     I ++  N                             N+      A+     +  + I +P+EL   V +L+   + I FS    + GL F +     S   +  +++   Y N S   FPC++ + + C W +E      SM  + +G L  ++         + + +  PT A  IS AVG FE   DP      ++        +K     L +  +F +  +   YP+  +K+VFVD    E  + +S+++F+ NLL       +       L     +Q+FG ++    W D W+  G + Y+    + + F +   ++  + I ++++ +V YE + GG+LL   FS  +  D       F   +P  +   Y   ++ K+ LV R     IS   +  V    L        +  +S+           +L + +N        LI+  V + G +       + ++R  +EL + Q    L +  Y G ++  ++E     +  +++      H              K+ L+   +  +  S M      P+ WI +DP++ V+ +V+      QA+ M+    R+   ++ 
Sbjct:   16 YKLTHQVVCINNVNFQRKCVIGYVELTICPMVTSLNRIKLNSKQCRIYRVRVNDLEAAFIYNDPTLEICHHESKQRNLNYFSNTYAAAVTAVDPDAGNGELCIKVPSELWKQVDELKSLKVYIEFSLDQPKGGLHFVVPNVEGSMAERGAHLFSYGYQNSSRFWFPCVDSYSELCTWKLEFTVD-ASMVAVSNGDLVEVEYTHDMRKKTFRYTLTIPTAAPNISLAVGPFEVLVDPYMHEVTHFCLPQLLPLLKHTTAYLHEVFEFYEEILTCRYPYSCFKTVFVDEAYIEVASYASMSIFSTNLLHSSMIIDQTPVTRRYLAHSLAQQFFGCFISRMSWSDEWVLKGISGYIYGLWMKKTFGV---NQYRHWIKDELDTIVAYELKTGGVLLHPIFSSGKEKDNPASYLHFSIKHPHTLSWEYYNMFQCKAHLVMRLIENRISMEFMLQVFNKLLSLASTASSQKFQSHMWSQMLVSTSGFLKSISNVSGKDIQPLIKQWVDQSGVVKFYGSFAFNRKRNVLELEIKQDYTSLGTQKYVGPIKVTVQELDGSFNHTLQIEENSLKHDIPCHSKSRRNKKKKIPLMNGEEVDMDLSAMDADS--PLLWIRIDPDMSVLRKVEF----EQADFMWQYQLRYERDVVA 651          
BLAST of transcription initiation factor TFIID subunit 2 vs. Ensembl Xenopus
Match: TAF2 (uncharacterized loc100125055 [Source:Xenbase;Acc:XB-GENE-5962512])

HSP 1 Score: 115.546 bits (288), Expect = 1.597e-25
Identity = 133/646 (20.59%), Postives = 253/646 (39.16%), Query Frame = 3
Query:   30 YKIKRQDLSIENIDFSKQSFEGITKFFIFPLECDFKSILLNCNGPIIKKIIFN---------------------------LENSSTDGFNAIYDRFNDDIISIYIPNELISAVYKLEPFFLLIYFSSQGNQCGLQFFI----SSTGSKTDYMYMAPYNNCSGSSFPCIE-FGQSCEWFIEIASPCGSMTVICSGCLKFID------DNNYLFHIERPTTACKISFAVGQFEYFHDPDNPRFQYYFPASFNQYVKFYIDILIKALKFLQSNVKFGYPFGIYKSVFVDFLLDEFYTASSLTLFNINLLLQYGESHKLFQPNHVLIAGFCEQYFGAYVETAQWKDSWICWGFAEYMAWEMLNEFFPIERSDESIYEIMEKMNHLVEYEYRNGGILLDASFSKSENFD-------FDPFNPRKMPIRYKRFYRIKSGLVFRSWTLCISFVGLCDVIRYYLKHEHFVDEKILESY-----------YLGNWTN--------LIEGTVKRRGHIDIIAKAHYLKERKNIELIVYQGRNIL-SFLYSGDMECDIRESGEVVSRIVELSPKVFNH-------IEIGLCLKVSLLK-TDYKLLTSRMGETKGPPIGWINLDPNLMVIGRVQVLLDESQAELMFHDDNRFTGKLIG 1748
            YK+  Q + I N++F ++   G  +  I P+      I LN     I ++  N                             N+      A+     +  + I +P+EL   V +L+   + I FS    + GL F +     S   +  +++   Y N S   FPC++ + + C W +E      SM  + +G L  ++         + + +  PT A  IS AVG FE   DP      ++        +K     L +  +F +  +   YP+  +K+VFVD    E  + +S+++F+ NLL       +       L     +Q+FG ++    W D W+  G + Y+    + + F +   ++  + I ++++ +V YE + GG+LL   FS  +  D       F   +P  +   Y   ++ K+ LV R     IS   +  V    L        +  +S+           +L + +N        LI+  V + G +       + ++R  +EL + Q    L +  Y G ++  ++E     +  +++      H              K+ L+   +  +  S M      P+ WI +DP++ V+ +V+      QA+ M+    R+   ++ 
Sbjct:   16 YKLTHQVVCINNVNFQRKCVIGYVELTICPMVTSLNRIKLNSKQCRIYRVRVNDLEAAFIYNDPTLEICHHESKQRNLNYFSNTYAAAVTAVDPDAGNGELCIKVPSELWKQVDELKSLKVYIEFSLDQPKGGLHFVVPNVEGSMAERGAHLFSYGYQNSSRFWFPCVDSYSELCTWKLEFTVD-ASMVAVSNGDLVEVEYTHDMRKKTFRYTLTIPTAAPNISLAVGPFEVLVDPYMHEVTHFCLPQLLPLLKHTTAYLHEVFEFYEEILTCRYPYSCFKTVFVDEAYIEVASYASMSIFSTNLLHSSMIIDQTPVTRRYLAHSLAQQFFGCFISRMSWSDEWVLKGISGYIYGLWMKKTFGV---NQYRHWIKDELDTIVAYELKTGGVLLHPIFSSGKEKDNPASYLHFSIKHPHTLSWEYYNMFQCKAHLVMRLIENRISMEFMLQVFNKLLSLASTASSQKFQSHMWSQMLVSTSGFLKSISNVSGKDIQPLIKQWVDQSGVVKFYGSFAFNRKRNVLELEIKQDYTSLGTQKYVGPIKVTVQELDGSFNHTLQIEENSLKHDIPCHSKSRRNKKKKIPLMNGEEVDMDLSAMDADS--PLLWIRIDPDMSVLRKVEF----EQADFMWQYQLRYERDVVA 651          
BLAST of transcription initiation factor TFIID subunit 2 vs. Ensembl Xenopus
Match: TAF2 (uncharacterized loc100125055 [Source:Xenbase;Acc:XB-GENE-5962512])

HSP 1 Score: 115.546 bits (288), Expect = 1.761e-25
Identity = 133/646 (20.59%), Postives = 253/646 (39.16%), Query Frame = 3
Query:   30 YKIKRQDLSIENIDFSKQSFEGITKFFIFPLECDFKSILLNCNGPIIKKIIFN---------------------------LENSSTDGFNAIYDRFNDDIISIYIPNELISAVYKLEPFFLLIYFSSQGNQCGLQFFI----SSTGSKTDYMYMAPYNNCSGSSFPCIE-FGQSCEWFIEIASPCGSMTVICSGCLKFID------DNNYLFHIERPTTACKISFAVGQFEYFHDPDNPRFQYYFPASFNQYVKFYIDILIKALKFLQSNVKFGYPFGIYKSVFVDFLLDEFYTASSLTLFNINLLLQYGESHKLFQPNHVLIAGFCEQYFGAYVETAQWKDSWICWGFAEYMAWEMLNEFFPIERSDESIYEIMEKMNHLVEYEYRNGGILLDASFSKSENFD-------FDPFNPRKMPIRYKRFYRIKSGLVFRSWTLCISFVGLCDVIRYYLKHEHFVDEKILESY-----------YLGNWTN--------LIEGTVKRRGHIDIIAKAHYLKERKNIELIVYQGRNIL-SFLYSGDMECDIRESGEVVSRIVELSPKVFNH-------IEIGLCLKVSLLK-TDYKLLTSRMGETKGPPIGWINLDPNLMVIGRVQVLLDESQAELMFHDDNRFTGKLIG 1748
            YK+  Q + I N++F ++   G  +  I P+      I LN     I ++  N                             N+      A+     +  + I +P+EL   V +L+   + I FS    + GL F +     S   +  +++   Y N S   FPC++ + + C W +E      SM  + +G L  ++         + + +  PT A  IS AVG FE   DP      ++        +K     L +  +F +  +   YP+  +K+VFVD    E  + +S+++F+ NLL       +       L     +Q+FG ++    W D W+  G + Y+    + + F +   ++  + I ++++ +V YE + GG+LL   FS  +  D       F   +P  +   Y   ++ K+ LV R     IS   +  V    L        +  +S+           +L + +N        LI+  V + G +       + ++R  +EL + Q    L +  Y G ++  ++E     +  +++      H              K+ L+   +  +  S M      P+ WI +DP++ V+ +V+      QA+ M+    R+   ++ 
Sbjct:   16 YKLTHQVVCINNVNFQRKCVIGYVELTICPMVTSLNRIKLNSKQCRIYRVRVNDLEAAFIYNDPTLEICHHESKQRNLNYFSNTYAAAVTAVDPDAGNGELCIKVPSELWKQVDELKSLKVYIEFSLDQPKGGLHFVVPNVEGSMAERGAHLFSYGYQNSSRFWFPCVDSYSELCTWKLEFTVD-ASMVAVSNGDLVEVEYTHDMRKKTFRYTLTIPTAAPNISLAVGPFEVLVDPYMHEVTHFCLPQLLPLLKHTTAYLHEVFEFYEEILTCRYPYSCFKTVFVDEAYIEVASYASMSIFSTNLLHSSMIIDQTPVTRRYLAHSLAQQFFGCFISRMSWSDEWVLKGISGYIYGLWMKKTFGV---NQYRHWIKDELDTIVAYELKTGGVLLHPIFSSGKEKDNPASYLHFSIKHPHTLSWEYYNMFQCKAHLVMRLIENRISMEFMLQVFNKLLSLASTASSQKFQSHMWSQMLVSTSGFLKSISNVSGKDIQPLIKQWVDQSGVVKFYGSFAFNRKRNVLELEIKQDYTSLGTQKYVGPIKVTVQELDGSFNHTLQIEENSLKHDIPCHSKSRRNKKKKIPLMNGEEVDMDLSAMDADS--PLLWIRIDPDMSVLRKVEF----EQADFMWQYQLRYERDVVA 651          
BLAST of transcription initiation factor TFIID subunit 2 vs. Ensembl Xenopus
Match: TAF2 (uncharacterized loc100125055 [Source:Xenbase;Acc:XB-GENE-5962512])

HSP 1 Score: 98.9821 bits (245), Expect = 2.233e-20
Identity = 131/646 (20.28%), Postives = 248/646 (38.39%), Query Frame = 3
Query:   30 YKIKRQDLSIENIDFSKQSFEGITKFFIFPLECDFKSILLNCNGPIIKKIIFN---------------------------LENSSTDGFNAIYDRFNDDIISIYIPNELISAVYKLEPFFLLIYFSSQGNQCGLQFFI----SSTGSKTDYMYMAPYNNCSGSSFPCIE-FGQSCEWFIEIASPCGSMTVICSGCLKFID------DNNYLFHIERPTTACKISFAVGQFEYFHDPDNPRFQYYFPASFNQYVKFYIDILIKALKFLQSNVKFGYPFGIYKSVFVDFLLDEFYTASSLTLFNINLLLQYGESHKLFQPNHVLIAGFCEQYFGAYVETAQWKDSWICWGFAEYMAWEMLNEFFPIERSDESIYEIMEKMNHLVEYEYRNGGILLDASFSKSENFD-------FDPFNPRKMPIRYKRFYRIKSGLVFRSWTLCISFVGLCDVIRYYLKHEHFVDEKILESY-----------YLGNWTN--------LIEGTVKRRGHIDIIAKAHYLKERKNIELIVYQGRNIL-SFLYSGDMECDIRESGEVVSRIVELSPKVFNH-------IEIGLCLKVSLLK-TDYKLLTSRMGETKGPPIGWINLDPNLMVIGRVQVLLDESQAELMFHDDNRFTGKLIG 1748
            YK+  Q + I N++F ++   G  +  I P+      I LN     I ++  N                             N+      A+     +  + I +P+EL   V +L+   + I FS    + GL F +     S   +  +++   Y N S   FPC++ + + C W +E      SM  + +G L  ++         + + +  PT A  IS AVG FE   DP      ++        +K     L +  +F +  +   YP+  +K+VFVD    E  + +S+++F + L        K  +P      G  E  +        W D W+  G + Y+    + + F +   ++  + I ++++ +V YE + GG+LL   FS  +  D       F   +P  +   Y   ++ K+ LV R     IS   +  V    L        +  +S+           +L + +N        LI+  V + G +       + ++R  +EL + Q    L +  Y G ++  ++E     +  +++      H              K+ L+   +  +  S M      P+ WI +DP++ V+ +V+      QA+ M+    R+   ++ 
Sbjct:   16 YKLTHQVVCINNVNFQRKCVIGYVELTICPMVTSLNRIKLNSKQCRIYRVRVNDLEAAFIYNDPTLEICHHESKQRNLNYFSNTYAAAVTAVDPDAGNGELCIKVPSELWKQVDELKSLKVYIEFSLDQPKGGLHFVVPNVEGSMAERGAHLFSYGYQNSSRFWFPCVDSYSELCTWKLEFTVD-ASMVAVSNGDLVEVEYTHDMRKKTFRYTLTIPTAAPNISLAVGPFEVLVDPYMHEVTHFCLPQLLPLLKHTTAYLHEVFEFYEEILTCRYPYSCFKTVFVDEAYIEVASYASMSIFRLYL--------KQNKP------GASEYVYKYVAVILLWSDEWVLKGISGYIYGLWMKKTFGV---NQYRHWIKDELDTIVAYELKTGGVLLHPIFSSGKEKDNPASYLHFSIKHPHTLSWEYYNMFQCKAHLVMRLIENRISMEFMLQVFNKLLSLASTASSQKFQSHMWSQMLVSTSGFLKSISNVSGKDIQPLIKQWVDQSGVVKFYGSFAFNRKRNVLELEIKQDYTSLGTQKYVGPIKVTVQELDGSFNHTLQIEENSLKHDIPCHSKSRRNKKKKIPLMNGEEVDMDLSAMDADS--PLLWIRIDPDMSVLRKVEF----EQADFMWQYQLRYERDVVA 637          
BLAST of transcription initiation factor TFIID subunit 2 vs. Ensembl Mouse
Match: Taf2 (TATA-box binding protein associated factor 2 [Source:MGI Symbol;Acc:MGI:2443028])

