Carbamoyl-phosphate synthase large chain

Overview
NameCarbamoyl-phosphate synthase large chain
Smed IDSMED30035969
Length (bp)5007
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Carbamoyl-phosphate synthase large chain (SMED30035969) t-SNE clustered cells

Violin plots show distribution of expression levels for Carbamoyl-phosphate synthase large chain (SMED30035969) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Carbamoyl-phosphate synthase large chain (SMED30035969) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Carbamoyl-phosphate synthase large chain (SMED30035969) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035969

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30035969SMESG000012911.1 SmedASXL_018407SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
cephalic gangliaSMED30035969SMESG000012911.1 dd_Smed_v4_7167_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30035969SMESG000012911.1 dd_Smed_v4_7167_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035969SMESG000012911.1 dd_Smed_v4_7167_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035969SMESG000012911.1 Contig48530newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035969SMESG000012911.1 Contig48530uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
zeta neoblastSMED30035969SMESG000012911.1 dd_Smed_v4_7167_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Human
Match: CAD (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:HGNC Symbol;Acc:HGNC:1424])

HSP 1 Score: 1038.1 bits (2683), Expect = 0.000e+0
Identity = 526/903 (58.25%), Postives = 674/903 (74.64%), Query Frame = 3
Query: 2313 KCAIKLAVL*XSVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYVEKFTESGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKIIKCLNELEEPRTY-LSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDWDTGNQASSD-SKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQALRKAIYKKKICVASPT---IDCITSQKIYRFPGLVDIHVHTRDPGQVHKEDWSTVTKXXXXXXXXXXFAMPNTAPPITNLESFELAKKRASSLAHCDYGLYVGASNDNWESLAELAPEAIGLKMYLNPTFSTLQMNNFSTWAKHFKHFPENRPICCHAEGETMAAVILLAQLHNRHVHICHVSRKQEIELIRLAKSQGLKVTCEVSPHH 5006
            + + K+     SVGE+M +GR FEEAFQKALRMVDE   GFD  V+  ++  L +PTD+R+ V+A AL  G SV  +Y+LT+ID WFL++  +II     LE+ R   L  D+L  AK LGFSD QIA AV STE+AVR+LR ELG+ P V QIDTV+AEWP  TNYLYL+Y G  HD+TF   +++VLGSGVYRIGSSVEFDWCAV CI++L++M  KTIMVN NPETVSTDYDMCD L+F+E+S E V+DI+ +E P+GVI+SMGGQLPNN+AM LHR++  + GTSP  ID+AENRFKFSR+LD+IGI QP+W+EL+D ESA  FC  V YPC+VRPSYVLSGAAMNVA+++ DL  +L+ A AV+K+HPVVISKFI++AKEIDVDAVA  G +   A+SEHVENAG+HSGDATLVTPPQD+  KTL++I  I+  + QEL+V+GPFN+QLIAKDD L VIECN+RVSRSFPFVSK LG +++A ATR IM E   +E   L      V VKVP FSF+RL GADV+LGVEM STGEVA FGE R EA+LKA L+ G KIP+   NI ++IGSYK+K ELL +VR L SLGY+LYASLGTADFY E G+ V AVDW        +   +++  + + E   +L+INL  R +G RR S  +T GY+ RRLA D+ + L+ ++KCTKLFV+AL       +I  A P    +DC+TSQK+ R PGL+D+HVH R+PG  HKED+++ T AA+AGGIT + AMPNT PPI +  +  LA+K A + A CD+ L++GAS++N  +L  +A  A GLK+YLN TFS L++++   W +HF+ +P + PI  HAE +T+AAV+++AQL  R VHICHV+RK+EI LI+ AK++GL VTCEV+PHH
Sbjct:  750 RVSTKIGSCMKSVGEVMGIGRSFEEAFQKALRMVDENCVGFDHTVKPVSDMELETPTDKRIFVVAAALWAGYSVDRLYELTRIDRWFLHRMKRIIAHAQLLEQHRGQPLPPDLLQQAKCLGFSDKQIALAVLSTELAVRKLRQELGICPAVKQIDTVAAEWPAQTNYLYLTYWGTTHDLTFRTPHVLVLGSGVYRIGSSVEFDWCAVGCIQQLRKMGYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGVILSMGGQLPNNMAMALHRQQCRVLGTSPEAIDSAENRFKFSRLLDTIGISQPQWRELSDLESARQFCQTVGYPCVVRPSYVLSGAAMNVAYTDGDLERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAVASDGVVAAIAISEHVENAGVHSGDATLVTPPQDITAKTLERIKAIVHAVGQELQVTGPFNLQLIAKDDQLKVIECNVRVSRSFPFVSKTLGVDLVALATRVIMGE--EVEPVGLMTGSGVVGVKVPQFSFSRLAGADVVLGVEMTSTGEVAGFGESRCEAYLKAMLSTGFKIPK--KNILLTIGSYKNKSELLPTVRLLESLGYSLYASLGTADFYTEHGVKVTAVDWHFEEAVDGECPPQRSILEQLAEKNFELVINLSMRGAGGRRLSSFVTKGYRTRRLAADFSVPLIIDIKCTKLFVEAL------GQIGPAPPLKVHVDCMTSQKLVRLPGLIDVHVHLREPGGTHKEDFASGTAAALAGGITMVCAMPNTRPPIIDAPALALAQKLAEAGARCDFALFLGASSENAGTLGTVAGSAAGLKLYLNETFSELRLDSVVQWMEHFETWPSHLPIVAHAEQQTVAAVLMVAQLTQRSVHICHVARKEEILLIKAAKARGLPVTCEVAPHH 1642          

HSP 2 Score: 883.634 bits (2282), Expect = 0.000e+0
Identity = 473/771 (61.35%), Postives = 581/771 (75.36%), Query Frame = 2
Query:   41 GALILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLINPLNNPEL-FIDPNERNLVEEVSINEIRHYNKNGNIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNADEYDALFISNGPGDPVKCTETIETIKNWIT--SEKPFMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVT-AVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKPKKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
             AL+L D +V  G  FGA     GEVVFQTGMVGY E+L+DPSY +Q+LVLTYP+IG+YG+  D+M D++GL K FES+ IH   L+V E     S+W+A  TL +WL++HG+ G+ G+DTR LTKKLRE GS+ G       KL+ N      L F+DPN R LV EVSI   R +N  G   +  +DCG+K NQIRC C+ GA VTV+P++  +++ EY+ LF+SNGPGDP      + T+   ++  + +P  GICLGHQLLALAIG KT+KM+YGNRGHNQPC  + + RCF+TSQNHGFAV   S+P +W  LF N ND SNEGI+H  LPF SVQFHPEH +GP+DMELLF +F+E V  A   N    ++ +RLT RL        +         P+K+LILGSGGLSIGQAGEFDYSG+QA+KAL+EE IQT+L+NPNIATVQT+ G+ADK Y LPIT  YVT+VI+ ERPDGV LTFGGQTALNCG+EL ++GV   Y V VLGT +ETI++TEDR+ F+  + EI E VAPS AA ++++   AAE+LGYPV++RAAFALGGLGSGFA+N  EL  L + AFAHTSQVLVDKSL+GWKEIEYEVVRD Y NC+TVCNMEN+DPLGIHTGES+VVAPSQTL++ EY +LR+ A+KV ++LG+VGECN+QYAL+P S +YYIIEVNARLSRSSALASKATGYPLAYVAAKL LG+ L  LRNSVT   TA FEPS+DYCVVKIPRWDL+KF +V  KI S M
Sbjct:    2 AALVLEDGSVLRGQPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILVLTYPLIGNYGIPPDEM-DEFGLCKWFESSGIHVAALVVGECCPTPSHWSATRTLHEWLQQHGIPGLQGVDTRELTKKLREQGSLLG-------KLVQNGTEPSSLPFLDPNARPLVPEVSIKTPRVFNTGGAPRILALDCGLKYNQIRCLCQRGAEVTVVPWDHALDSQEYEGLFLSNGPGDPASYPSVVSTLSRVLSEPNPRPVFGICLGHQLLALAIGAKTYKMRYGNRGHNQPCLLVGSGRCFLTSQNHGFAVETDSLPADWAPLFTNANDGSNEGIVHNSLPFFSVQFHPEHQAGPSDMELLFDIFLETVKEATAGNPGGQTVRERLTERLC----PPGIPTPGSGLPPPRKVLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTLLINPNIATVQTSQGLADKVYFLPITPHYVTQVIRNERPDGVLLTFGGQTALNCGVELTKAGVLARYGVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQAQAAAERLGYPVLVRAAFALGGLGSGFASNREELSALVAPAFAHTSQVLVDKSLKGWKEIEYEVVRDAYGNCVTVCNMENLDPLGIHTGESIVVAPSQTLNDREYQLLRQTAIKVTQHLGIVGECNVQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPELRNSVTG-GTAAFEPSVDYCVVKIPRWDLSKFLRVSTKIGSCM 759          

HSP 3 Score: 144.821 bits (364), Expect = 7.497e-34
Identity = 111/387 (28.68%), Postives = 183/387 (47.29%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMG------LHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAV--AYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQ--LIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRG-----EP--NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            +++LGSG   IG + EFD+   + IK L+    +T+++N N  TV T   + D ++F  ++   V  +   E+PDGV+++ GGQ   N  +       L R  + + GT    I+  E+R  F+  +  IG      +     E A      + YP LVR ++ L G     A +  +L+  +  A A      V++ K ++  KEI+ + V  AY G  +     E+++  GIH+G++ +V P Q +N++  Q + Q   ++ Q L + G  N+Q  L  + +   +IE N R+SRS    SKA GY +   A +  +  P       + G     EP  +   VK+P +  ++       +G  M S GEV   G    EAF KA
Sbjct:  396 VLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTLLINPNIATVQTSQGLADKVYFLPITPHYVTQVIRNERPDGVLLTFGGQTALNCGVELTKAGVLARYGVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQAQAAAERLGYPVLVRAAFALGGLGSGFASNREELSALVAPAFAHTSQ--VLVDKSLKGWKEIEYEVVRDAY-GNCVTVCNMENLDPLGIHTGESIVVAPSQTLNDREYQLLRQTAIKVTQHLGIVGECNVQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPELRNSVTGGTAAFEPSVDYCVVKIPRWDLSKFLRVSTKIGSCMKSVGEVMGIGRSFEEAFQKA 779          

HSP 4 Score: 94.7449 bits (234), Expect = 1.538e-18
Identity = 86/305 (28.20%), Postives = 149/305 (48.85%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQ--VLVDKSLRGWKEIEYEVVRDVYDNCITVCNM-ENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLG 2197
            EFD+     ++ LR+ G +T++VN N  TV T   + D+ Y   I+ + V ++ ++E P+GV L+ GGQ   N  + L         +  VLGTS E I   E+R +FS +L+ I            ++      + +GYP ++R ++ L G     A    +L    S+A A + +  V++ K ++  KEI+ + V    D  +    + E+V+  G+H+G++ +V P Q ++      ++     V + L V G  N+Q  L     +  +IE N R+SRS    SK  G  L  +A ++ +G
Sbjct:  950 EFDWCAVGCIQQLRKMGYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGVILSMGGQLPNNMAMALHRQ------QCRVLGTSPEAIDSAENRFKFSRLLDTIGISQPQWRELSDLESARQFCQTVGYPCVVRPSYVLSGAAMNVAYTDGDLERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAV--ASDGVVAAIAISEHVENAGVHSGDATLVTPPQDITAKTLERIKAIVHAVGQELQVTGPFNLQ--LIAKDDQLKVIECNVRVSRSFPFVSKTLGVDLVALATRVIMG 1244          
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Human
Match: CAD (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:HGNC Symbol;Acc:HGNC:1424])

HSP 1 Score: 1037.33 bits (2681), Expect = 0.000e+0
Identity = 526/903 (58.25%), Postives = 674/903 (74.64%), Query Frame = 3
Query: 2313 KCAIKLAVL*XSVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYVEKFTESGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKIIKCLNELEEPRTY-LSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDWDTGNQASSD-SKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQALRKAIYKKKICVASPT---IDCITSQKIYRFPGLVDIHVHTRDPGQVHKEDWSTVTKXXXXXXXXXXFAMPNTAPPITNLESFELAKKRASSLAHCDYGLYVGASNDNWESLAELAPEAIGLKMYLNPTFSTLQMNNFSTWAKHFKHFPENRPICCHAEGETMAAVILLAQLHNRHVHICHVSRKQEIELIRLAKSQGLKVTCEVSPHH 5006
            + + K+     SVGE+M +GR FEEAFQKALRMVDE   GFD  V+  ++  L +PTD+R+ V+A AL  G SV  +Y+LT+ID WFL++  +II     LE+ R   L  D+L  AK LGFSD QIA AV STE+AVR+LR ELG+ P V QIDTV+AEWP  TNYLYL+Y G  HD+TF   +++VLGSGVYRIGSSVEFDWCAV CI++L++M  KTIMVN NPETVSTDYDMCD L+F+E+S E V+DI+ +E P+GVI+SMGGQLPNN+AM LHR++  + GTSP  ID+AENRFKFSR+LD+IGI QP+W+EL+D ESA  FC  V YPC+VRPSYVLSGAAMNVA+++ DL  +L+ A AV+K+HPVVISKFI++AKEIDVDAVA  G +   A+SEHVENAG+HSGDATLVTPPQD+  KTL++I  I+  + QEL+V+GPFN+QLIAKDD L VIECN+RVSRSFPFVSK LG +++A ATR IM E   +E   L      V VKVP FSF+RL GADV+LGVEM STGEVA FGE R EA+LKA L+ G KIP+   NI ++IGSYK+K ELL +VR L SLGY+LYASLGTADFY E G+ V AVDW        +   +++  + + E   +L+INL  R +G RR S  +T GY+ RRLA D+ + L+ ++KCTKLFV+AL       +I  A P    +DC+TSQK+ R PGL+D+HVH R+PG  HKED+++ T AA+AGGIT + AMPNT PPI +  +  LA+K A + A CD+ L++GAS++N  +L  +A  A GLK+YLN TFS L++++   W +HF+ +P + PI  HAE +T+AAV+++AQL  R VHICHV+RK+EI LI+ AK++GL VTCEV+PHH
Sbjct:  687 RVSTKIGSCMKSVGEVMGIGRSFEEAFQKALRMVDENCVGFDHTVKPVSDMELETPTDKRIFVVAAALWAGYSVDRLYELTRIDRWFLHRMKRIIAHAQLLEQHRGQPLPPDLLQQAKCLGFSDKQIALAVLSTELAVRKLRQELGICPAVKQIDTVAAEWPAQTNYLYLTYWGTTHDLTFRTPHVLVLGSGVYRIGSSVEFDWCAVGCIQQLRKMGYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGVILSMGGQLPNNMAMALHRQQCRVLGTSPEAIDSAENRFKFSRLLDTIGISQPQWRELSDLESARQFCQTVGYPCVVRPSYVLSGAAMNVAYTDGDLERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAVASDGVVAAIAISEHVENAGVHSGDATLVTPPQDITAKTLERIKAIVHAVGQELQVTGPFNLQLIAKDDQLKVIECNVRVSRSFPFVSKTLGVDLVALATRVIMGE--EVEPVGLMTGSGVVGVKVPQFSFSRLAGADVVLGVEMTSTGEVAGFGESRCEAYLKAMLSTGFKIPK--KNILLTIGSYKNKSELLPTVRLLESLGYSLYASLGTADFYTEHGVKVTAVDWHFEEAVDGECPPQRSILEQLAEKNFELVINLSMRGAGGRRLSSFVTKGYRTRRLAADFSVPLIIDIKCTKLFVEAL------GQIGPAPPLKVHVDCMTSQKLVRLPGLIDVHVHLREPGGTHKEDFASGTAAALAGGITMVCAMPNTRPPIIDAPALALAQKLAEAGARCDFALFLGASSENAGTLGTVAGSAAGLKLYLNETFSELRLDSVVQWMEHFETWPSHLPIVAHAEQQTVAAVLMVAQLTQRSVHICHVARKEEILLIKAAKARGLPVTCEVAPHH 1579          