HSP 1 Score: 132.494 bits (332), Expect = 8.747e-31
Identity = 152/746 (20.38%), Postives = 301/746 (40.35%), Query Frame = 3
Query:   30 YKIKRQDLSIENIDFSKQSFEGITKFFIFPLECDFKSILLNCNGPIIKKIIFN---------------------------LENSSTDGFNAIYDRFNDDIISIYIPNELISAVYKLEPFFLLIYFSSQGNQCGLQFFISST----GSKTDYMYMAPYNNCSGSSFPCIE-FGQSCEWFIEIASPCGSMTVICSGCLKFI---DDNNYLFH--IERPTTACKISFAVGQFEYFHDPDNPRFQYYFPASFNQYVKFYIDILIKALKFLQSNVKFGYPFGIYKSVFVDFLLDEFYTASSLTLFNINLLLQYGESHKLFQPNHVLIAGFCEQYFGAYVETAQWKDSWICWGFAEYMAWEMLNEFFPIERSDESIYEIMEKMNHLVEYEYRNGGILLDASFSKSENFD-------FDPFNPRKMPIRYKRFYRIKSGLVFRSWTLCISFVGLCDVIRYYLK----------HEHFVDEKILESY-YLGNWTN--------LIEGTVKRRGHIDIIAKAHYLKERKNIELIVYQG-RNILSFLYSGDMECDIRESGEVVSRIVELSPKVFNH-------IEIGLCLKVSLLK-TDYKLLTSRMGETKGPPIGWINLDPNLMVIGRVQVLLDESQAELMFHDDNRFTGKLIGLQ----GMRKNKSVDHLGSLMKLVADRKLFPRIRIEA---ITQLKNALCDPSVKFPKDSLKNLLVNIYCEKDDVNPVLKRNFWKTFGDYIVHLALVEAVSV 2030
            YK+  Q + I NI+F ++S  G  +  IFP   +   I LN     I ++  N                             N+     +A+     +  + I +P+EL   V +L+   + I FS    + GL F + S       +  +++   Y N +   FPC++ + + C W +E       + V     ++ +   D     FH  +  PT A  IS A+G FE   DP      ++        +K     + +  +F +  +   YP+  +K+VF+D    E    +S+++F+ NLL       +       L     +Q+FG ++    W D W+  G + Y+    + + F +   +E  + I E+++ +V YE + GG+LL   F   +  D       F   +P  +   Y   ++ K+ LV R     IS   +  V    L             H   + ++ +Y +L + +N        LI+  V + G +       + ++R  +EL + Q   +  +  Y G ++  ++E     +  +++      H              K+ L+   +  +  S M      P+ WI +DP++ V+ +V+      QA+ M+  + R+   ++  Q     + K  +     +L  ++   + F R+R+ A   + ++ N++       P  ++K+L   ++C K   N ++K N + +F  Y +   +  A+++
Sbjct:   26 YKLTHQVVCINNINFQRKSVVGFVELTIFPTVANLNRIKLNSKQCRIYRVRINDLEAAFIYNDPTLEVCHSESKQRNLNYFSNAYAAAVSAVDPDAGNGELCIKVPSELWKHVDELKVLKIHINFSLDQPKGGLHFVVPSVEGSMAERGAHVFSCGYQNSTRFWFPCVDSYSELCTWKLEFTVDAAMVAVSNGDLVETVYTHDMRKKTFHYMLTIPTAASNISLAIGPFEILVDPYMHEVTHFCLPQLLPLLKHTTSYIHEVFEFYEEILTCRYPYSCFKTVFIDEAYVEVAAYASMSIFSTNLLHSAMIIDETPLTRRCLAQALAQQFFGCFISRMSWSDEWVLKGISGYIYGLWMKKTFGV---NEYHHWIKEELDKIVAYELKTGGVLLHPIFGGGKEKDNPASHLHFSIKHPHTLSWEYYTMFQCKAHLVMRLIENRISMEFMLQVFNKLLSLASTASSQKFQSHMWSQMLVSTYGFLKSISNVSGKDIQPLIKQWVDQSGVVKFYGSFAFNRKRNVLELEIKQDYTSPGTQKYVGPLKVTVQELDGSFNHTLQIEENSLKHDIPCHSKSRRNKKKKIPLMNGEEVDMDLSAMDADS--PLLWIRIDPDMSVLRKVEF----EQADFMWQYELRYERDVVAQQESILALEKFPTPASRLALTDILEQEQCFYRVRMSACFCLAKIANSMVSTWTGPP--AMKSLFTRMFCCKTCPN-IVKTNNFMSFQSYFLQKTMPVAMAL 759          
BLAST of transcription initiation factor TFIID subunit 2 vs. UniProt/SwissProt
Match: sp|Q24325|TAF2_DROME (Transcription initiation factor TFIID subunit 2 OS=Drosophila melanogaster OX=7227 GN=Taf2 PE=1 SV=2)

HSP 1 Score: 125.561 bits (314), Expect = 8.780e-28
Identity = 101/398 (25.38%), Postives = 169/398 (42.46%), Query Frame = 3
Query:   30 YKIKRQDLSIENIDFSKQSFEGITKFFIFPLECDFKSILLNCNGPIIKKIIFN-------------------------LENSSTDGFNAIY---DRFNDDIISIYIPNELISAVYKLEPFFLLIYFSSQGNQCGLQFFI--SSTGSKTD----YMYMAPYNNCSGSSFPCIE-FGQSCEWFIEIASPCGSMTVICSGCLKFI---DDNNYLFH--IERPTTACKISFAVGQFEYFHDPDNPRFQYYFPASFNQYVKFYIDILIKALKFLQSNVKFGYPFGIYKSVFVDFLLDEFYTASSLTLFNINLLLQYGESHKLFQPNHVLIAGFCEQYFGAYVETAQWKDSWICWGFAEYMAWEMLNEFFPIERSDESIYEIMEKMNHLVEYEYRNGGILLDAS 1103
            +K+  Q +S+  I F ++S  G+ +  I P   + + I LN     I  ++ N                         LE  S     A        N+  + I +P E  S + + +   + I FS +  +CG+ F I  +ST  +T     +M+   Y N S   FPC++ F   C W +E         V C   L+ I   D     FH  +  P  A  I+ AVGQFE + DP      ++        +K  +  L +A +F +  +   YPF  YK VFVD L  +    +++++ ++NLL       + +     +     EQ+FG ++ +  W D+W+  G AEY+      + F    ++E    +  ++  +V YE + GGI+LD S
Sbjct:   15 FKLAHQVVSLTGISFERRSIIGVVELTIVPNSENLRLIRLNAKQLRIYSVVLNDVCQADFTYFDPFQNICYKEHKSRALEVYSKHHLTAAQYTDPDVNNGELLIQVPPEGYSMIQEGQGLRIRIEFSLENPKCGVHFVIPPASTDEETQMNSSHMFTNCYENSSRLWFPCVDSFADPCTWRLEFTVDKNMTAVSCGELLEVIMTPDLRKKTFHYSVSTPVCAPNIALAVGQFEIYVDPHMHEVTHFCLPGLLPLLKNTVRYLHEAFEFYEETLSTRYPFSCYKQVFVDELDTDISAYATMSIASVNLLHSIAIIDQTYISRTFMSRAVAEQFFGCFITSHHWSDTWLAKGIAEYLCGLYSRKCF---GNNEYRAWVQSELARVVRYEEQYGGIILDCS 409          
BLAST of transcription initiation factor TFIID subunit 2 vs. UniProt/SwissProt
Match: sp|Q8C176|TAF2_MOUSE (Transcription initiation factor TFIID subunit 2 OS=Mus musculus OX=10090 GN=Taf2 PE=2 SV=2)

HSP 1 Score: 120.939 bits (302), Expect = 1.910e-26
Identity = 131/646 (20.28%), Postives = 256/646 (39.63%), Query Frame = 3
Query:   30 YKIKRQDLSIENIDFSKQSFEGITKFFIFPLECDFKSILLNCNGPIIKKIIFN---------------------------LENSSTDGFNAIYDRFNDDIISIYIPNELISAVYKLEPFFLLIYFSSQGNQCGLQFFISST----GSKTDYMYMAPYNNCSGSSFPCIE-FGQSCEWFIEIASPCGSMTVICSGCLKFI---DDNNYLFH--IERPTTACKISFAVGQFEYFHDPDNPRFQYYFPASFNQYVKFYIDILIKALKFLQSNVKFGYPFGIYKSVFVDFLLDEFYTASSLTLFNINLLLQYGESHKLFQPNHVLIAGFCEQYFGAYVETAQWKDSWICWGFAEYMAWEMLNEFFPIERSDESIYEIMEKMNHLVEYEYRNGGILLDASF-------SKSENFDFDPFNPRKMPIRYKRFYRIKSGLVFRSWTLCISFVGLCDVIRYYLK----------HEHFVDEKILESY-YLGNWTN--------LIEGTVKRRGHIDIIAKAHYLKERKNIELIVYQG-RNILSFLYSGDMECDIRESGEVVSRIVELSPKVFNH-------IEIGLCLKVSLLKTDYKLLTSRMGETKGPPIGWINLDPNLMVIGRVQVLLDESQAELMFHDDNRFTGKLIGLQ 1754
            YK+  Q + I NI+F ++S  G  +  IFP   +   I LN     I ++  N                             N+     +A+     +  + I +P+EL   V +L+   + I FS    + GL F + S       +  +++   Y N +   FPC++ + + C W +E       + V     ++ +   D     FH  +  PT A  IS A+G FE   DP      ++        +K     + +  +F +  +   YP+  +K+VF+D    E    +S+++F+ NLL       +       L     +Q+FG ++    W D W+  G + Y+    + + F +   +E  + I E+++ +V YE + GG+LL   F       + + +  F   +P  +   Y   ++ K+ LV R     IS   +  V    L             H   + ++ +Y +L + +N        LI+  + + G +       + ++R  +EL + Q   +  +  Y G ++  ++E     +  +++      H              K+ L+  +   +     E    P+ WI +DP++ V+ +V+      QA+ M+  + R+   ++  Q
Sbjct:   16 YKLTHQVVCINNINFQRKSVVGFVELTIFPTVANLNRIKLNSKQCRIYRVRINDLEAAFIYNDPTLEVCHSESKQRNLNYFSNAYAAAVSAVDPDAGNGELCIKVPSELWKHVDELKVLKIHINFSLDQPKGGLHFVVPSVEGSMAERGAHVFSCGYQNSTRFWFPCVDSYSELCTWKLEFTVDAAMVAVSNGDLVETVYTHDMRKKTFHYMLTIPTAASNISLAIGPFEILVDPYMHEVTHFCLPQLLPLLKHTTSYIHEVFEFYEEILTCRYPYSCFKTVFIDEAYVEVAAYASMSIFSTNLLHSAMIIDETPLTRRCLAQALAQQFFGCFISRMSWSDEWVLKGISGYIYGLWMKKTFGV---NEYHHWIKEELDKIVAYELKTGGVLLHPIFGGGKEKDNPASHLHFSIKHPHTLSWEYYTMFQCKAHLVMRLIENRISMEFMLQVFNKLLSLASTASSQKFQSHMWSQMLVSTYGFLKSISNVSGKDIQPLIKQWLDQSGVVKFYGSFAFNRKRNVLELEIKQDYTSPGTQKYVGPLKVTVQELDGSFNHTLQIEENSLKHDIPCHSKSRRNKKKKIPLMNGEEVDMDLSAMEADS-PLLWIRIDPDMSVLRKVEF----EQADFMWQYELRYERDVVAQQ 653          
BLAST of transcription initiation factor TFIID subunit 2 vs. UniProt/SwissProt
Match: sp|Q32PW3|TAF2_DANRE (Transcription initiation factor TFIID subunit 2 OS=Danio rerio OX=7955 GN=taf2 PE=2 SV=2)