HSP 2 Score: 694.886 bits (1792), Expect = 0.000e+0
Identity = 409/770 (53.12%), Postives = 505/770 (65.58%), Query Frame = 2
Query:   41 GALILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLINPLNNPEL-FIDPNERNLVEEVSINEIRHYNKNGNIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNADEYDALFISNGPGDPVKCTETIETIKNWIT--SEKPFMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVTAVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKPKKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
             AL+L D +V  G  FGA     GEVVFQTGMVGY E+L+DPSY +Q+LVLTYP+IG+YG+  D+M D++GL K FES+ IH   L+V E     S+W+A  TL +WL++HG+ G+ G+DTR LTKKLRE GS+ G       KL+ N      L F+DPN R LV EVSI   R +N  G   +  +DCG+K NQIRC C+ GA VTV+P++  +++ EY+ LF+SNGPGDP      + T+   ++  + +P  GICLGHQLLALAIG KT+KM+YGNRGHNQPC  + + RCF+TSQNHGFAV   S+P +W  LF N ND SNEGI+H  LPF SVQFHPEH +GP+DMELLF +F+E    VK  TA     Q +  RLT +     +         P+K+LILGSGGLSIGQAGEFDYSG+QA+KAL+EE IQT+L+NPNIATVQT+ G+ADK Y LPIT  YVT+VI+ ERPDGV LTFGGQTALNCG+EL ++GV   Y V VLGT +ETI++TEDR+ F+  + EI E VAPS AA ++++   AAE+LGYPV++RAAFALGGLGSGFA+N  EL  L                                           V P   HT + +V    +     EY ++R             G C            YYIIEVNARLSRSSALASKATGYPLAYVAAKL LG+ L  LRNSVT   TA FEPS+DYCVVKIPRWDL+KF +V  KI S M
Sbjct:    2 AALVLEDGSVLRGQPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILVLTYPLIGNYGIPPDEM-DEFGLCKWFESSGIHVAALVVGECCPTPSHWSATRTLHEWLQQHGIPGLQGVDTRELTKKLREQGSLLG-------KLVQNGTEPSSLPFLDPNARPLVPEVSIKTPRVFNTGGAPRILALDCGLKYNQIRCLCQRGAEVTVVPWDHALDSQEYEGLFLSNGPGDPASYPSVVSTLSRVLSEPNPRPVFGICLGHQLLALAIGAKTYKMRYGNRGHNQPCLLVGSGRCFLTSQNHGFAVETDSLPADWAPLFTNANDGSNEGIVHNSLPFFSVQFHPEHQAGPSDMELLFDIFLE---TVKEATAGNPGGQTVRERLTERLCPPGIPTPGSGLPPPRKVLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTLLINPNIATVQTSQGLADKVYFLPITPHYVTQVIRNERPDGVLLTFGGQTALNCGVELTKAGVLARYGVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQAQAAAERLGYPVLVRAAFALGGLGSGFASNREELSAL-------------------------------------------VAPAFAHTSQVLVDKSLKGWKEIEYEVVRDA----------YGNCVT----------YYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPELRNSVTG-GTAAFEPSVDYCVVKIPRWDLSKFLRVSTKIGSCM 696          

HSP 3 Score: 95.1301 bits (235), Expect = 1.197e-18
Identity = 86/305 (28.20%), Postives = 149/305 (48.85%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQ--VLVDKSLRGWKEIEYEVVRDVYDNCITVCNM-ENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLG 2197
            EFD+     ++ LR+ G +T++VN N  TV T   + D+ Y   I+ + V ++ ++E P+GV L+ GGQ   N  + L         +  VLGTS E I   E+R +FS +L+ I            ++      + +GYP ++R ++ L G     A    +L    S+A A + +  V++ K ++  KEI+ + V    D  +    + E+V+  G+H+G++ +V P Q ++      ++     V + L V G  N+Q  L     +  +IE N R+SRS    SK  G  L  +A ++ +G
Sbjct:  887 EFDWCAVGCIQQLRKMGYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGVILSMGGQLPNNMAMALHRQ------QCRVLGTSPEAIDSAENRFKFSRLLDTIGISQPQWRELSDLESARQFCQTVGYPCVVRPSYVLSGAAMNVAYTDGDLERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAV--ASDGVVAAIAISEHVENAGVHSGDATLVTPPQDITAKTLERIKAIVHAVGQELQVTGPFNLQ--LIAKDDQLKVIECNVRVSRSFPFVSKTLGVDLVALATRVIMG 1181          

HSP 4 Score: 85.8853 bits (211), Expect = 7.213e-16
Identity = 62/217 (28.57%), Postives = 104/217 (47.93%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMG------LHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAV--AYG 3491
            +++LGSG   IG + EFD+   + IK L+    +T+++N N  TV T   + D ++F  ++   V  +   E+PDGV+++ GGQ   N  +       L R  + + GT    I+  E+R  F+  +  IG      +     E A      + YP LVR ++ L G     A +  +L+  +  A A      V++ K ++  KEI+ + V  AYG
Sbjct:  396 VLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTLLINPNIATVQTSQGLADKVYFLPITPHYVTQVIRNERPDGVLLTFGGQTALNCGVELTKAGVLARYGVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQAQAAAERLGYPVLVRAAFALGGLGSGFASNREELSALVAPAFAHTSQ--VLVDKSLKGWKEIEYEVVRDAYG 610          
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Human
Match: CPS1 (carbamoyl-phosphate synthase 1 [Source:HGNC Symbol;Acc:HGNC:2323])

HSP 1 Score: 716.072 bits (1847), Expect = 0.000e+0
Identity = 394/772 (51.04%), Postives = 532/772 (68.91%), Query Frame = 2
Query:   47 LILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLINPLNNPELFIDPNERNLVEEVSINEIRHYNKNGNIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNADEYDALFISNGPGDPVKCTETIETIKNWITSEK--PFMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVTAVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKPK--KXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTT---MGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
            ++L D T   G  FG      GEVVF TG+ GY E+++DP+Y  Q+L +  PIIG+ G  D   LD+ GL K  ES  I  +GL+V +YS +Y++W A  +L QWL++  V  I G+DTR LTK +R+ G++ G I     +    P++    F+DPN++NL+ EVS  +++ Y K     V  +DCG+KNN IR   K GA V ++P+N      EYD + I+ GPG+P      I+ ++  + S++  P  GI  G+ +  LA G KT+KM   NRG NQP  ++  K+ F+T+QNHG+A+  +++P  W+ LF N ND++NEGI+H+  PF +VQFHPE   GP D E LF  F   +   K+ T T  L +                  AL+ ++ +  K+LILGSGGLSIGQAGEFDYSG+QA+KA++EE ++TVL+NPNIA+VQT    +  AD  Y LPIT  +VTEVIK E+PDG+ L  GGQTALNCG+EL + GV K+Y V VLGTS+E+I  TEDRQ FS+ L EI E++APS A  ++++ + AA+ +GYPVMIR+A+ALGGLGSG   N   L+DL++ AFA T+Q+LV+KS+ GWKEIEYEVVRD  DNC+TVCNMENVD +G+HTG+SVVVAP+QTLSN E+ MLR+ ++ VVR+LG+VGECNIQ+AL P S +Y IIEVNARLSRSSALASKATGYPLA++AAK+ LG+ L  ++N V+  T+ACFEPS+DY V KIPRWDL++F    ++I SSM
Sbjct:   48 IVLEDGTKMKGYSFGHPSSVAGEVVFNTGLGGYPEAITDPAYKGQILTMANPIIGNGGAPDTTALDELGLSKYLESNGIKVSGLLVLDYSKDYNHWLATKSLGQWLQEEKVPAIYGVDTRMLTKIIRDKGTMLGKI-----EFEGQPVD----FVDPNKQNLIAEVSTKDVKVYGKGNPTKVVAVDCGIKNNVIRLLVKRGAEVHLVPWNHDFTKMEYDGILIAGGPGNPALAEPLIQNVRKILESDRKEPLFGISTGNLITGLAAGAKTYKMSMANRGQNQPVLNITNKQAFITAQNHGYALD-NTLPAGWKPLFVNVNDQTNEGIMHESKPFFAVQFHPEVTPGPIDTEYLFDSFFSLIKKGKATTITSVLPK-----------------PALVASRVEVSKVLILGSGGLSIGQAGEFDYSGSQAVKAMKEENVKTVLMNPNIASVQTNEVGLKQADTVYFLPITPQFVTEVIKAEQPDGLILGMGGQTALNCGVELFKRGVLKEYGVKVLGTSVESIMATEDRQLFSDKLNEINEKIAPSFAVESIEDALKAADTIGYPVMIRSAYALGGLGSGICPNRETLMDLSTKAFAMTNQILVEKSVTGWKEIEYEVVRDADDNCVTVCNMENVDAMGVHTGDSVVVAPAQTLSNAEFQMLRRTSINVVRHLGIVGECNIQFALHPTSMEYCIIEVNARLSRSSALASKATGYPLAFIAAKIALGIPLPEIKNVVSGKTSACFEPSLDYMVTKIPRWDLDRFHGTSSRIGSSM 792          

HSP 2 Score: 592.423 bits (1526), Expect = 0.000e+0
Identity = 318/700 (45.43%), Postives = 453/700 (64.71%), Query Frame = 3
Query: 2346 SVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYVEKFTE--------SGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKIIKCLNELEEPRT-YLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRGEP----NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDWDT--GNQASSDSKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQALRKA 4400
            SVGE+M++GR FEE+FQKALRM    ++GF P +    E          LS P+  R+  +A A+   +S+ EI  LT ID WFLYK   I+     L+   +  ++++ L  AK +GFSD QI++ +  TE   R+LR++  + P V QIDT++AE+P  TNYLY++Y+G +HD+ F+   +MVLG G Y IGSSVEFDWCAV  I+ L+++ KKT++VNCNPETVSTD+D CD L+FEELSLE +LDI+H E   G I+S+GGQ+PNN+A+ L++  + I GTSP+ ID AE+R  FS +LD + + Q  WK +     A+ F   V YPCL+RPSYVLSG+AMNV FSE ++ ++L +A  V+++HPVV++KF+E A+E+++DAV   G+++  A+SEHVE+AG+HSGDATL+ P Q +++  ++K+     +IA+   +SGPFN+Q + K +++LVIECNLR SRSFPFVSK LG + I  AT+ ++ E    +       P    + VA+K PMFS+ RL  AD +L  EM STGEVACFGE  + AFLKA L+ G KIP+ G  I I I     +   L    QL + G+ L+A+  T+D+   + +    V W +  G   S  S +K   D      +DL+INLP  N+        + + Y  RR A+D GI LLTN + TKLF +A++K+
Sbjct:  794 SVGEVMAIGRTFEESFQKALRMCHPSIEGFTPRLPMNKEWPSNLDLRKELSEPSSTRIYAIAKAIDDNMSLDEIEKLTYIDKWFLYKMRDILNMEKTLKGLNSESMTEETLKRAKEIGFSDKQISKCLGLTEAQTRELRLKKNIHPWVKQIDTLAAEYPSVTNYLYVTYNGQEHDVNFDDHGMMVLGCGPYHIGSSVEFDWCAVSSIRTLRQLGKKTVVVNCNPETVSTDFDECDKLYFEELSLERILDIYHQEACGGCIISVGGQIPNNLAVPLYKNGVKIMGTSPLQIDRAEDRSIFSAVLDELKVAQAPWKAVNTLNEALEFAKSVDYPCLLRPSYVLSGSAMNVVFSEDEMKKFLEEATRVSQEHPVVLTKFVEGAREVEMDAVGKDGRVISHAISEHVEDAGVHSGDATLMLPTQTISQGAIEKVKDATRKIAKAFAISGPFNVQFLVKGNDVLVIECNLRASRSFPFVSKTLGVDFIDVATKVMIGENVDEKHLPTLDHPIIPADYVAIKAPMFSWPRLRDADPILRCEMASTGEVACFGEGIHTAFLKAMLSTGFKIPQKG--ILIGI-QQSFRPRFLGVAEQLHNEGFKLFATEATSDWLNANNVPATPVAWPSQEGQNPSLSSIRKLIRD----GSIDLVINLPNNNTKF------VHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKS 1480          

HSP 3 Score: 138.272 bits (347), Expect = 7.745e-32
Identity = 104/390 (26.67%), Postives = 180/390 (46.15%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTD---YDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHRE------KIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYG-GKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNL--LVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRG------EP--NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            +++LGSG   IG + EFD+   + +K ++    KT+++N N  +V T+       D ++F  ++ + V ++   EQPDG+I+ MGGQ   N  + L +        + + GTS   I   E+R  FS  L+ I         +   E A+   + + YP ++R +Y L G    +  +   L +  T+A A+     +++ K +   KEI+ + V       +     E+V+  G+H+GD+ +V P Q ++    Q + +    + + L + G  N+Q      ++   +IE N R+SRS    SKA GY +   A +  +  P       + G      EP  + +  K+P +   R  G    +G  M S GEV   G    E+F KA
Sbjct:  425 VLILGSGGLSIGQAGEFDYSGSQAVKAMKEENVKTVLMNPNIASVQTNEVGLKQADTVYFLPITPQFVTEVIKAEQPDGLILGMGGQTALNCGVELFKRGVLKEYGVKVLGTSVESIMATEDRQLFSDKLNEINEKIAPSFAVESIEDALKAADTIGYPVMIRSAYALGGLGSGICPNRETLMDLSTKAFAMTNQ--ILVEKSVTGWKEIEYEVVRDADDNCVTVCNMENVDAMGVHTGDSVVVAPAQTLSNAEFQMLRRTSINVVRHLGIVGECNIQFALHPTSMEYCIIEVNARLSRSSALASKATGYPLAFIAAKIALGIPLPEIKNVVSGKTSACFEPSLDYMVTKIPRWDLDRFHGTSSRIGSSMKSVGEVMAIGRTFEESFQKA 812          

HSP 4 Score: 109.768 bits (273), Expect = 3.185e-23
Identity = 87/305 (28.52%), Postives = 151/305 (49.51%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAA--FAHTSQVLVDKSLRGWKEIEYEVV-RDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLG 2197
            EFD+    +++ LR+ G +TV+VN N  TV T     DK Y   ++ + + ++   E   G  ++ GGQ   N  + L ++GV       ++GTS   I   EDR  FS +L+E+K   AP  A  T+ E ++ A+ + YP ++R ++ L G       +  E+      A   +    V++ K + G +E+E + V +D     I+    E+V+  G+H+G++ ++ P+QT+S      ++    K+ +   + G  N+Q+ +  N     +IE N R SRS    SK  G     VA K+ +G
Sbjct:  991 EFDWCAVSSIRTLRQLGKKTVVVNCNPETVSTDFDECDKLYFEELSLERILDIYHQEACGGCIISVGGQIPNNLAVPLYKNGV------KIMGTSPLQIDRAEDRSIFSAVLDELKVAQAPWKAVNTLNEALEFAKSVDYPCLLRPSYVLSGSAMNVVFSEDEMKKFLEEATRVSQEHPVVLTKFVEGAREVEMDAVGKD--GRVISHAISEHVEDAGVHSGDATLMLPTQTISQGAIEKVKDATRKIAKAFAISGPFNVQFLVKGND--VLVIECNLRASRSFPFVSKTLGVDFIDVATKVMIG 1285          
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Human
Match: CPS1 (carbamoyl-phosphate synthase 1 [Source:HGNC Symbol;Acc:HGNC:2323])