HSP 1 Score: 119.398 bits (298), Expect = 6.516e-26
Identity = 99/436 (22.71%), Postives = 182/436 (41.74%), Query Frame = 3
Query:   30 YKIKRQDLSIENIDFSKQSFEGITKFFIFPLECDFKSILLNCNGPIIKKIIFN---------------------------LENSSTDGFNAIYDRFNDDIISIYIPNELISAVYKLEPFFLLIYFSSQGNQCGLQFFISST----GSKTDYMYMAPYNNCSGSSFPCIE-FGQSCEWFIEIASPCGSMTVICSGCLKFI-----DDNNYLFHIERPTTACKISFAVGQFEYFHDPDNPRFQYYFPASFNQYVKFYIDILIKALKFLQSNVKFGYPFGIYKSVFVDFLLDEFYTASSLTLFNINLLLQYGESHKLFQPNHVLIAGFCEQYFGAYVETAQWKDSWICWGFAEYMAWEMLNEFFPIERSDESIYEIMEKMNHLVEYEYRNGGILLDASFSKSENFD-------FDPFNPRKMPIRYKRFYRIKSGLVFR 1205
            YK+  Q + I N++F ++S  G  +  IFP   +   I LN     I ++  N                             ++ T   +A+     +  +SI +P+EL     +++   + I FS    + GL F +         +  +++     N S   FPC++ + + C W +E       + V C   ++ +         Y + +  PT A  IS AVG FE   DP      ++        +K  +  L +  +F +  +   YP+  +K+VFVD    +  + +S+++F+ NLL       +       L     +Q+FG ++    W D W+  G + Y+    L + F +   +E  + I E+++ +VEYE + GG+LL  +FS  +  D       F   +P  +   Y + ++ K+ LV R
Sbjct:   15 YKLTHQVVCINNVNFQRKSVIGYVELTIFPTVVNLNRIKLNSKQCRIYRVRVNDLEAPFIYNDPTLEVCHHESKQRNLNYFSSAYTAAVSAVDPDAGNGELSIKVPSELWKQGDEMKVMKVYIEFSLDQPKGGLHFVVPDVEGNMAERAAHVFSFGNQNSSRFWFPCVDSYSELCTWKLEFTVDASMVAVSCGDLVETVYTHDMRKKTYHYMLPIPTAAPNISMAVGPFEILVDPYMHEVTHFCLPQLLPLLKHTMSYLHEIFEFYEEILTCRYPYSCFKTVFVDEAYVQVSSYASMSIFSTNLLHSGLIIDQTPMTRSFLAQALAQQFFGCFISRMSWADEWVLKGISGYIYGLYLKKTFGV---NEYRHWIKEELDKIVEYELKIGGVLLHPTFSGGKEKDNPTPHLHFSIKHPHTLSWEYYKMFQCKAHLVMR 447          
BLAST of transcription initiation factor TFIID subunit 2 vs. UniProt/SwissProt
Match: sp|Q6P1X5|TAF2_HUMAN (Transcription initiation factor TFIID subunit 2 OS=Homo sapiens OX=9606 GN=TAF2 PE=1 SV=3)

HSP 1 Score: 118.242 bits (295), Expect = 1.299e-25
Identity = 133/647 (20.56%), Postives = 254/647 (39.26%), Query Frame = 3
Query:   30 YKIKRQDLSIENIDFSKQSFEGITKFFIFPLECDFKSILLNCNGPIIKKIIFN---------------------------LENSSTDGFNAIYDRFNDDIISIYIPNELISAVYKLEPFFLLIYFSSQGNQCGLQFFISST----GSKTDYMYMAPYNNCSGSSFPCIE-FGQSCEWFIEIASPCGSMTVICSGCLKFI---DDNNYLFH--IERPTTACKISFAVGQFEYFHDPDNPRFQYYFPASFNQYVKFYIDILIKALKFLQSNVKFGYPFGIYKSVFVDFLLDEFYTASSLTLFNINLLLQYGESHKLFQPNHVLIAGFCEQYFGAYVETAQWKDSWICWGFAEYMAWEMLNEFFPIERSDESIYEIMEKMNHLVEYEYRNGGILLDASF-------SKSENFDFDPFNPRKMPIRYKRFYRIKSGLVFRSWTLCISFVGLCDVIRYYLKHEHFVDEKILESY-----------YLGNWTN--------LIEGTVKRRGHIDIIAKAHYLKERKNIELIVYQG-RNILSFLYSGDMECDIRESGEVVSRIVELSPKVFNH-------IEIGLCLKVSLLK-TDYKLLTSRMGETKGPPIGWINLDPNLMVIGRVQVLLDESQAELMFHDDNRFTGKLIGLQ 1754
            YK+  Q + I NI+F ++S  G  +  IFP   +   I LN     I ++  N                             N+     +A+     +  + I +P+EL   V +L+   + I FS    + GL F + S       +  +++   Y N +   FPC++ + + C W +E       + V     ++ +   D     FH  +  PT A  IS A+G FE   DP      ++        +K     L +  +F +  +   YP+  +K+VF+D    E    +S+++F+ NLL       +       L     +Q+FG ++    W D W+  G + Y+    + + F +   +E  + I E+++ +V YE + GG+LL   F       + + +  F   +P  +   Y   ++ K+ LV R     IS   +  V    L        +  +S+           +L + +N        LI+  V + G +       + ++R  +EL + Q   +  +  Y G ++  ++E     +  +++      H              K+ L+   +  +  S M      P+ WI +DP++ V+ +V+      QA+ M+    R+   ++  Q
Sbjct:   26 YKLTHQVVCINNINFQRKSVVGFVELTIFPTVANLNRIKLNSKQCRIYRVRINDLEAAFIYNDPTLEVCHSESKQRNLNYFSNAYAAAVSAVDPDAGNGELCIKVPSELWKHVDELKVLKIHINFSLDQPKGGLHFVVPSVEGSMAERGAHVFSCGYQNSTRFWFPCVDSYSELCTWKLEFTVDAAMVAVSNGDLVETVYTHDMRKKTFHYMLTIPTAASNISLAIGPFEILVDPYMHEVTHFCLPQLLPLLKHTTSYLHEVFEFYEEILTCRYPYSCFKTVFIDEAYVEVAAYASMSIFSTNLLHSAMIIDETPLTRRCLAQSLAQQFFGCFISRMSWSDEWVLKGISGYIYGLWMKKTFGV---NEYRHWIKEELDKIVAYELKTGGVLLHPIFGGGKEKDNPASHLHFSIKHPHTLSWEYYSMFQCKAHLVMRLIENRISMEFMLQVFNKLLSLASTASSQKFQSHMWSQMLVSTSGFLKSISNVSGKDIQPLIKQWVDQSGVVKFYGSFAFNRKRNVLELEIKQDYTSPGTQKYVGPLKVTVQELDGSFNHTLQIEENSLKHDIPCHSKSRRNKKKKIPLMNGEEVDMDLSAMDADS--PLLWIRIDPDMSVLRKVEF----EQADFMWQYQLRYERDVVAQQ 663          
BLAST of transcription initiation factor TFIID subunit 2 vs. UniProt/SwissProt
Match: sp|Q5ZIT8|TAF2_CHICK (Transcription initiation factor TFIID subunit 2 OS=Gallus gallus OX=9031 GN=TAF2 PE=2 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 3.589e-25
Identity = 97/436 (22.25%), Postives = 178/436 (40.83%), Query Frame = 3
Query:   30 YKIKRQDLSIENIDFSKQSFEGITKFFIFPLECDFKSILLNCNGPIIKKIIFN---------------------------LENSSTDGFNAIYDRFNDDIISIYIPNELISAVYKLEPFFLLIYFSSQGNQCGLQFFI----SSTGSKTDYMYMAPYNNCSGSSFPCIE-FGQSCEWFIEIASPCGSMTVICSGCLKFI---DDNNYLFH--IERPTTACKISFAVGQFEYFHDPDNPRFQYYFPASFNQYVKFYIDILIKALKFLQSNVKFGYPFGIYKSVFVDFLLDEFYTASSLTLFNINLLLQYGESHKLFQPNHVLIAGFCEQYFGAYVETAQWKDSWICWGFAEYMAWEMLNEFFPIERSDESIYEIMEKMNHLVEYEYRNGGILLDASF-------SKSENFDFDPFNPRKMPIRYKRFYRIKSGLVFR 1205
            YK+  Q + I NI+F ++S  G  +  IFP   +   I LN     I ++  N                             N+     +A+     +  + I +P+EL   V +L+   + I FS    + GL F +     S   +  +++   Y N +   FPC++ + + C W +E       + V     ++ +   D     FH  +  PT A  IS A+G FE   DP      ++        +K     L +  +F +  +   YP+  +K+VF+D    E    +S+++F+ NLL       +       L     +Q+FG ++    W D W+  G + Y+    + + F +   +E  + I ++++ +V YE + GG+LL   F       + + +  F   +P  +   Y   ++ K+ LV R
Sbjct:   16 YKLTHQVVCINNINFQRKSVVGYVELTIFPTVANLNRIKLNSKQCRIYRVRVNDLEAAFIYNDPTLEVCHHESKQRNLNYFSNAYAAAVSAVDPDAGNGELCIKVPSELWKHVDELKVLKVHINFSLDQPKGGLHFVVPNMEGSMAERGAHVFSCGYQNSTRFWFPCVDSYSELCTWKLEYTVDAAMVAVSNGDLVETVYTHDMRKKTFHYMLAIPTAASNISLAIGPFEILVDPYMHEVTHFCLPQLLPLLKHTTSYLHEVFEFYEEILTCRYPYSCFKTVFIDEAYVEVAAYASMSIFSTNLLHSAMIIDETPLTRRCLAQALAQQFFGCFISRMSWSDEWVLKGISGYIYGLWMKKTFGV---NEYRHWIKQELDQIVAYELKTGGVLLHPIFGGGKEKDNPASHLHFSIKHPHTLSWEYYTMFQCKAHLVMR 448          
BLAST of transcription initiation factor TFIID subunit 2 vs. TrEMBL
Match: A0A0N7ZC01 (Peptidase_M1 domain-containing protein OS=Scylla olivacea OX=85551 PE=4 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 2.034e-32
Identity = 147/708 (20.76%), Postives = 280/708 (39.55%), Query Frame = 3
Query:   27 SYKIKRQDLSIENIDFSKQSFEGITKFFIFPLECDFKSILLNCNGPIIKKIIFN----------------------------LENSSTDGFNAIYDRFNDDIISIYIPNELISAVYKLEPFFLLIYFSSQGNQCGLQFFISST----GSKTDYMYMAPYNNCSGSSFPCIE-FGQSCEWFIEIASPCGSMTVICSGCLKFI---DDNNYLFH--IERPTTACKISFAVGQFEYFHDPDNPRFQYYFPASFNQYVKFYIDILIKALKFLQSNVKFGYPFGIYKSVFVDFLLDEFYTASSLTLFNINLLLQYGESHKLFQPNHVLIAGFCEQYFGAYVETAQWKDSWICWGFAEYMAWEMLNEFFPIERSDESIYEIMEKMNHLVEYEYRNGGILLDASFSKSE-----------------NFDFDPFNPRKMPIRYKRFYRIKSGLVFRSWTLCISFVGLCDVIRYYLKHEHFVDEKILESYYLGNWTNLIEGT----------------------VKRRGHIDIIAKAHYLKERKNIELIVYQG--RNILSFLYSGDMECDIRESGEVVSRIVELSPKVFNHIEIGLCLKVSLLKTDYKLLTSRMGET------KGPPIGWINLDPNLMVIGRVQVLLDESQAELMFHDDNRFTGKLIGLQGMRK-----NKSVDHLGSLMKLVADRKLFPRIRIEA---ITQLKNAL 1871
            SYK+  Q LS+  I+F++Q+  G T+  + P +  F+ I LNC    + ++  N                               S T G  ++        + I +P+E    + + +P  + + FS +  Q GL F + ST    G K  +++   + N +   FPCI+ + + C W +E         V C   ++ +   D     FH  +  PT A  I+ AVG FE + DP      ++        +K     L +  +F +  +   YP+  YK V+VD    + ++ +++++ ++NLL       +++Q    +     +Q+FG ++    W D+W+  G A Y+    + + F     +E    I  ++  ++EYE R GGI+LD S S +E                  F F   NP      Y   Y  K+ LV R     I   G   +++ + KH       +    +   W++++  T                      V++ GH     K  + ++R  +E+ + QG    +    Y G +   I+E        +++  +V     +         K    L T    +          P+ W+ LDP++ ++  V+V   ++Q +     +   T +   +  + +       + +   +L  ++ + + F +IR  A   +TQ+ NA+
Sbjct:   10 SYKLSHQILSLTGINFTRQTVIGFTELTLIPSKDSFRYIWLNCKQCCVYRVTLNDSLEVQFQYFDPFLEVCPQESKQRNLEYFNKSQTTGAFSVDPEIGRGELVIIVPSEAQHMIQEGKPLRVGVEFSLEKPQSGLHFVVPSTEGTLGEKAAHLFTYGHENSARLWFPCIDTWSEVCTWRLEFTVDDFMTAVSCGDLVEVVYTQDMRRKTFHYCLTTPTCAPNIALAVGPFEIYVDPFMNEITHFCLPQLLPLMKATSKYLHEGFEFYEELLSTRYPYSCYKQVYVDEAYSDLHSYATMSILDVNLLCSNRIIDQVYQTRKTMALCVAQQFFGCFLSRQAWSDAWLTTGIAHYLMSLYVKKHFGF---NEYKGWIHSELQEIIEYEERFGGIVLDPSSSPNEPQNGPNVPASTNSSNKDTFYFSVKNPHACSPHYISVYYKKAHLVIRMLEFRI---GQELMMQVFNKHLSLALIAVANKGHPAGWSHMLISTETFTKAIFTVTGKDITVFCDQWVRQGGHAKFNMKFLFNRKRNIVEMTIEQGYIGELGIRRYVGPLVVWIQELDGTFKHTLQIEHQVSKKEIVCHSKSRRNKKKKIPLCTGEEVDMDLSHLDADSPVLWLRLDPDMTMMRAVEVEQPDNQWQYQLRHERDVTAQTEAINALHRLAKQGAVTTEMRNTLNAVLENEQCFYKIRCRAARCLTQVANAM 711          
BLAST of transcription initiation factor TFIID subunit 2 vs. TrEMBL
Match: A0A0P4WF88 (Peptidase_M1 domain-containing protein OS=Scylla olivacea OX=85551 PE=4 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 2.154e-32
Identity = 147/708 (20.76%), Postives = 280/708 (39.55%), Query Frame = 3
Query:   27 SYKIKRQDLSIENIDFSKQSFEGITKFFIFPLECDFKSILLNCNGPIIKKIIFN----------------------------LENSSTDGFNAIYDRFNDDIISIYIPNELISAVYKLEPFFLLIYFSSQGNQCGLQFFISST----GSKTDYMYMAPYNNCSGSSFPCIE-FGQSCEWFIEIASPCGSMTVICSGCLKFI---DDNNYLFH--IERPTTACKISFAVGQFEYFHDPDNPRFQYYFPASFNQYVKFYIDILIKALKFLQSNVKFGYPFGIYKSVFVDFLLDEFYTASSLTLFNINLLLQYGESHKLFQPNHVLIAGFCEQYFGAYVETAQWKDSWICWGFAEYMAWEMLNEFFPIERSDESIYEIMEKMNHLVEYEYRNGGILLDASFSKSE-----------------NFDFDPFNPRKMPIRYKRFYRIKSGLVFRSWTLCISFVGLCDVIRYYLKHEHFVDEKILESYYLGNWTNLIEGT----------------------VKRRGHIDIIAKAHYLKERKNIELIVYQG--RNILSFLYSGDMECDIRESGEVVSRIVELSPKVFNHIEIGLCLKVSLLKTDYKLLTSRMGET------KGPPIGWINLDPNLMVIGRVQVLLDESQAELMFHDDNRFTGKLIGLQGMRK-----NKSVDHLGSLMKLVADRKLFPRIRIEA---ITQLKNAL 1871
            SYK+  Q LS+  I+F++Q+  G T+  + P +  F+ I LNC    + ++  N                               S T G  ++        + I +P+E    + + +P  + + FS +  Q GL F + ST    G K  +++   + N +   FPCI+ + + C W +E         V C   ++ +   D     FH  +  PT A  I+ AVG FE + DP      ++        +K     L +  +F +  +   YP+  YK V+VD    + ++ +++++ ++NLL       +++Q    +     +Q+FG ++    W D+W+  G A Y+    + + F     +E    I  ++  ++EYE R GGI+LD S S +E                  F F   NP      Y   Y  K+ LV R     I   G   +++ + KH       +    +   W++++  T                      V++ GH     K  + ++R  +E+ + QG    +    Y G +   I+E        +++  +V     +         K    L T    +          P+ W+ LDP++ ++  V+V   ++Q +     +   T +   +  + +       + +   +L  ++ + + F +IR  A   +TQ+ NA+
Sbjct:   10 SYKLSHQILSLTGINFTRQTVIGFTELTLIPSKDSFRYIWLNCKQCCVYRVTLNDSLEVQFQYFDPFLEVCPQESKQRNLEYFNKSQTTGAFSVDPEIGRGELVIIVPSEAQHMIQEGKPLRVGVEFSLEKPQSGLHFVVPSTEGTLGEKAAHLFTYGHENSARLWFPCIDTWSEVCTWRLEFTVDDFMTAVSCGDLVEVVYTQDMRRKTFHYCLTTPTCAPNIALAVGPFEIYVDPFMNEITHFCLPQLLPLMKATSKYLHEGFEFYEELLSTRYPYSCYKQVYVDEAYSDLHSYATMSILDVNLLCSNRIIDQVYQTRKTMALCVAQQFFGCFLSRQAWSDAWLTTGIAHYLMSLYVKKHFGF---NEYKGWIHSELQEIIEYEERFGGIVLDPSSSPNEPQNGPNVPASTNSSNKDTFYFSVKNPHACSPHYISVYYKKAHLVIRMLEFRI---GQELMMQVFNKHLSLALIAVANKGHPAGWSHMLISTETFTKAIFTVTGKDITVFCDQWVRQGGHAKFNMKFLFNRKRNIVEMTIEQGYIGELGIRRYVGPLVVWIQELDGTFKHTLQIEHQVSKKEIVCHSKSRRNKKKKIPLCTGEEVDMDLSHLDADSPVLWLRLDPDMTMMRAVEVEQPDNQWQYQLRHERDVTAQTEAINALHRLAKQGAVTTEMRNTLNAVLENEQCFYKIRCRAARCLTQVANAM 711          
BLAST of transcription initiation factor TFIID subunit 2 vs. TrEMBL
Match: V4BCU4 (Peptidase_M1 domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_228096 PE=4 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 3.039e-32
Identity = 116/479 (24.22%), Postives = 204/479 (42.59%), Query Frame = 3
Query:   30 YKIKRQDLSIENIDFSKQSFEGITKFFIFPLECDFKSILLN----------------------------CNGPIIKKIIFNLENSSTDGFNAI-YDRFNDDIISIYIPNELISAVYKLEPFFLLIYFSSQGNQCGLQFFI----SSTGSKTDYMYMAPYNNCSGSSFPCIE-FGQSCEWFIEI-------ASPCGSM-TVICSGCLKFIDDNNYLFHIERPTTACKISFAVGQFEYFHDPDNPRFQYYFPASFNQYVKFYIDILIKALKFLQSNVKFGYPFGIYKSVFVDFLLDEFYTASSLTLFNINLLLQYGESHKLFQPNHVLIAGFCEQYFGAYVETAQWKDSWICWGFAEYMAWEMLNEFFPIERSDESIYEIMEKMNHLVEYEYRNGGILLDASFSKSENFDFDPFNPRKMPIRYKRFYRIKSGLVFRSWTLCISFVGLCDVIRYYLKHEHFVDEKILESYYLGNWTNLIEGT 1340
            YK+  Q + +  ++F K+S  G     I PL  D K + +N                            C G   ++ +   +N      NA+  D  N ++ +I +P E I  + +L PF + I +S +  + G+ F +         +  +M+   + N S   FPCI+ F + C W IEI       A  CG +  V+ S CL       + ++I  P +A  I+ AVG FE   DP+     ++     +  +K     + +A +F +  +   YP+  YK VFVD    +    +++T+F+ NLL       + F   + +     +Q+FG ++    W D+W+  G A Y++   +   F    ++E  YEI + +  + +YE + GGI+LD +  K  N  +   NP  +   Y   +  K+ LV R     I    +   +   L   +   +   + +   NWTN++  T
Sbjct:   13 YKLSHQKICLTGVNFEKRSVIGYVDLTIHPLRPDLKRVKVNFKQGCIYRICINDQWEAAFLYNDPTQEICQGDAKQRNLDFFQNCHLSAMNAVDADNVNGEV-TIKMPPETIPLIAELRPFRICIEYSLENPKGGIHFVVPDINDDMADRGAHMFSYGHENSSRLWFPCIDTFCEPCTWKIEITCHRDMTAVSCGDLIEVVYSPCLM---KKTFHYYISTPVSAPNIAIAVGPFEILVDPNMHEVTHFCLPHLSGILKHTTGYIHEAFEFYEELLSSRYPYSYYKQVFVDESYADVSVYATMTIFSTNLLHSSRIIDQTFHTRNFMAQAVAQQFFGTFISMDGWSDAWLPKGIAGYLSTLFIKRTF---GNNEFRYEINKILKEVADYENKVGGIVLDPT-KKESNVHYSTKNPHTISPMYAEMFYKKATLVIRILEHRIGTELILQALNKLLSLAYTASQ---QKFLNNNWTNMLLST 480          
BLAST of transcription initiation factor TFIID subunit 2 vs. TrEMBL
Match: K1PN07 (Transcription initiation factor TFIID subunit 2 OS=Crassostrea gigas OX=29159 GN=CGI_10006397 PE=4 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 2.730e-31
Identity = 107/433 (24.71%), Postives = 184/433 (42.49%), Query Frame = 3
Query:   21 SMSYKIKRQDLSIENIDFSKQSFEGITKFFIFPLECDFKSILLN----------------------------CNGPIIKKIIFNLENSSTDGFNAIYDRFNDDIISIYIPNELISAVYKLEPFFLLIYFSSQGNQCGLQFFISS----TGSKTDYMYMAPYNNCSGSSFPCIE-FGQSCEWFIEIASPCGSMTVICSGCLKFI---DDNNYLFH--IERPTTACKISFAVGQFEYFHDPDNPRFQYYFPASFNQYVKFYIDILIKALKFLQSNVKFGYPFGIYKSVFVDFLLDEFYTASSLTLFNINLLLQYGESHKLFQPNHVLIAGFCEQYFGAYVETAQWKDSWICWGFAEYMAWEMLNEFFPIERSDESIYEIMEKMNHLVEYEYRNGGILLDASFSKSENFDFDPFNPRKMPIRYKRFYRIKSGLVFR 1205
            S  YK+  Q L I  I+  K+S  G  +  I PL  D K + +N                            C G   ++ +   ++      +A+     +  I++ +P E+   + +L PF L I FS +  + GL F +            +++ A  NNCS   FPC++ + + C W IE+        V C   ++ I   D     FH  +  PT+A  I  AVG FE   DP+     ++      + +K   + + +A +F +  +   YP+  YK VFVD    E  + +++++ + NLL       +      VL     +Q+FG ++    W D+W+  G + Y+    + + F    ++E  + I   +  + +YE R GGI+LD +  +  N  F   +P  +  RY   +R K  LV R
Sbjct:   10 SRPYKLAHQTLCIRAINLEKKSLIGYVELVIHPLRQDLKRVKINSKQCRIYHVSINDQYEAKFLYNDPTLEICQGDAKQRNLDYFQHCHFSAMSAVDPDNGNGEITVRLPPEMYLNIAELRPFRLCIEFSLENPKGGLHFVVPDLPGPAHENAAHVFTAGLNNCSRLWFPCLDTYSEPCTWKIEVTVDNELTAVTCGDLIEVISTPDKKRKTFHYFLSIPTSAPNIGMAVGPFEIHVDPNMHEVTHFCLPHLTEILKHTTNYIHQAFEFYEELLSSRYPYTCYKHVFVDEAYVESTSYATMSVLSTNLLHSNRIIDQTISTRTVLAEAVAKQFFGTFIAMQTWSDAWLPMGISGYLCGLFIKKTF---GNNEYRFRISNYLKDVQDYENRVGGIVLDPT-KRDSNHHFSIKSPHTVSPRYMEAFRSKCFLVMR 438          
BLAST of transcription initiation factor TFIID subunit 2 vs. TrEMBL
Match: A0A1Z5L4C4 (Peptidase_M1 domain-containing protein (Fragment) OS=Ornithodoros moubata OX=6938 PE=4 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 2.214e-30
Identity = 142/664 (21.39%), Postives = 259/664 (39.01%), Query Frame = 3
Query:   30 YKIKRQDLSIENIDFSKQSFEGITKFFIFPLECDFKSILLNC--------------------NGPIIKKIIFNLENSSTDGFNAIYDR--------FNDDIISIYIPNELISAVYKLEPFFLLIYFSSQGNQCGLQFFI----SSTGSKTDYMYMAPYNNCSGSSFPCIE-FGQSCEWFIE-------IASPCGSM--TVICSGCLKFIDDNNYLFHIERPTTACKISFAVGQFEYFHDPDNPRFQYYFPASFNQYVKFYIDILIKALKFLQSNVKFGYPFGIYKSVFVDFLLDEFYTASSLTLFNINLLLQYGESHKLFQPNHVLIAGFCEQYFGAYVETAQWKDSWICWGFAEYMAWEMLNEFFPIERSDESIYEIMEKMNHLVEYEYRNGGILLDASFSKSENFDFDPFNPRKMPIRYKRFYRIKSGLVFRSWTLCISFVGLCDVIRYYLKHEHFVDEKILESYYLGNWTNLIEGT----------------------VKRRGHIDIIAKAHYLKERKNIELIVYQGRNILSFL--YSGDMECDIRESGEVVSRIVELSPKVFNH-------------IEIGLC------LKVSLLKTDYKLLTSRMGETKGPPIGWINLDPNLMVIGRVQVLLDESQAELMFHDDNRFTGKLIGLQGMRK 1766
            YK+  Q L I +I+F +QS  G  +  + P   D + I +NC                    N P ++    + +  + D F+A +            +  ++I IP E    V + +   + + +S +  Q G+ F +     S   +  +M+   Y N S   FPCI+ +   C W +E       IA  CG +  TV  S   K      + +H+  PT+A  I+ AVG FE F DP      ++        +K   + L +A +F +  +   YP+  YK VFV          +++T+ ++NLL       + +    ++     EQ+FG ++    W D+W+  G + Y+A +   + F    ++E  Y I + M  ++ YE   GGILLD S  +S  F F   N   M  RY      K+ LV R   +    +G   +++ + K          +      W N++  T                      V++ GH        + ++R  +EL + Q     + +  Y G +   I+E        +++      H              +I LC      + +S +  D              P+ WI +DP+++++ +V     + Q +     +   T ++  ++ + +
Sbjct:   17 YKLSHQVLCITSINFQRQSLIGFVELTLIPTRNDVRWIRINCKQSRVYRVRINDQVEAPYQYNDPTLEICQGDAKQRNLDNFSACHSAAVASVSPVLGNGELTITIPPEASHMVQEGKLLRVSVEYSLERPQGGIHFVVPDSEGSLAERGAHMFTYGYENSSRLWFPCIDSYADPCTWKMEFTVDSTMIAVSCGDLVETVYTSDMRK----KTFHYHLTTPTSAPNIALAVGPFEVFVDPQMHEVTHFCLPHLLPLLKQCSNFLHEAFEFYEELLSSRYPYSCYKQVFVAEAYVPVDPYATMTILSVNLLHSKHIIDEAYMSRKLMARAVAEQFFGCFISMHTWADTWLPKGISAYLAGQYNKKAF---GNNEYRYWIQQDMKKVIAYEQEFGGILLDPSHLESSPFHFPLDNLHTMSPRYTEMISTKAHLVIR---MLEDRIGRELLLQVFNKLLSLASSAAQQKVTTNMWHNMLLSTSSFQKAIFIVTGKDIKIFLEQWVRQGGHSKFHGTFVFNRKRNTVELEIKQTETQATGIKCYVGPLTVTIQELDGTFEHHLQIEENSTKHDITCHSKSRRNKKKKIPLCTGEEVDMDLSAMDADS-------------PVLWIRVDPDMLLLRQVIFEQPDYQWQYQLRYERDVTSQMEAIEALER 657          
BLAST of transcription initiation factor TFIID subunit 2 vs. Ensembl Cavefish
Match: taf2 (TATA-box binding protein associated factor 2 [Source:NCBI gene;Acc:103035672])