HSP 1 Score: 716.072 bits (1847), Expect = 0.000e+0
Identity = 394/772 (51.04%), Postives = 532/772 (68.91%), Query Frame = 2
Query:   47 LILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLINPLNNPELFIDPNERNLVEEVSINEIRHYNKNGNIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNADEYDALFISNGPGDPVKCTETIETIKNWITSEK--PFMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVTAVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKPK--KXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTT---MGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
            ++L D T   G  FG      GEVVF TG+ GY E+++DP+Y  Q+L +  PIIG+ G  D   LD+ GL K  ES  I  +GL+V +YS +Y++W A  +L QWL++  V  I G+DTR LTK +R+ G++ G I     +    P++    F+DPN++NL+ EVS  +++ Y K     V  +DCG+KNN IR   K GA V ++P+N      EYD + I+ GPG+P      I+ ++  + S++  P  GI  G+ +  LA G KT+KM   NRG NQP  ++  K+ F+T+QNHG+A+  +++P  W+ LF N ND++NEGI+H+  PF +VQFHPE   GP D E LF  F   +   K+ T T  L +                  AL+ ++ +  K+LILGSGGLSIGQAGEFDYSG+QA+KA++EE ++TVL+NPNIA+VQT    +  AD  Y LPIT  +VTEVIK E+PDG+ L  GGQTALNCG+EL + GV K+Y V VLGTS+E+I  TEDRQ FS+ L EI E++APS A  ++++ + AA+ +GYPVMIR+A+ALGGLGSG   N   L+DL++ AFA T+Q+LV+KS+ GWKEIEYEVVRD  DNC+TVCNMENVD +G+HTG+SVVVAP+QTLSN E+ MLR+ ++ VVR+LG+VGECNIQ+AL P S +Y IIEVNARLSRSSALASKATGYPLA++AAK+ LG+ L  ++N V+  T+ACFEPS+DY V KIPRWDL++F    ++I SSM
Sbjct:   48 IVLEDGTKMKGYSFGHPSSVAGEVVFNTGLGGYPEAITDPAYKGQILTMANPIIGNGGAPDTTALDELGLSKYLESNGIKVSGLLVLDYSKDYNHWLATKSLGQWLQEEKVPAIYGVDTRMLTKIIRDKGTMLGKI-----EFEGQPVD----FVDPNKQNLIAEVSTKDVKVYGKGNPTKVVAVDCGIKNNVIRLLVKRGAEVHLVPWNHDFTKMEYDGILIAGGPGNPALAEPLIQNVRKILESDRKEPLFGISTGNLITGLAAGAKTYKMSMANRGQNQPVLNITNKQAFITAQNHGYALD-NTLPAGWKPLFVNVNDQTNEGIMHESKPFFAVQFHPEVTPGPIDTEYLFDSFFSLIKKGKATTITSVLPK-----------------PALVASRVEVSKVLILGSGGLSIGQAGEFDYSGSQAVKAMKEENVKTVLMNPNIASVQTNEVGLKQADTVYFLPITPQFVTEVIKAEQPDGLILGMGGQTALNCGVELFKRGVLKEYGVKVLGTSVESIMATEDRQLFSDKLNEINEKIAPSFAVESIEDALKAADTIGYPVMIRSAYALGGLGSGICPNRETLMDLSTKAFAMTNQILVEKSVTGWKEIEYEVVRDADDNCVTVCNMENVDAMGVHTGDSVVVAPAQTLSNAEFQMLRRTSINVVRHLGIVGECNIQFALHPTSMEYCIIEVNARLSRSSALASKATGYPLAFIAAKIALGIPLPEIKNVVSGKTSACFEPSLDYMVTKIPRWDLDRFHGTSSRIGSSM 792          

HSP 2 Score: 592.423 bits (1526), Expect = 0.000e+0
Identity = 318/700 (45.43%), Postives = 453/700 (64.71%), Query Frame = 3
Query: 2346 SVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYVEKFTE--------SGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKIIKCLNELEEPRT-YLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRGEP----NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDWDT--GNQASSDSKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQALRKA 4400
            SVGE+M++GR FEE+FQKALRM    ++GF P +    E          LS P+  R+  +A A+   +S+ EI  LT ID WFLYK   I+     L+   +  ++++ L  AK +GFSD QI++ +  TE   R+LR++  + P V QIDT++AE+P  TNYLY++Y+G +HD+ F+   +MVLG G Y IGSSVEFDWCAV  I+ L+++ KKT++VNCNPETVSTD+D CD L+FEELSLE +LDI+H E   G I+S+GGQ+PNN+A+ L++  + I GTSP+ ID AE+R  FS +LD + + Q  WK +     A+ F   V YPCL+RPSYVLSG+AMNV FSE ++ ++L +A  V+++HPVV++KF+E A+E+++DAV   G+++  A+SEHVE+AG+HSGDATL+ P Q +++  ++K+     +IA+   +SGPFN+Q + K +++LVIECNLR SRSFPFVSK LG + I  AT+ ++ E    +       P    + VA+K PMFS+ RL  AD +L  EM STGEVACFGE  + AFLKA L+ G KIP+ G  I I I     +   L    QL + G+ L+A+  T+D+   + +    V W +  G   S  S +K   D      +DL+INLP  N+        + + Y  RR A+D GI LLTN + TKLF +A++K+
Sbjct:  794 SVGEVMAIGRTFEESFQKALRMCHPSIEGFTPRLPMNKEWPSNLDLRKELSEPSSTRIYAIAKAIDDNMSLDEIEKLTYIDKWFLYKMRDILNMEKTLKGLNSESMTEETLKRAKEIGFSDKQISKCLGLTEAQTRELRLKKNIHPWVKQIDTLAAEYPSVTNYLYVTYNGQEHDVNFDDHGMMVLGCGPYHIGSSVEFDWCAVSSIRTLRQLGKKTVVVNCNPETVSTDFDECDKLYFEELSLERILDIYHQEACGGCIISVGGQIPNNLAVPLYKNGVKIMGTSPLQIDRAEDRSIFSAVLDELKVAQAPWKAVNTLNEALEFAKSVDYPCLLRPSYVLSGSAMNVVFSEDEMKKFLEEATRVSQEHPVVLTKFVEGAREVEMDAVGKDGRVISHAISEHVEDAGVHSGDATLMLPTQTISQGAIEKVKDATRKIAKAFAISGPFNVQFLVKGNDVLVIECNLRASRSFPFVSKTLGVDFIDVATKVMIGENVDEKHLPTLDHPIIPADYVAIKAPMFSWPRLRDADPILRCEMASTGEVACFGEGIHTAFLKAMLSTGFKIPQKG--ILIGI-QQSFRPRFLGVAEQLHNEGFKLFATEATSDWLNANNVPATPVAWPSQEGQNPSLSSIRKLIRD----GSIDLVINLPNNNTKF------VHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKS 1480          

HSP 3 Score: 138.272 bits (347), Expect = 7.745e-32
Identity = 104/390 (26.67%), Postives = 180/390 (46.15%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTD---YDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHRE------KIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYG-GKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNL--LVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRG------EP--NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            +++LGSG   IG + EFD+   + +K ++    KT+++N N  +V T+       D ++F  ++ + V ++   EQPDG+I+ MGGQ   N  + L +        + + GTS   I   E+R  FS  L+ I         +   E A+   + + YP ++R +Y L G    +  +   L +  T+A A+     +++ K +   KEI+ + V       +     E+V+  G+H+GD+ +V P Q ++    Q + +    + + L + G  N+Q      ++   +IE N R+SRS    SKA GY +   A +  +  P       + G      EP  + +  K+P +   R  G    +G  M S GEV   G    E+F KA
Sbjct:  425 VLILGSGGLSIGQAGEFDYSGSQAVKAMKEENVKTVLMNPNIASVQTNEVGLKQADTVYFLPITPQFVTEVIKAEQPDGLILGMGGQTALNCGVELFKRGVLKEYGVKVLGTSVESIMATEDRQLFSDKLNEINEKIAPSFAVESIEDALKAADTIGYPVMIRSAYALGGLGSGICPNRETLMDLSTKAFAMTNQ--ILVEKSVTGWKEIEYEVVRDADDNCVTVCNMENVDAMGVHTGDSVVVAPAQTLSNAEFQMLRRTSINVVRHLGIVGECNIQFALHPTSMEYCIIEVNARLSRSSALASKATGYPLAFIAAKIALGIPLPEIKNVVSGKTSACFEPSLDYMVTKIPRWDLDRFHGTSSRIGSSMKSVGEVMAIGRTFEESFQKA 812          