HSP 1 Score: 114.775 bits (286), Expect = 1.647e-25
Identity = 100/436 (22.94%), Postives = 186/436 (42.66%), Query Frame = 3
Query:   30 YKIKRQDLSIENIDFSKQSFEGITKFFIFPLECDFKSILLNCNGPIIKKIIFN---------------------------LENSSTDGFNAIYDRFNDDIISIYIPNELISAVYKLEPFFLLIYFSSQGNQCGLQFFIS----STGSKTDYMYMAPYNNCSGSSFPCIE-FGQSCEWFIEIASPCGSMTVICSGCLKFI---DDNNYLFH--IERPTTACKISFAVGQFEYFHDPDNPRFQYYFPASFNQYVKFYIDILIKALKFLQSNVKFGYPFGIYKSVFVDFLLDEFYTASSLTLFNINLLLQYGESHKLFQPNHVLIAGFCEQYFGAYVETAQWKDSWICWGFAEYMAWEMLNEFFPIERSDESIYEIMEKMNHLVEYEYRNGGILLDASFS-------KSENFDFDPFNPRKMPIRYKRFYRIKSGLVFR 1205
            YK+  Q + I NI+F ++S  G  +  IFP   +   I LN     I ++  N                             ++ T   +A+     +  +SI +P+EL     +++   + I FS    + GL F +     S   +  +++   Y N +   FPC++ + + C W +E       + V C   ++ +   D     FH  +  PT A  IS AVG FE   DP      ++        +K  +  L +  +F +  +   YP+  +K+VFVD    E  +++S+++F+ N+L       +       L     +Q+FG ++    W D W+  G + Y+    L + F +   +E  + I E+++ +V+YE + GG+LL  +F+        + +  F   +P  +   Y + ++ K+ LV R
Sbjct:   15 YKLTHQVVCINNINFQRKSVIGFVELTIFPTVVNLNRIKLNSKQCRIYRVRVNDLEAPFIYNDPTLEVCHHESKQRNLNYFSSAYTAAVSAVDPDAGNGELSIKVPSELWKQGDEMKVLKVYIEFSLDQPKGGLHFVVPDVEGSMAERGAHVFSFGYQNSTRFWFPCVDSYSELCTWKLEFTVDASMVAVSCGDLVETVYTHDMRKKTFHYMLPIPTAAPNISMAVGPFEILVDPYMHEVTHFCLPQLLPLLKHSMSFLHEIFEFYEEILTCRYPYSCFKTVFVDEAYMEVSSSASMSIFSTNMLHSGMIIDQTPMTRRCLAQALAQQFFGCFISRMSWSDEWVLKGISGYIYGLYLKKTFGV---NEYRHWIKEELDRIVDYELKMGGVLLHPTFTGGKEKENPTPHLHFSIKHPHTLSWEYYKMFQCKAHLVMR 447          
BLAST of transcription initiation factor TFIID subunit 2 vs. Ensembl Cavefish
Match: taf2 (TATA-box binding protein associated factor 2 [Source:NCBI gene;Acc:103035672])

HSP 1 Score: 103.605 bits (257), Expect = 5.040e-22
Identity = 116/559 (20.75%), Postives = 233/559 (41.68%), Query Frame = 3
Query:  204 TDGFNAIYDRFNDDIISIYIPNELISAVYKLEPFFLLIYFSSQGNQCGLQFFI----SSTGSKTDYMYMAPYNNCSGSSFPCIE-FGQSCEWFIEIASPCGSMTVICSGCLKFI---DDNNYLFH--IERPTTACKISFAVGQFEYFHDPDNPRFQYYFPASFNQYVKFYIDILIKALKFLQSNVKFGYPFGIYKSVFVDFLLDEFYTASSLTLFNINLLLQYGESHKLFQPNHVLIAGFCEQYFGAYVETAQWKDSWICWGFAEYMAWEMLNEFFPIERSDESIYEIMEKMNHLVEYEYRNGGILLDASFS-------KSENFDFDPFNPRKMPIRYKRFYRIKSGLVFRSWTLCISFVGLCDVIRYYLK----------HEHFVDEKILE-SYYLGNWTN--------LIEGTVKRRGHIDIIAKAHYLKERKNIELIVYQG-RNILSFLYSGDMECDIRESGEVVSRIVELSPKVFNH-------IEIGLCLKVSLLKTDYKLLTSRMGETKGPPIGWINLDPNLMVIGRVQVLLDESQAELMFHDDNRFTGKLIG 1748
            T   +A+     +  +SI +P+EL     +++   + I FS    + GL F +     S   +  +++   Y N +   FPC++ + + C W +E       + V C   ++ +   D     FH  +  PT A  IS AVG FE   DP      ++        +K  +  L +  +F +  +   YP+  +K+VFVD    E  +++S+++F+ N+L       +       L     +Q+FG ++    W D W+  G + Y+    L + F +   +E  + I E+++ +V+YE + GG+LL  +F+        + +  F   +P  +   Y + ++ K+ LV R     IS   +  V    L             H   + +L  S +L + +N        LI+  V + G +       + ++R  +EL + Q   +  +  Y G ++  ++E     +  +++      H              K+ L+  + ++           P+ WI +DP++ ++ +V+      QA+ M+    R+   ++ 
Sbjct:   67 TAAVSAVDPDAGNGELSIKVPSELWKQGDEMKVLKVYIEFSLDQPKGGLHFVVPDVEGSMAERGAHVFSFGYQNSTRFWFPCVDSYSELCTWKLEFTVDASMVAVSCGDLVETVYTHDMRKKTFHYMLPIPTAAPNISMAVGPFEILVDPYMHEVTHFCLPQLLPLLKHSMSFLHEIFEFYEEILTCRYPYSCFKTVFVDEAYMEVSSSASMSIFSTNMLHSGMIIDQTPMTRRCLAQALAQQFFGCFISRMSWSDEWVLKGISGYIYGLYLKKTFGV---NEYRHWIKEELDRIVDYELKMGGVLLHPTFTGGKEKENPTPHLHFSIKHPHTLSWEYYKMFQCKAHLVMRLIENRISMEFMLQVFNKLLSLANTASSQKYQSHMWSQMLLSTSGFLKSISNVSGKDIGPLIKQWVDQSGVVKFFGSFAFNRKRNVLELEIRQDYTSSGTQKYVGPIKVTVQELDGSFNHTLQIEENSLKHDIPCHSKSRRNKKKKIPLMNGE-EIDMDLSAMDSDSPLLWIRIDPDMAILRKVEF----EQADFMWQYQLRYERDVVA 617          
BLAST of transcription initiation factor TFIID subunit 2 vs. Ensembl Sea Lamprey
Match: taf2 (TAF2 RNA polymerase II, TATA box binding protein (TBP)-associated factor [Source:NCBI gene;Acc:324486])

HSP 1 Score: 121.324 bits (303), Expect = 3.436e-28
Identity = 102/437 (23.34%), Postives = 181/437 (41.42%), Query Frame = 3
Query:   30 YKIKRQDLSIENIDFSKQSFEGITKFFIFPLECDFKSILLNCNGPIIKKIIFN---------------------------LENSSTDGFNAIYDRFNDDIISIYIPNELISAVYKLEPFFLLIYFSSQGNQCGLQFFIS----STGSKTDYMYMAPYNNCSGSSFPCIE-FGQSCEWFIEIASPCGSMTVICSGCL------KFIDDNNYLFHIERPTTACKISFAVGQFEYFHDPDNPRFQYYFPASFNQYVKFYIDILIKALKFLQSNVKFGYPFGIYKSVFVDFLLDEFYTASSLTLFNINLLLQYGESHKLFQPNHVLIAGFCEQYFGAYVETAQWKDSWICWGFAEYMAWEMLNEFFPIERSDESIYEIMEKMNHLVEYEYRNGGILLDASF-------SKSENFDFDPFNPRKMPIRYKRFYRIKSGLVFR 1205
            +K+  Q LSI NI+F K+S  G  +  +FP       I LNC    I ++  N                             N+      A+   + +  + I +P++L   V ++    + + F     + GLQF +     +   +  +++   + N S S FPCI+ + + C W +E      SM  + +G L        +    + + +  PT A  IS AVG FE   DP      ++        +K     L +  +F +  +   YP+  YK+VFVD    E  + +S+++F+ NLL       +       +     +Q+FG ++    W D W+  G + Y+    + + F    ++E  Y I + ++ + +YE + GGILL  +F       S + +  F    P  +   Y + Y+ K+ LV R
Sbjct:   29 FKLNHQVLSINNINFQKKSIIGHVELTLFPTTATLNKIRLNCKQCRIYRVRVNDKEAAFMYNDPTLEVCHQENKQRNLNFFSNAYAASVQAVEPDYGNGELLIKVPSDLREHVEEMRMLKVHVEFWMDNPKGGLQFVVPDLEGTLAERAAHVFSYGHQNASRSWFPCIDSYSELCMWKLEYTVD-ASMVAVSNGDLVETIYTHDMRRKTFHYQLTTPTAAPNISLAVGPFEILVDPFMHEVTHFCLPQLLPLLKQTTSFLHEIFEFYEEVLTCRYPYTCYKTVFVDQAYVEATSYASMSIFSTNLLHGATIIDQTPITRKRIAKALAQQFFGCFISRMSWTDDWVLKGISGYIYGLWIKKTF---GNNEYRYWIKKWLSRVTDYELQTGGILLHPTFPAGKEKESPTPHLHFSVCYPHTLSWEYYKLYQAKAHLVLR 461          
BLAST of transcription initiation factor TFIID subunit 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005578.1 (pep scaffold:Pmarinus_7.0:GL491533:415:5877:-1 gene:ENSPMAG00000005072.1 transcript:ENSPMAT00000005578.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.4261 bits (215), Expect = 2.963e-19
Identity = 67/265 (25.28%), Postives = 118/265 (44.53%), Query Frame = 3
Query:  345 GLQFFI----SSTGSKTDYMYMAPYNNCSGSSFPCIE-FGQSCEWFIEIASPCGSMTVICSGCL------KFIDDNNYLFHIERPTTACKISFAVGQFEYFHDPDNPRFQYYFPASFNQYVKFYIDILIKALKFLQSNVKFGYPFGIYKSVFVDFLLDEFYTASSLTLFNINLLLQYGESHKLFQPNHVLIAGFCEQYFGAYVETAQWKDSWICWGFAEYMAWEMLNEFFPIERSDESIYEIMEKMNHLVEYEYRNGGILLDASF 1106
            GLQF +     +   +  + +   + N S S FPCI+ + + C W +E      SM  + +G L        +    + + +  PT A  IS AVG FE   DP      ++        +K     L +  +F +  +   YP+  YK+VFVD    E  + +S+++F+ NLL       +       +     +Q+FG ++    W D W+  G + Y+    + + F    ++E  Y I + ++ + +YE + GGILL  +F
Sbjct:    4 GLQFLLPDLEGTLAERAAFFFSYGHQNASRSWFPCIDSYSELCMWKLEYTVD-ASMVAVSNGDLVETIYTHDMRRKTFHYQLTTPTAAPNISLAVGPFEILVDPFMHEVTHFCLPQLLPLLKQTTSFLHEIFEFYEEVLTCRYPYTCYKTVFVDQAYVEATSYASMSIFSTNLLHGATIIDQTPITRKRIAKALAQQFFGCFISRMSWTDDWVLKGISGYIYGLWIKKTF---GNNEYRYWIKKWLSRVTDYELQTGGILLHPTF 264          
BLAST of transcription initiation factor TFIID subunit 2 vs. Ensembl Nematostella
Match: EDO32839 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STW0])