HSP 4 Score: 109.768 bits (273), Expect = 3.185e-23
Identity = 87/305 (28.52%), Postives = 151/305 (49.51%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAA--FAHTSQVLVDKSLRGWKEIEYEVV-RDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLG 2197
            EFD+    +++ LR+ G +TV+VN N  TV T     DK Y   ++ + + ++   E   G  ++ GGQ   N  + L ++GV       ++GTS   I   EDR  FS +L+E+K   AP  A  T+ E ++ A+ + YP ++R ++ L G       +  E+      A   +    V++ K + G +E+E + V +D     I+    E+V+  G+H+G++ ++ P+QT+S      ++    K+ +   + G  N+Q+ +  N     +IE N R SRS    SK  G     VA K+ +G
Sbjct:  991 EFDWCAVSSIRTLRQLGKKTVVVNCNPETVSTDFDECDKLYFEELSLERILDIYHQEACGGCIISVGGQIPNNLAVPLYKNGV------KIMGTSPLQIDRAEDRSIFSAVLDELKVAQAPWKAVNTLNEALEFAKSVDYPCLLRPSYVLSGSAMNVVFSEDEMKKFLEEATRVSQEHPVVLTKFVEGAREVEMDAVGKD--GRVISHAISEHVEDAGVHSGDATLMLPTQTISQGAIEKVKDATRKIAKAFAISGPFNVQFLVKGND--VLVIECNLRASRSFPFVSKTLGVDFIDVATKVMIG 1285          
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Human
Match: CPS1 (carbamoyl-phosphate synthase 1 [Source:HGNC Symbol;Acc:HGNC:2323])

HSP 1 Score: 716.072 bits (1847), Expect = 0.000e+0
Identity = 394/772 (51.04%), Postives = 532/772 (68.91%), Query Frame = 2
Query:   47 LILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLINPLNNPELFIDPNERNLVEEVSINEIRHYNKNGNIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNADEYDALFISNGPGDPVKCTETIETIKNWITSEK--PFMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVTAVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKPK--KXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTT---MGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
            ++L D T   G  FG      GEVVF TG+ GY E+++DP+Y  Q+L +  PIIG+ G  D   LD+ GL K  ES  I  +GL+V +YS +Y++W A  +L QWL++  V  I G+DTR LTK +R+ G++ G I     +    P++    F+DPN++NL+ EVS  +++ Y K     V  +DCG+KNN IR   K GA V ++P+N      EYD + I+ GPG+P      I+ ++  + S++  P  GI  G+ +  LA G KT+KM   NRG NQP  ++  K+ F+T+QNHG+A+  +++P  W+ LF N ND++NEGI+H+  PF +VQFHPE   GP D E LF  F   +   K+ T T  L +                  AL+ ++ +  K+LILGSGGLSIGQAGEFDYSG+QA+KA++EE ++TVL+NPNIA+VQT    +  AD  Y LPIT  +VTEVIK E+PDG+ L  GGQTALNCG+EL + GV K+Y V VLGTS+E+I  TEDRQ FS+ L EI E++APS A  ++++ + AA+ +GYPVMIR+A+ALGGLGSG   N   L+DL++ AFA T+Q+LV+KS+ GWKEIEYEVVRD  DNC+TVCNMENVD +G+HTG+SVVVAP+QTLSN E+ MLR+ ++ VVR+LG+VGECNIQ+AL P S +Y IIEVNARLSRSSALASKATGYPLA++AAK+ LG+ L  ++N V+  T+ACFEPS+DY V KIPRWDL++F    ++I SSM
Sbjct:   54 IVLEDGTKMKGYSFGHPSSVAGEVVFNTGLGGYPEAITDPAYKGQILTMANPIIGNGGAPDTTALDELGLSKYLESNGIKVSGLLVLDYSKDYNHWLATKSLGQWLQEEKVPAIYGVDTRMLTKIIRDKGTMLGKI-----EFEGQPVD----FVDPNKQNLIAEVSTKDVKVYGKGNPTKVVAVDCGIKNNVIRLLVKRGAEVHLVPWNHDFTKMEYDGILIAGGPGNPALAEPLIQNVRKILESDRKEPLFGISTGNLITGLAAGAKTYKMSMANRGQNQPVLNITNKQAFITAQNHGYALD-NTLPAGWKPLFVNVNDQTNEGIMHESKPFFAVQFHPEVTPGPIDTEYLFDSFFSLIKKGKATTITSVLPK-----------------PALVASRVEVSKVLILGSGGLSIGQAGEFDYSGSQAVKAMKEENVKTVLMNPNIASVQTNEVGLKQADTVYFLPITPQFVTEVIKAEQPDGLILGMGGQTALNCGVELFKRGVLKEYGVKVLGTSVESIMATEDRQLFSDKLNEINEKIAPSFAVESIEDALKAADTIGYPVMIRSAYALGGLGSGICPNRETLMDLSTKAFAMTNQILVEKSVTGWKEIEYEVVRDADDNCVTVCNMENVDAMGVHTGDSVVVAPAQTLSNAEFQMLRRTSINVVRHLGIVGECNIQFALHPTSMEYCIIEVNARLSRSSALASKATGYPLAFIAAKIALGIPLPEIKNVVSGKTSACFEPSLDYMVTKIPRWDLDRFHGTSSRIGSSM 798          

HSP 2 Score: 592.423 bits (1526), Expect = 0.000e+0
Identity = 318/700 (45.43%), Postives = 453/700 (64.71%), Query Frame = 3
Query: 2346 SVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYVEKFTE--------SGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKIIKCLNELEEPRT-YLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRGEP----NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDWDT--GNQASSDSKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQALRKA 4400
            SVGE+M++GR FEE+FQKALRM    ++GF P +    E          LS P+  R+  +A A+   +S+ EI  LT ID WFLYK   I+     L+   +  ++++ L  AK +GFSD QI++ +  TE   R+LR++  + P V QIDT++AE+P  TNYLY++Y+G +HD+ F+   +MVLG G Y IGSSVEFDWCAV  I+ L+++ KKT++VNCNPETVSTD+D CD L+FEELSLE +LDI+H E   G I+S+GGQ+PNN+A+ L++  + I GTSP+ ID AE+R  FS +LD + + Q  WK +     A+ F   V YPCL+RPSYVLSG+AMNV FSE ++ ++L +A  V+++HPVV++KF+E A+E+++DAV   G+++  A+SEHVE+AG+HSGDATL+ P Q +++  ++K+     +IA+   +SGPFN+Q + K +++LVIECNLR SRSFPFVSK LG + I  AT+ ++ E    +       P    + VA+K PMFS+ RL  AD +L  EM STGEVACFGE  + AFLKA L+ G KIP+ G  I I I     +   L    QL + G+ L+A+  T+D+   + +    V W +  G   S  S +K   D      +DL+INLP  N+        + + Y  RR A+D GI LLTN + TKLF +A++K+
Sbjct:  800 SVGEVMAIGRTFEESFQKALRMCHPSIEGFTPRLPMNKEWPSNLDLRKELSEPSSTRIYAIAKAIDDNMSLDEIEKLTYIDKWFLYKMRDILNMEKTLKGLNSESMTEETLKRAKEIGFSDKQISKCLGLTEAQTRELRLKKNIHPWVKQIDTLAAEYPSVTNYLYVTYNGQEHDVNFDDHGMMVLGCGPYHIGSSVEFDWCAVSSIRTLRQLGKKTVVVNCNPETVSTDFDECDKLYFEELSLERILDIYHQEACGGCIISVGGQIPNNLAVPLYKNGVKIMGTSPLQIDRAEDRSIFSAVLDELKVAQAPWKAVNTLNEALEFAKSVDYPCLLRPSYVLSGSAMNVVFSEDEMKKFLEEATRVSQEHPVVLTKFVEGAREVEMDAVGKDGRVISHAISEHVEDAGVHSGDATLMLPTQTISQGAIEKVKDATRKIAKAFAISGPFNVQFLVKGNDVLVIECNLRASRSFPFVSKTLGVDFIDVATKVMIGENVDEKHLPTLDHPIIPADYVAIKAPMFSWPRLRDADPILRCEMASTGEVACFGEGIHTAFLKAMLSTGFKIPQKG--ILIGI-QQSFRPRFLGVAEQLHNEGFKLFATEATSDWLNANNVPATPVAWPSQEGQNPSLSSIRKLIRD----GSIDLVINLPNNNTKF------VHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKS 1486          