HSP 1 Score: 124.405 bits (311), Expect = 6.489e-29
Identity = 100/390 (25.64%), Postives = 164/390 (42.05%), Query Frame = 3
Query:   45 QDLSIENIDFSKQSFEGITKFFIFPLECDFKSILLNCNGPIIKKII-------------FNLENSST----DGFNAIYDRF---NDDIIS------------IYIPNELISAVYKLEPFFLLIYFSSQGNQCGLQFFI----SSTGSKTDYMYMAPYNNCSGSSFPCIE-FGQSCEWFIEIASPCGSMTVICSGCLK---FIDDNNYLFH--IERPTTACKISFAVGQFEYFHDPDNPRFQYYFPASFNQYVKFYIDILIKALKFLQSNVKFGYPFGIYKSVFVDFLLDEFYTASSLTLFNINLLLQYGESHKLFQPNHVLIAGFCEQYFGAYVETAQWKDSWICWGFAEYMAWEMLNEFFPIERSDESIYEIMEKMNHLVEYEYRNGGI 1088
            Q L I +IDF ++   G  +  + PL  +   + LNC    I ++              F LE+S+     DG     D F     + +S            I IP E++S   + + F + I +S +    G+QF       +   +  +++   Y N S   FPC++ + + C W I+I      + V C   +     ID+    FH  +  PT+A  I+ AVG FE + DP  P    +        +K     L    +  + N+   YP+  YK VFVD         +S+++FN +LL       + F    VL     EQ+FG Y+    W D+W+C G A Y+    + + F    ++E  Y IM++   + +YE    G+
Sbjct:    2 QTLCITSIDFQRRCLFGFVELRVLPLTSNLNRLKLNCKQCRIMRVCIREEKKEDWYEAGFQLEDSNRPVCPDGKKRNLDYFLACQQNAVSSADPDYGGGELVIRIPKEVLSCAMERKQFRVSIEYSLEHPDSGIQFVTPKGDGTMAQRAAHLFTYTYANSSRLWFPCVDSYAEVCTWSIDITVDKDMVAVSCGELVDQVFTIDERRKTFHYALNIPTSAVNIAVAVGPFEIYVDPIMPEVTNFCLPGLLANLKHSTAFLHDVFEMYEENLSCRYPYTHYKQVFVDQAYSVKAAYASMSIFNTSLLHSSRIIDQTFITRRVLAQALAEQFFGCYICMQDWSDAWLCSGIAGYLYSLYVKKAFG---NNEYRYWIMKETESVCQYETDGPGL 388          
BLAST of transcription initiation factor TFIID subunit 2 vs. Ensembl Nematostella
Match: EDO26744 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TB73])

HSP 1 Score: 67.3958 bits (163), Expect = 1.709e-12
Identity = 39/131 (29.77%), Postives = 59/131 (45.04%), Query Frame = 3
Query:  582 ISFAVGQFEYFHDPDNPRFQYYFPASFNQYVKFYIDILIKALKFLQSNVKFGYPFGIYKSVFVDFLLDEFYTASSLTLFNINLLLQYGESHKLFQPNHVLIAGFCEQYFGAYVETAQWKDSWICWGFAEYM 974
            +S A+G FE + DP  P    +        +K     L    +  + N+   YP+  YK VFVD         +S+++FN +LL       + F    VL     EQ+FG Y+    W D+W+C G A Y+
Sbjct:   68 LSCAMGPFEIYVDPIMPEVTNFCLPGLLANLKHSTAFLHDVFEMYEENLSCRYPYTHYKQVFVDQAYSVKAAYASMSIFNTSLLHSSRIIDQTFITRRVLAQALAEQFFGCYICMQDWSDAWLCSGIAGYL 198          
BLAST of transcription initiation factor TFIID subunit 2 vs. Ensembl Medaka
Match: taf2 (TATA-box binding protein associated factor 2 [Source:NCBI gene;Acc:101170787])

HSP 1 Score: 133.265 bits (334), Expect = 4.377e-31
Identity = 156/747 (20.88%), Postives = 310/747 (41.50%), Query Frame = 3
Query:   30 YKIKRQDLSIENIDFSKQSFEGITKFFIFPLECDFKSILLNC-------------------NGPIIKKIIFNLENSSTDGFNAIY---------DRFNDDIISIYIPNELISAVYKLEPFFLLIYFSSQGNQCGLQFFI----SSTGSKTDYMYMAPYNNCSGSSFPCIE-FGQSCEWFIEIASPCGSMTVICSGCLKFIDDNNY---LFH--IERPTTACKISFAVGQFEYFHDPDNPRFQYYFPASFNQYVKFYIDILIKALKFLQSNVKFGYPFGIYKSVFVDFLLDEFYTASSLTLFNINLLLQYGESHKLFQPNHVLIAGFCEQYFGAYVETAQWKDSWICWGFAEYMAWEMLNEFFPIERSDESIYEIMEKMNHLVEYEYRNGGILLDASF-------SKSENFDFDPFNPRKMPIRYKRFYRIKSGLVFRSWTLCISFVGLCDVIRYYLK----------HEHFVDEKILESY-YLGNWTN--------LIEGTVKRRGHIDIIAKAHYLKERKNIELIVYQG-RNILSFLYSGDMECDIRESGEVVSRIVELSPKVFNH-------IEIGLCLKVSLLK-TDYKLLTSRMGETKGPPIGWINLDPNLMVIGRVQVLLDESQAELMFHDDNRFTGKLI----GLQGMRKNKSVDHLGSLMKLVADRKLFPRIRIEA---ITQLKNALCDPSVKFPKDSLKNLLVNIYCEKDDVNPVLKRNFWKTFGDYIVHLALVEAVSV 2030
            +K+  Q + I NI+F ++S  G  +  IFP   +   I LN                    N P ++      +  + + F++ Y         D  N +++ I +P+EL     +L    + I FS    + GL F +     S   +  +++   Y N +   FPC++ + + C W +E       + V C   ++ I  N+     FH  +  PT A  IS AVG FE   DP      ++        +K  +  L +  +F +  +   YP+  +K+VFVD    +  + +S+++F+ NLL       +       L     +Q+FG ++    W D W+  G + Y+    L + F +   +E  +   E+++ +VEYE + GG+LL  +F       S + +  F   +P  M   Y + ++ K+ LV R     IS   +  V    L             H   + +L +Y +L + +N        LI+  V + G +       + ++R  +EL + Q   +  +  Y G ++  ++E     +  +++      H              K+ L+   +  +  S M      P+ WI +DP++ ++ +V+      QA+ M+    R+   ++     +  + K  +     +L  ++   + F ++R+ A   + ++ N++       P  ++K+L   ++C K   N ++K N + +F  Y +   +  A+++
Sbjct:   15 FKLTHQVVCINNINFQRKSVIGFVELTIFPTVVNLNRIKLNSKQCRIYRVRVNDLEAPFIYNDPTLEVCHSESKQRNLNYFSSAYTAAVSAVDPDAGNGELV-IKVPSELWKQGDELNVLKVYIDFSLDQPKGGLHFVVPDVEGSMAERAAHVFSFGYQNSTRFWFPCVDSYSELCTWKLEFTVDASMVAVSCGDLVETIYTNDMRKKTFHYVLPIPTAAPNISLAVGPFEILVDPYMHEVTHFCLPQLLPLLKHSMSFLHEIFEFYEEILTCRYPYSCFKTVFVDEAYVQVSSYASMSIFSTNLLHSPMIIDQTPLTRRCLAQALAQQFFGCFISRMSWADEWVLKGISGYIYGLYLKKTFGV---NEYRHWFKEELDKIVEYELKMGGVLLHPTFTGCKDKDSPTPHLHFSIKHPHTMSWEYYKMFQCKAHLVMRLIENRISMEFMLQVFNKLLSLASTASSQKYQSHMWSQMLLSTYGFLKSISNVSGKDIGPLIKQWVDQSGVVKFFGSFAFNRKRNVLELEIRQDYTSSGTQKYVGPIKVTVQELDGSFNHTLQIEENSLKHDIPCHSKSRRNKKKKIPLMNGEEVDMDLSAMDADS--PLLWIRIDPDMSILRKVEF----EQADFMWQYQLRYERDVVAQEEAISALEKFPTPASRLALTDILEQEQCFYKVRMLACFCLAKIANSMVSTWQGPP--AMKSLFTRMFCCKSCPN-IVKTNNFISFQSYFLQKTMPVAMAL 748          
BLAST of transcription initiation factor TFIID subunit 2 vs. Ensembl Medaka
Match: taf2 (TATA-box binding protein associated factor 2 [Source:NCBI gene;Acc:101170787])

HSP 1 Score: 132.109 bits (331), Expect = 8.778e-31
Identity = 156/747 (20.88%), Postives = 310/747 (41.50%), Query Frame = 3
Query:   30 YKIKRQDLSIENIDFSKQSFEGITKFFIFPLECDFKSILLNC-------------------NGPIIKKIIFNLENSSTDGFNAIY---------DRFNDDIISIYIPNELISAVYKLEPFFLLIYFSSQGNQCGLQFFI----SSTGSKTDYMYMAPYNNCSGSSFPCIE-FGQSCEWFIEIASPCGSMTVICSGCLKFIDDNNY---LFH--IERPTTACKISFAVGQFEYFHDPDNPRFQYYFPASFNQYVKFYIDILIKALKFLQSNVKFGYPFGIYKSVFVDFLLDEFYTASSLTLFNINLLLQYGESHKLFQPNHVLIAGFCEQYFGAYVETAQWKDSWICWGFAEYMAWEMLNEFFPIERSDESIYEIMEKMNHLVEYEYRNGGILLDASF-------SKSENFDFDPFNPRKMPIRYKRFYRIKSGLVFRSWTLCISFVGLCDVIRYYLK----------HEHFVDEKILESY-YLGNWTN--------LIEGTVKRRGHIDIIAKAHYLKERKNIELIVYQG-RNILSFLYSGDMECDIRESGEVVSRIVELSPKVFNH-------IEIGLCLKVSLLK-TDYKLLTSRMGETKGPPIGWINLDPNLMVIGRVQVLLDESQAELMFHDDNRFTGKLI----GLQGMRKNKSVDHLGSLMKLVADRKLFPRIRIEA---ITQLKNALCDPSVKFPKDSLKNLLVNIYCEKDDVNPVLKRNFWKTFGDYIVHLALVEAVSV 2030
            +K+  Q + I NI+F ++S  G  +  IFP   +   I LN                    N P ++      +  + + F++ Y         D  N +++ I +P+EL     +L    + I FS    + GL F +     S   +  +++   Y N +   FPC++ + + C W +E       + V C   ++ I  N+     FH  +  PT A  IS AVG FE   DP      ++        +K  +  L +  +F +  +   YP+  +K+VFVD    +  + +S+++F+ NLL       +       L     +Q+FG ++    W D W+  G + Y+    L + F +   +E  +   E+++ +VEYE + GG+LL  +F       S + +  F   +P  M   Y + ++ K+ LV R     IS   +  V    L             H   + +L +Y +L + +N        LI+  V + G +       + ++R  +EL + Q   +  +  Y G ++  ++E     +  +++      H              K+ L+   +  +  S M      P+ WI +DP++ ++ +V+      QA+ M+    R+   ++     +  + K  +     +L  ++   + F ++R+ A   + ++ N++       P  ++K+L   ++C K   N ++K N + +F  Y +   +  A+++
Sbjct:   15 FKLTHQVVCINNINFQRKSVIGFVELTIFPTVVNLNRIKLNSKQCRIYRVRVNDLEAPFIYNDPTLEVCHSESKQRNLNYFSSAYTAAVSAVDPDAGNGELV-IKVPSELWKQGDELNVLKVYIDFSLDQPKGGLHFVVPDVEGSMAERAAHVFSFGYQNSTRFWFPCVDSYSELCTWKLEFTVDASMVAVSCGDLVETIYTNDMRKKTFHYVLPIPTAAPNISLAVGPFEILVDPYMHEVTHFCLPQLLPLLKHSMSFLHEIFEFYEEILTCRYPYSCFKTVFVDEAYVQVSSYASMSIFSTNLLHSPMIIDQTPLTRRCLAQALAQQFFGCFISRMSWADEWVLKGISGYIYGLYLKKTFGV---NEYRHWFKEELDKIVEYELKMGGVLLHPTFTGCKDKDSPTPHLHFSIKHPHTMSWEYYKMFQCKAHLVMRLIENRISMEFMLQVFNKLLSLASTASSQKYQSHMWSQMLLSTYGFLKSISNVSGKDIGPLIKQWVDQSGVVKFFGSFAFNRKRNVLELEIRQDYTSSGTQKYVGPIKVTVQELDGSFNHTLQIEENSLKHDIPCHSKSRRNKKKKIPLMNGEEVDMDLSAMDADS--PLLWIRIDPDMSILRKVEF----EQADFMWQYQLRYERDVVAQEEAISALEKFPTPASRLALTDILEQEQCFYKVRMLACFCLAKIANSMVSTWQGPP--AMKSLFTRMFCCKSCPN-IVKTNNFISFQSYFLQKTMPVAMAL 748          
BLAST of transcription initiation factor TFIID subunit 2 vs. Planmine SMEST
Match: SMESG000037189.1 (SMESG000037189.1)

HSP 1 Score: 1848.94 bits (4788), Expect = 0.000e+0
Identity = 914/936 (97.65%), Postives = 915/936 (97.76%), Query Frame = 3
Query:   24 MSYKIKRQDLSIENIDFSKQSFEGITKFFIFPLECDFKSILLNCNGPIIKKIIFNLENSSTDGFNAIYDRFNDDIISIYIPNELISAVYKLEPFFLLIYFSSQGNQCGLQFFISSTGSKTDYMYMAPYNNCSGSSFPCIEFGQSCEWFIEIASPCGSMTVICSGCLKFIDDNNYLFHIERPTTACKISFAVGQFEYFHDPDNPRFQYYFPASFNQYVKFYIDILIKALKFLQSNVKFGYPFGIYKSVFVDFLLDEFYTASSLTLFNINLLLQYGESHKLFQPNHVLIAGFCEQYFGAYVETAQWKDSWICWGFAEYMAWEMLNEFFPIERSDESIYEIMEKMNHLVEYEYRNGGILLDASFSKSENFDFDPFNPRKMPIRYKRFYRIKSGLVFRSWTLCISFVGLCDVIRYYLKHEHFVDEKILESYYLGNWTNLIEGTVKRRGHIDIIAKAHYLKERKNIELIVYQGRNILSFLYSGDMECDIRESGEVVSRIVELSPKVFNHIEIGLCLKVSLLKTDYKLLTSRMGETKGPPIGWINLDPNLMVIGRVQVLLDESQAELMFHDDNRFTGKLIGLQGMRKNKSVDHLGSLMKLVADRKLFPRIRIEAITQLKNALCDPSVKFPKDSLKNLLVNIYCEKDDVNPVLKRNFWKTFGDYIVHLALVEAVSVTYVPETGEKWSXXXXXXXXXXXXCGCATEKSVSYLRASVILAISVSFSQVSHSFISEENLDLFTDILNRQLIEEMSCASHNFCVTSAVLHAWAKLHEYQLIKDLPMSVYFSNFHDDNECVRLAGISALLSLTNQVYLAEEAIGEILNYLSKTEVPVTIRCKGVSLISDNLISLKYSQNVMGNLNKIFQERLSFIMSMISCTTPDCLKASILELVKIIENLKSPVTISNPESWGEILDHSTLDTETKEVNVVQYQPSKGDMNLSDDSD 2831
            MSYKIKRQDLSIENIDFSKQSFEGITKFFIFPLECDFKSILLNCNGPIIKKIIFNLENSSTDGFNAIYDRFNDDIISIYIPNELISAVYKLEPFFLLIYFSSQGNQCGLQFFISSTGSKTDYMYMAPYNNCSGSSFPCIEFGQSCEWFIEIASPCGSMTVICSGCLKFIDDNNYLFHIERPTTACKISFAVGQFEYFHDPDNPRFQYYFPASFNQYVKFYIDILIKALKFLQSNVKFGYPFGIYKSVFVDFLLDEFYTASSLTLFNINLLLQYGESHKLFQPNHVLIAGFCEQYFGAYVE AQWKDSWICWGFAEYMAWEMLNEFFPIERSDESIYEIMEKMNHLVEYEYRNGGILLDASFSKSENFDFDPFNPRKMPIRYKRFYRIKSGLVFRSWTLCISFVGLCDVIRYYLKHEHFVDEKILESYYLGNWTNLIEGTVKRRGHIDIIAKAHYLKERKNIELIVYQGRNILSFLYSGDMECDIRESGEVVSRIVELSPKVFNHIEI LCLKVSLLKTDYKLLTSRMGETKGPPIGWINLDPNLMVIGRVQVLLDESQAELMFHDDNRFTGKLIGLQGMRKNKSVDHLGSLMKLVADRKLFPRIRIEAITQLKNALCDPSVKFPKDSLKNLLVNIYCEKDDVNPVLKRNFWKTFGDYIVHLALVEAVSVTYVPETGEKWSELLLLFVEMLEFCGCATEKSVSYLRA                   EENLDLFTDILNRQLIEEMSCASHNFCVTSAVLHAWAKLHEYQLIKDLPMSVYFSNFHDDNECVRLAGISALLSLTNQVYLAEEAIGEILNYLSKTEVPVTIRCKGVSLI+DNLISLKYSQNVMGNLNKIFQERLSFIMSMISCTTPDCLKASILELVKIIENLKSPVTISNPESWGEILDHSTLDTETKEVNVVQYQPSKGDMNLSDDSD
Sbjct:    1 MSYKIKRQDLSIENIDFSKQSFEGITKFFIFPLECDFKSILLNCNGPIIKKIIFNLENSSTDGFNAIYDRFNDDIISIYIPNELISAVYKLEPFFLLIYFSSQGNQCGLQFFISSTGSKTDYMYMAPYNNCSGSSFPCIEFGQSCEWFIEIASPCGSMTVICSGCLKFIDDNNYLFHIERPTTACKISFAVGQFEYFHDPDNPRFQYYFPASFNQYVKFYIDILIKALKFLQSNVKFGYPFGIYKSVFVDFLLDEFYTASSLTLFNINLLLQYGESHKLFQPNHVLIAGFCEQYFGAYVEAAQWKDSWICWGFAEYMAWEMLNEFFPIERSDESIYEIMEKMNHLVEYEYRNGGILLDASFSKSENFDFDPFNPRKMPIRYKRFYRIKSGLVFRSWTLCISFVGLCDVIRYYLKHEHFVDEKILESYYLGNWTNLIEGTVKRRGHIDIIAKAHYLKERKNIELIVYQGRNILSFLYSGDMECDIRESGEVVSRIVELSPKVFNHIEIVLCLKVSLLKTDYKLLTSRMGETKGPPIGWINLDPNLMVIGRVQVLLDESQAELMFHDDNRFTGKLIGLQGMRKNKSVDHLGSLMKLVADRKLFPRIRIEAITQLKNALCDPSVKFPKDSLKNLLVNIYCEKDDVNPVLKRNFWKTFGDYIVHLALVEAVSVTYVPETGEKWSELLLLFVEMLEFCGCATEKSVSYLRA-------------------EENLDLFTDILNRQLIEEMSCASHNFCVTSAVLHAWAKLHEYQLIKDLPMSVYFSNFHDDNECVRLAGISALLSLTNQVYLAEEAIGEILNYLSKTEVPVTIRCKGVSLIADNLISLKYSQNVMGNLNKIFQERLSFIMSMISCTTPDCLKASILELVKIIENLKSPVTISNPESWGEILDHSTLDTETKEVNVVQYQPSKGDMNLSDDSD 917          
BLAST of transcription initiation factor TFIID subunit 2 vs. Planmine SMEST
Match: SMESG000037715.1 (SMESG000037715.1)

HSP 1 Score: 174.481 bits (441), Expect = 3.159e-44
Identity = 167/706 (23.65%), Postives = 294/706 (41.64%), Query Frame = 3
Query:   27 SYKIKRQDLSIENIDFSKQSFEGITKFFIFPLECDFKSILLNCNGPIIKKIIF------------NLENSSTDGFNAI-----YDRFNDD--------------------IISIYIPNELISAVYKLEPFFLLIYFSSQGNQCGLQFF----ISSTGSKTDYMYMAPYNNCSGSSFPCIEFGQSCEWFIEIASPCGSMTVICSGCLK----FIDDNNYLFH--IERPTTACKISFAVGQFEYFHDPDNPRFQYYFPASFNQYVKFYIDILIKALKFLQSNVKFGYPFGIYKSVFVDFLLDEFYTASSLTLFNINLLLQYGESHKLFQPNHVLIAGFCEQYFGAYVETAQWKDSWICWGFAEYMAWEMLNEFFPIERSDESIYEIMEKMNHLVEYEYRNGGILLDASFSKS-ENFDFDPFNPRKMPIRYKRFYRIKSGLVFRSWTLCISFVGLCDVIRYYLKHEHFVDEKILESYYL-----------------------------GNWTNLIEGTVKRRGHIDIIAKAHYLKERKNIELIVYQGRNILS--FLYSGDMECDIRESGEVVSRIVELSPKVF---NHIEIGLCLKVSLLKTDYKLLTSRMG---ETKGPPIG------WINLDPNLMVIGRVQVLLDESQAELMFHDDNRFTGKLIGLQGMRKNKSVDHLGSLMKLVADRKLFPRIRIEAITQLKNAL 1871
            +Y +  Q L I  IDF      G T+  I+PL+     I LN     I                 +L  S  D F AI     Y+ FN D                     +++ IP +  S + +L+P  L++ FS    + GL F       +  S  +Y++ +   N S   FPC++  + C W IEI +    M  I +G L       D +N ++H  +++P  A  I   VG+FE + DP      ++ P  F   +K  ++ + +  KF++  + F YPF +YK+VFVD   ++F++ +S+T+F++NLL       +      V+     EQ+FG +     W  +W+ WG + Y+    L     I   +E  + I ++M+ +V YE +NGGI+LD    K+  N+ F     +     Y   Y+ K+ L+ R   L +    +  V R  L       +  ++S Y                                 TN +E  V + GH+ I A+  + + R   EL V Q  + +   F Y+G +E   +E      + V +   V    + I + + L   + K   + +T   G   +   PP        WI LD N+ + G++ ++  +    L+   +     ++  ++ +   +   +L  L  +  + K+F + RI+A   +K+ +
Sbjct:    3 NYYVSNQTLCINKIDFDNNWICGHTEIVIWPLDPTMVRIHLNAKQIRIHSTQLCTLHNEISIMETDLAMSYHDPFMAISRKSDYNFFNLDNFIKMHISSAKRVDLEEGIGELTLQIPPDFWSYISELKPLKLIVEFSLYRPKAGLYFVKPNNNKNGNSNGNYLFTSTMGNMSRLWFPCVDCAEPCTWKIEI-TVNEDMVAISNGMLLDSVYTPDLHNKVYHYFLKQPVPASCIGMVVGEFEIYPDPLISHVTHFCPPKFMPLLKTTVEAMPQIFKFIEDKLNFNYPFDMYKTVFVDNAFEDFHSYASMTIFDLNLLHPNNMLDQSLITLKVMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGI---NEYKFNIKKEMDEVVNYEEQNGGIVLDPLECKTLPNYSFSLLFAQAANATYVAMYKKKAALIIRLLELKLGPSMILKVFRKLLLLAKMAQDTSVDSNYNLAAPVIDEHRTNLLLCAELLKYAVDLVSGSQITNFLEMWVNKPGHVRIQAEYQFNRRRNVAELSVKQFHHRIRGCFEYTGPIEVVTQEFEGFFQQKVRIDRPVNPSQSRIVVDIPLHTKVRKHRKRKVTLSNGAEVDVDLPPNDSDIPYLWIMLDINMTLFGKIDLIQPDRICLLILRHEQDALAQISAIETISAVRDASYLSILRDIAQNNKIFYQTRIQAAIGMKDIM 704          
BLAST of transcription initiation factor TFIID subunit 2 vs. Planmine SMEST
Match: SMESG000037715.1 (SMESG000037715.1)