HSP 3 Score: 138.272 bits (347), Expect = 7.197e-32
Identity = 104/390 (26.67%), Postives = 180/390 (46.15%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTD---YDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHRE------KIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYG-GKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNL--LVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRG------EP--NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            +++LGSG   IG + EFD+   + +K ++    KT+++N N  +V T+       D ++F  ++ + V ++   EQPDG+I+ MGGQ   N  + L +        + + GTS   I   E+R  FS  L+ I         +   E A+   + + YP ++R +Y L G    +  +   L +  T+A A+     +++ K +   KEI+ + V       +     E+V+  G+H+GD+ +V P Q ++    Q + +    + + L + G  N+Q      ++   +IE N R+SRS    SKA GY +   A +  +  P       + G      EP  + +  K+P +   R  G    +G  M S GEV   G    E+F KA
Sbjct:  431 VLILGSGGLSIGQAGEFDYSGSQAVKAMKEENVKTVLMNPNIASVQTNEVGLKQADTVYFLPITPQFVTEVIKAEQPDGLILGMGGQTALNCGVELFKRGVLKEYGVKVLGTSVESIMATEDRQLFSDKLNEINEKIAPSFAVESIEDALKAADTIGYPVMIRSAYALGGLGSGICPNRETLMDLSTKAFAMTNQ--ILVEKSVTGWKEIEYEVVRDADDNCVTVCNMENVDAMGVHTGDSVVVAPAQTLSNAEFQMLRRTSINVVRHLGIVGECNIQFALHPTSMEYCIIEVNARLSRSSALASKATGYPLAFIAAKIALGIPLPEIKNVVSGKTSACFEPSLDYMVTKIPRWDLDRFHGTSSRIGSSMKSVGEVMAIGRTFEESFQKA 818          

HSP 4 Score: 110.153 bits (274), Expect = 2.932e-23
Identity = 87/305 (28.52%), Postives = 151/305 (49.51%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAA--FAHTSQVLVDKSLRGWKEIEYEVV-RDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLG 2197
            EFD+    +++ LR+ G +TV+VN N  TV T     DK Y   ++ + + ++   E   G  ++ GGQ   N  + L ++GV       ++GTS   I   EDR  FS +L+E+K   AP  A  T+ E ++ A+ + YP ++R ++ L G       +  E+      A   +    V++ K + G +E+E + V +D     I+    E+V+  G+H+G++ ++ P+QT+S      ++    K+ +   + G  N+Q+ +  N     +IE N R SRS    SK  G     VA K+ +G
Sbjct:  997 EFDWCAVSSIRTLRQLGKKTVVVNCNPETVSTDFDECDKLYFEELSLERILDIYHQEACGGCIISVGGQIPNNLAVPLYKNGV------KIMGTSPLQIDRAEDRSIFSAVLDELKVAQAPWKAVNTLNEALEFAKSVDYPCLLRPSYVLSGSAMNVVFSEDEMKKFLEEATRVSQEHPVVLTKFVEGAREVEMDAVGKD--GRVISHAISEHVEDAGVHSGDATLMLPTQTISQGAIEKVKDATRKIAKAFAISGPFNVQFLVKGND--VLVIECNLRASRSFPFVSKTLGVDFIDVATKVMIG 1291          
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Celegans
Match: pyr-1 (CAD protein Glutamine-dependent carbamoyl-phosphate synthase Aspartate carbamoyltransferase Dihydroorotase [Source:UniProtKB/Swiss-Prot;Acc:Q18990])

HSP 1 Score: 953.355 bits (2463), Expect = 0.000e+0
Identity = 498/903 (55.15%), Postives = 637/903 (70.54%), Query Frame = 3
Query: 2346 SVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYV--EKFTESGLSSPTDRRMLVLANALKQG-VSVKEIYDLTKIDYWFLYKFAKIIKCLNELEEPR-TYLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFE-GGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSE-------PFSLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDWDTGNQASSDSKKKTFSDYIIE----DKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQALRKAIYKKKICVASPTIDCITSQKIYRFPGLVDIHVHTRDPGQVHKEDWSTVTKXXXXXXXXXXFAMPNTAPPITNLESFELAKKRASSLAHCDYGLYVGASNDNWESLAELAPEAIGLKMYLNPTFSTLQMNNFSTWAKHFKHFPENRPICCHAEGETMAAVILLAQLHNRHVHICHVSRKQEIELIRLAKSQGLKVTCEVSPHH 5006
            SVGE+M +GR FEEA QKALRMV +   GF PY      T   LS PTD+RM  LA  +  G   V++ ++LT+ID WFL++   I+   + LE+     +S ++LL AK  GFSD QIA+ + S E  VR+ R   G+ P V QIDTV+ EWP  TNYLY +++GI++D++F     +MVLGSGVYRIGSSVEFD   V CI+EL+ +   TI VNCNPETVSTDYD+CD L+FEE+S E+VLD++H+E+P GVI++ GGQ PNNIAM L R ++ IFGTSP  IDNAE+RFKFSR L+S+ I QP+WK+  + E A NFC  V YPCL+RPSYVLSGAAMNVA +  DL  +L QA  V K+HPVV+SKFI +AKE+DVDAVA  GKL+  AVSEH+ENAG+HSGDATLVTP QDMN+ TL +I  I   IA+   V+GPFNMQLIAK++ L VIECNLRVSRSFPFVSK L Y+ +A ATRA+M+                L+G+  +V VKVP FSF+RL GADV+LGVEM STGEVACFG  R +A+LKA L+ G  +P+   NIFISIG Y  K E+L+SV  L  LGY LY S GTAD++  + I+V  VDW    + SSD K  + +  ++E     +  L+INLP R SG  R S   T+GYK RR+AID GI L+T++KC K F+QAL   +  K+  + S  +DC+TS+ + R PG+VDIHVH R+PG  HKEDW+T +KAA+AGG+TTI AMPNT+P + + +SF   ++ AS+ +  DY LY+GA+ +N +  AE A +A GLKMYLN TFSTL+M+N S WAKH   FP NRPI CHAE +T+AA++ +AQ+ NR VHI HV+   EI L++ AK +G  VTCEV PHH
Sbjct:  759 SVGEVMGIGRCFEEALQKALRMVSDHADGFSPYTFSRPTTADDLSKPTDKRMFALARGMYYGDFDVEKAHELTRIDRWFLFRMQNIVDIYHRLEKTDVNTVSAELLLEAKQAGFSDRQIAKKIGSNEYTVREARFVKGITPCVKQIDTVAGEWPAQTNYLYTTFNGIENDVSFNMKNAVMVLGSGVYRIGSSVEFDSSCVGCIRELKALGYSTITVNCNPETVSTDYDICDRLYFEEISFETVLDVYHLEKPKGVILAFGGQAPNNIAMSLSRAQVKIFGTSPNDIDNAEDRFKFSRKLESLKISQPQWKKSENMEDAKNFCAQVGYPCLIRPSYVLSGAAMNVAHNAEDLEVFLKQAAVVAKEHPVVVSKFINEAKELDVDAVALDGKLVVMAVSEHIENAGVHSGDATLVTPAQDMNKLTLDRIKDITFRIAEAFNVNGPFNMQLIAKNNELKVIECNLRVSRSFPFVSKTLDYDFVALATRAMMASDSPAIRATIKPTATLLKGK-GRVGVKVPQFSFSRLAGADVMLGVEMASTGEVACFGTSRCDAYLKALLSTGFVVPKQ--NIFISIGGYHAKAEMLKSVEALLKLGYELYGSKGTADYFQSNKINVKPVDWPF-EEGSSDEKTASGTRSVVEFLENKEFHLVINLPIRGSGAYRVSAFRTHGYKTRRMAIDNGIPLITDIKCAKTFIQALE--MVGKRPTMNS-LVDCVTSKSLKRLPGMVDIHVHVREPGATHKEDWATCSKAALAGGVTTILAMPNTSPVLVDTDSFYQTEQLASAKSVVDYALYIGATPNNSKFAAEFADKAAGLKMYLNETFSTLKMDNISDWAKHLSAFPANRPIVCHAEKQTLAAILCMAQMANRAVHIAHVATADEINLVKEAKQRGWNVTCEVCPHH 1654          