HSP 1 Score: 169.088 bits (427), Expect = 1.217e-42
Identity = 141/595 (23.70%), Postives = 261/595 (43.87%), Query Frame = 3
Query:  249 ISIYIPNELISAVYKLEPFFLLIYFSSQGNQCGLQFF----ISSTGSKTDYMYMAPYNNCSGSSFPCIEFGQSCEWFIEIASPCGSMTVICSGCLK----FIDDNNYLFH--IERPTTACKISFAVGQFEYFHDPDNPRFQYYFPASFNQYVKFYIDILIKALKFLQSNVKFGYPFGIYKSVFVDFLLDEFYTASSLTLFNINLLLQYGESHKLFQPNHVLIAGFCEQYFGAYVETAQWKDSWICWGFAEYMAWEMLNEFFPIERSDESIYEIMEKMNHLVEYEYRNGGILLDASFSKS-ENFDFDPFNPRKMPIRYKRFYRIKSGLVFRSWTLCISFVGLCDVIRYYLKHEHFVDEKILESYYL-----------------------------GNWTNLIEGTVKRRGHIDIIAKAHYLKERKNIELIVYQGRNILS--FLYSGDMECDIRESGEVVSRIVELSPKV---FNHIEIGLCLKVSLLKTDYKLLTSRMG---ETKGPPIG------WINLDPNLMVIGRVQVLLDESQAELMFHDDNRFTGKLIGLQGMRKNKSVDHLGSLMKLVADRKLFPRIRIEAITQLKNAL 1871
            +++ IP +  S + +L+P  L++ FS    + GL F       +  S  +Y++ +   N S   FPC++  + C W IEI +    M  I +G L       D +N ++H  +++P  A  I   VG+FE + DP      ++ P  F   +K  ++ + +  KF++  + F YPF +YK+VFVD   ++F++ +S+T+F++NLL       +      V+     EQ+FG +     W  +W+ WG + Y+    L     I   +E  + I ++M+ +V YE +NGGI+LD    K+  N+ F     +     Y   Y+ K+ L+ R   L +    +  V R  L       +  ++S Y                                 TN +E  V + GH+ I A+  + + R   EL V Q  + +   F Y+G +E   +E      + V +   V    + I + + L   + K   + +T   G   +   PP        WI LD N+ + G++ ++  +    L+   +     ++  ++ +   +   +L  L  +  + K+F + RI+A   +K+ +
Sbjct:   77 LTLQIPPDFWSYISELKPLKLIVEFSLYRPKAGLYFVKPNNNKNGNSNGNYLFTSTMGNMSRLWFPCVDCAEPCTWKIEI-TVNEDMVAISNGMLLDSVYTPDLHNKVYHYFLKQPVPASCIGMVVGEFEIYPDPLISHVTHFCPPKFMPLLKTTVEAMPQIFKFIEDKLNFNYPFDMYKTVFVDNAFEDFHSYASMTIFDLNLLHPNNMLDQSLITLKVMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGI---NEYKFNIKKEMDEVVNYEEQNGGIVLDPLECKTLPNYSFSLLFAQAANATYVAMYKKKAALIIRLLELKLGPSMILKVFRKLLLLAKMAQDTSVDSNYNLAAPVIDEHRTNLLLCAELLKYAVDLVSGSQITNFLEMWVNKPGHVRIQAEYQFNRRRNVAELSVKQFHHRIRGCFEYTGPIEVVTQEFEGFFQQKVRIDRPVNPSQSRIVVDIPLHTKVRKHRKRKVTLSNGAEVDVDLPPNDSDIPYLWIMLDINMTLFGKIDLIQPDRICLLILRHEQDALAQISAIETISAVRDASYLSILRDIAQNNKIFYQTRIQAAIGMKDIM 667          
The following BLAST results are available for this feature:
BLAST of transcription initiation factor TFIID subunit 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
TAF22.704e-2620.56TATA-box binding protein associated factor 2 [Sour... [more]
back to top
BLAST of transcription initiation factor TFIID subunit 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
taf-22.008e-1521.15Transcription initiation factor TFIID subunit 2 [... [more]
back to top
BLAST of transcription initiation factor TFIID subunit 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Taf28.759e-2925.38gene:FBgn0011836 transcript:FBtr0332688[more]
Taf28.759e-2925.38gene:FBgn0011836 transcript:FBtr0076361[more]
back to top
BLAST of transcription initiation factor TFIID subunit 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
taf28.631e-2722.71TAF2 RNA polymerase II, TATA box binding protein (... [more]
back to top
BLAST of transcription initiation factor TFIID subunit 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TAF21.100e-2520.59uncharacterized loc100125055 [Source:Xenbase;Acc:X... [more]
TAF21.183e-2520.59uncharacterized loc100125055 [Source:Xenbase;Acc:X... [more]
TAF21.597e-2520.59uncharacterized loc100125055 [Source:Xenbase;Acc:X... [more]
TAF21.761e-2520.59uncharacterized loc100125055 [Source:Xenbase;Acc:X... [more]
TAF22.233e-2020.28uncharacterized loc100125055 [Source:Xenbase;Acc:X... [more]
back to top
BLAST of transcription initiation factor TFIID subunit 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Taf28.747e-3120.38TATA-box binding protein associated factor 2 [Sour... [more]
back to top
BLAST of transcription initiation factor TFIID subunit 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q24325|TAF2_DROME8.780e-2825.38Transcription initiation factor TFIID subunit 2 OS... [more]
sp|Q8C176|TAF2_MOUSE1.910e-2620.28Transcription initiation factor TFIID subunit 2 OS... [more]
sp|Q32PW3|TAF2_DANRE6.516e-2622.71Transcription initiation factor TFIID subunit 2 OS... [more]
sp|Q6P1X5|TAF2_HUMAN1.299e-2520.56Transcription initiation factor TFIID subunit 2 OS... [more]
sp|Q5ZIT8|TAF2_CHICK3.589e-2522.25Transcription initiation factor TFIID subunit 2 OS... [more]
back to top
BLAST of transcription initiation factor TFIID subunit 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0N7ZC012.034e-3220.76Peptidase_M1 domain-containing protein OS=Scylla o... [more]
A0A0P4WF882.154e-3220.76Peptidase_M1 domain-containing protein OS=Scylla o... [more]
V4BCU43.039e-3224.22Peptidase_M1 domain-containing protein OS=Lottia g... [more]
K1PN072.730e-3124.71Transcription initiation factor TFIID subunit 2 OS... [more]
A0A1Z5L4C42.214e-3021.39Peptidase_M1 domain-containing protein (Fragment) ... [more]
back to top
BLAST of transcription initiation factor TFIID subunit 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
taf21.647e-2522.94TATA-box binding protein associated factor 2 [Sour... [more]
taf25.040e-2220.75TATA-box binding protein associated factor 2 [Sour... [more]
back to top
BLAST of transcription initiation factor TFIID subunit 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
taf23.436e-2823.34TAF2 RNA polymerase II, TATA box binding protein (... [more]
ENSPMAT00000005578.12.963e-1925.28pep scaffold:Pmarinus_7.0:GL491533:415:5877:-1 gen... [more]
back to top
BLAST of transcription initiation factor TFIID subunit 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of transcription initiation factor TFIID subunit 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO328396.489e-2925.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO267441.709e-1229.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of transcription initiation factor TFIID subunit 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
taf24.377e-3120.88TATA-box binding protein associated factor 2 [Sour... [more]
taf28.778e-3120.88TATA-box binding protein associated factor 2 [Sour... [more]
back to top
BLAST of transcription initiation factor TFIID subunit 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000037189.10.000e+097.65SMESG000037189.1[more]
SMESG000037715.13.159e-4423.65SMESG000037715.1[more]
SMESG000037715.11.217e-4223.70SMESG000037715.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035970 ID=SMED30035970|Name=transcription initiation factor TFIID subunit 2|organism=Schmidtea mediterranea sexual|type=transcript|length=2876bp
CTATATAAATCTTATATGATTCTATGTCATATAAAATTAAACGACAAGAT
TTATCGATTGAAAATATAGATTTTTCAAAACAGTCATTTGAAGGTATTAC
GAAATTTTTTATATTTCCTCTAGAATGCGATTTTAAATCTATTCTGCTAA
ATTGCAATGGACCGATTATCAAAAAAATAATTTTTAACTTAGAAAATTCG
TCAACAGATGGATTTAATGCTATTTATGATAGATTTAATGATGACATAAT
ATCTATATATATCCCCAATGAACTTATTTCAGCTGTTTATAAATTGGAAC
CATTTTTCTTACTGATTTACTTTAGCAGTCAAGGTAACCAATGTGGATTG
CAGTTTTTCATTTCATCAACAGGATCTAAAACCGATTATATGTATATGGC
ACCATATAATAACTGTTCGGGTTCTTCTTTTCCATGCATTGAATTTGGGC
AATCTTGTGAATGGTTTATTGAAATTGCGTCACCATGTGGAAGTATGACA
GTGATTTGTTCTGGGTGTCTTAAGTTCATAGATGATAATAATTATTTATT
CCACATTGAACGTCCAACCACAGCCTGCAAAATTTCATTTGCAGTAGGTC
AGTTTGAATATTTCCATGATCCTGATAATCCGAGATTTCAATATTATTTT
CCCGCCTCATTCAATCAATATGTTAAATTTTATATTGATATATTGATTAA
AGCATTAAAATTTTTGCAATCTAATGTAAAATTTGGTTATCCGTTTGGAA
TTTACAAATCAGTTTTTGTTGATTTTTTATTGGATGAATTTTACACTGCG
TCGTCGCTAACATTGTTTAATATTAACTTGTTACTACAATATGGAGAAAG
CCATAAACTGTTTCAACCAAATCATGTTTTAATAGCTGGATTTTGTGAAC
AATACTTTGGTGCATATGTCGAAACTGCACAATGGAAGGATTCTTGGATT
TGTTGGGGATTTGCTGAATACATGGCTTGGGAAATGTTAAATGAATTTTT
TCCAATTGAAAGATCTGATGAATCGATTTACGAAATAATGGAAAAAATGA
ATCATTTGGTTGAATATGAATACAGAAATGGTGGAATTTTATTGGATGCT
TCGTTTTCAAAATCCGAAAATTTCGATTTTGATCCATTTAATCCGAGAAA
AATGCCGATACGTTACAAACGATTTTATCGAATCAAATCTGGATTGGTAT
TTCGCAGCTGGACACTTTGCATATCATTTGTCGGATTGTGTGATGTCATC
CGATATTATTTGAAGCATGAGCATTTTGTTGACGAAAAAATCCTTGAAAG
TTATTATTTGGGAAATTGGACAAATCTCATTGAAGGAACTGTAAAGAGGC
GAGGTCACATTGATATAATAGCAAAGGCTCATTATTTGAAAGAGCGGAAA
AATATTGAATTAATTGTTTATCAAGGCAGAAATATATTATCCTTCCTTTA
TTCTGGAGACATGGAATGCGATATTCGAGAATCGGGAGAAGTTGTCAGCA
GAATTGTGGAACTCAGTCCGAAAGTCTTCAATCATATTGAAATCGGTTTG
TGTTTGAAAGTGTCACTTTTGAAAACCGATTATAAATTGCTAACGAGTCG
AATGGGAGAAACAAAAGGTCCGCCCATCGGGTGGATTAACTTGGATCCGA
ATTTGATGGTAATCGGGCGAGTGCAAGTGCTTTTGGATGAATCACAAGCG
GAACTCATGTTTCATGACGACAACAGATTTACGGGGAAACTAATCGGGTT
GCAGGGAATGAGAAAAAATAAATCAGTCGATCATTTGGGATCATTGATGA
AACTGGTTGCTGATAGGAAATTGTTTCCTAGGATTCGCATAGAAGCTATC
ACACAGTTGAAAAACGCTCTATGTGATCCTAGTGTAAAATTTCCGAAAGA
TTCCTTGAAGAATCTCCTGGTGAACATTTACTGTGAAAAAGATGATGTAA
ATCCAGTGTTGAAAAGGAACTTTTGGAAAACCTTTGGGGATTATATCGTT
CATTTGGCATTGGTCGAGGCGGTTTCGGTGACATATGTTCCGGAAACTGG
TGAAAAATGGTCTGAACTGTTGTTATTATTCGTTGAGATGTTGGAATTCT
GCGGATGTGCAACTGAAAAATCCGTTTCATATTTACGCGCGTCCGTCATT
CTTGCTATCAGCGTTTCGTTTTCTCAGGTCTCTCATTCATTTATCAGCGA
GGAAAATCTAGACTTGTTTACTGATATTCTAAACCGGCAACTCATTGAAG
AAATGTCATGTGCCAGTCATAATTTCTGCGTCACGTCGGCGGTTTTGCAT
GCTTGGGCGAAATTGCACGAATATCAATTGATTAAAGATTTACCGATGTC
GGTTTATTTCTCGAATTTCCACGATGACAATGAATGCGTCCGATTGGCGG
GAATTTCAGCACTTTTGTCACTGACCAATCAAGTTTATTTGGCTGAAGAA
GCAATTGGGGAGATTTTGAATTATCTTTCAAAAACGGAAGTTCCTGTGAC
AATTCGTTGTAAAGGAGTTTCTTTAATATCCGATAATTTGATATCTTTGA
AATATTCTCAGAATGTTATGGGAAATTTGAATAAAATCTTTCAGGAAAGA
CTGAGTTTTATAATGTCGATGATTTCTTGCACAACTCCCGACTGTTTGAA
AGCATCGATATTGGAATTGGTTAAGATTATAGAGAATTTAAAGTCACCAG
TTACTATTTCTAATCCTGAGTCTTGGGGAGAGATTCTCGATCATTCTACT
TTAGACACAGAAACAAAAGAGGTGAATGTTGTCCAGTACCAACCTAGCAA
GGGAGACATGAACTTGAGTGATGATTCAGATTGAAATTATTATAAAAAGA
AGATTAAAATTTTTTATAAAGTATCA
back to top

protein sequence of SMED30035970-orf-1

>SMED30035970-orf-1 ID=SMED30035970-orf-1|Name=SMED30035970-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=937bp
MSYKIKRQDLSIENIDFSKQSFEGITKFFIFPLECDFKSILLNCNGPIIK
KIIFNLENSSTDGFNAIYDRFNDDIISIYIPNELISAVYKLEPFFLLIYF
SSQGNQCGLQFFISSTGSKTDYMYMAPYNNCSGSSFPCIEFGQSCEWFIE
IASPCGSMTVICSGCLKFIDDNNYLFHIERPTTACKISFAVGQFEYFHDP
DNPRFQYYFPASFNQYVKFYIDILIKALKFLQSNVKFGYPFGIYKSVFVD
FLLDEFYTASSLTLFNINLLLQYGESHKLFQPNHVLIAGFCEQYFGAYVE
TAQWKDSWICWGFAEYMAWEMLNEFFPIERSDESIYEIMEKMNHLVEYEY
RNGGILLDASFSKSENFDFDPFNPRKMPIRYKRFYRIKSGLVFRSWTLCI
SFVGLCDVIRYYLKHEHFVDEKILESYYLGNWTNLIEGTVKRRGHIDIIA
KAHYLKERKNIELIVYQGRNILSFLYSGDMECDIRESGEVVSRIVELSPK
VFNHIEIGLCLKVSLLKTDYKLLTSRMGETKGPPIGWINLDPNLMVIGRV
QVLLDESQAELMFHDDNRFTGKLIGLQGMRKNKSVDHLGSLMKLVADRKL
FPRIRIEAITQLKNALCDPSVKFPKDSLKNLLVNIYCEKDDVNPVLKRNF
WKTFGDYIVHLALVEAVSVTYVPETGEKWSELLLLFVEMLEFCGCATEKS
VSYLRASVILAISVSFSQVSHSFISEENLDLFTDILNRQLIEEMSCASHN
FCVTSAVLHAWAKLHEYQLIKDLPMSVYFSNFHDDNECVRLAGISALLSL
TNQVYLAEEAIGEILNYLSKTEVPVTIRCKGVSLISDNLISLKYSQNVMG
NLNKIFQERLSFIMSMISCTTPDCLKASILELVKIIENLKSPVTISNPES
WGEILDHSTLDTETKEVNVVQYQPSKGDMNLSDDSD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003743translation initiation factor activity
GO:0008270zinc ion binding
GO:0008237metallopeptidase activity
GO:0005488binding
GO:0001129RNA polymerase II transcription factor activity, TBP-class protein binding, involved in preinitiation complex assembly
GO:0003682chromatin binding
GO:0043565sequence-specific DNA binding
GO:0044212transcription regulatory region DNA binding
Vocabulary: biological process
TermDefinition
GO:0006413translational initiation
GO:0000086G2/M transition of mitotic cell cycle
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0006367transcription initiation from RNA polymerase II promoter
GO:0006508proteolysis
GO:0045944positive regulation of transcription from RNA polymerase II promoter
GO:0051123RNA polymerase II transcriptional preinitiation complex assembly
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR014782Peptidase_M1_dom
IPR016024ARM-type_fold
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005669transcription factor TFIID complex
GO:0033276transcription factor TFTC complex