HSP 2 Score: 874.004 bits (2257), Expect = 0.000e+0
Identity = 470/774 (60.72%), Postives = 578/774 (74.68%), Query Frame = 2
Query:   35 MKGALILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLIVNEYSL--EYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLINPLNNPEL-FIDPNERNLVEEVSINEIRHYNKNGNIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNAD-EYDALFISNGPGDPVKCTETIETIKNWIT-SEKPFMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVTAVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKPKKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
            M+  L L D + ++G+++GA K   GE+VFQTGMVGY ESL+DPSY  QLL LTYP+IG+YGV   ++LDQ+ LP  FES +I    LIV +  +  E+S+W A  +LS+WL K  V  +SGID R L KK+RE G++       K KL+I   N     ++D N  NLV+ VS  E   Y  +G+  +  +DCG+KNNQIRC  K G RV V+P+N  ++ + +YD LF+SNGPGDP  C   ++ +   I   +KP  GICLGHQ+L+ AIG KT+K+KYGNRGHNQPCTH  T RC++TSQNHG+AV   S+P +W+ LF NENDK+NEGI+H   PF SVQFHPEH +GPTD E LF VF + V   KS T  +++DQ LT  +T+    H          + +K+L+LGSGGL+IGQAGEFDYSGAQALKALREEGI+TVL+NPNIATVQT+ G AD +Y LPITK+YVT+VIK ERP G+  TFGGQTALNC I+L + G+F+ Y V VLGT I TI  TEDR  F++ +  I E+VAPS AA T++  I+AAE+LGYPV++RAA+ALGGLGSGFA+N  EL+ +A  A AH++QVLVDKSL+GWKE+EYEVVRD YDNCITVCNMENVDPLGIHTGESVVVAPSQTLS+ EY  LR CA+KV+R+LG++GECNIQYALDP S  YYIIEVNARLSRSSALASKATGYPLAYVAAKL LG  L  +RNSVT  TTACFEPS+DYCVVKIPRWDL KF +V  +I SSM
Sbjct:    1 MRATLHLEDGSTFVGSIYGATKSVVGEIVFQTGMVGYVESLTDPSYAKQLLTLTYPLIGNYGVPSAEILDQFKLPAEFESDRIWPAALIVEKICVDGEHSHWQAVQSLSEWLRKADVPCLSGIDVRQLVKKIRETGTM-------KAKLVIESDNAQNFDYVDVNAENLVDFVSRKEPVVYG-SGDQTILAVDCGLKNNQIRCLAKRGFRVKVVPWNHPIDTESDYDGLFLSNGPGDPEICAPLVDRLAKVIARGDKPIFGICLGHQILSRAIGAKTYKLKYGNRGHNQPCTHYATGRCYITSQNHGYAVDPDSLPADWKALFTNENDKTNEGIVHSSKPFFSVQFHPEHTAGPTDCEFLFDVFADSVRQAKSGT-FMNVDQELTRLMTFTPIYHA--------KEQRKVLVLGSGGLTIGQAGEFDYSGAQALKALREEGIRTVLINPNIATVQTSKGFADFTYFLPITKEYVTDVIKKERPTGILCTFGGQTALNCAIDLYKDGIFEQYDVQVLGTQINTIMKTEDRDLFNQEISAIGEKVAPSKAATTMEGAIEAAEELGYPVLVRAAYALGGLGSGFADNREELIAIAQQALAHSNQVLVDKSLKGWKEVEYEVVRDAYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSDREYNALRTCAIKVIRHLGIIGECNIQYALDPYSLTYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGQHLPVIRNSVTGTTTACFEPSLDYCVVKIPRWDLGKFARVSTQIGSSM 757          

HSP 3 Score: 143.28 bits (360), Expect = 9.574e-34
Identity = 110/388 (28.35%), Postives = 184/388 (47.42%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKI------PIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAV--AYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNL--LVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRG------EP--NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            ++VLGSG   IG + EFD+   + +K L+    +T+++N N  TV T     D  +F  ++ E V D+   E+P G++ + GGQ   N A+ L+++ I       + GT    I   E+R  F++ + +IG      K  T  E AI    ++ YP LVR +Y L G     A +  +L     QA+A    + V++ K ++  KE++ + V  AY    +     E+V+  GIH+G++ +V P Q ++++    +     ++ + L + G  N+Q      +L   +IE N R+SRS    SKA GY +   A +  + +   +    + G      EP  +   VK+P +   +       +G  M S GEV   G    EA  KA
Sbjct:  393 VLVLGSGGLTIGQAGEFDYSGAQALKALREEGIRTVLINPNIATVQTSKGFADFTYFLPITKEYVTDVIKKERPTGILCTFGGQTALNCAIDLYKDGIFEQYDVQVLGTQINTIMKTEDRDLFNQEISAIGEKVAPSKAATTMEGAIEAAEELGYPVLVRAAYALGGLGSGFADNREELIAIAQQALA--HSNQVLVDKSLKGWKEVEYEVVRDAY-DNCITVCNMENVDPLGIHTGESVVVAPSQTLSDREYNALRTCAIKVIRHLGIIGECNIQYALDPYSLTYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGQHLPVIRNSVTGTTTACFEPSLDYCVVKIPRWDLGKFARVSTQIGSSMKSVGEVMGIGRCFEEALQKA 777          

HSP 4 Score: 105.145 bits (261), Expect = 4.236e-22
Identity = 91/342 (26.61%), Postives = 158/342 (46.20%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTEL--LDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFT 2311
            EFD S    ++ L+  G  T+ VN N  TV T   + D+ Y   I+ + V +V  +E+P GV L FGGQ   N  + L  +      +V + GTS   I   EDR +FS  LE +K        +  +++  +   Q+GYP +IR ++ L G     A+N  +L      +A  A    V+V K +   KE++ + V  +    + +   E+++  G+H+G++ +V P+Q ++      ++    ++     V G  N+Q     N  K  +IE N R+SRS    SK   Y    +A +  +     ++R ++    TA          VK+P++  ++  
Sbjct:  952 EFDSSCVGCIRELKALGYSTITVNCNPETVSTDYDICDRLYFEEISFETVLDVYHLEKPKGVILAFGGQAPNNIAMSLSRA------QVKIFGTSPNDIDNAEDRFKFSRKLESLKISQPQWKKSENMEDAKNFCAQVGYPCLIRPSYVLSGAAMNVAHNAEDLEVFLKQAAVVAKEHPVVVSKFINEAKELDVDAVA-LDGKLVVMAVSEHIENAGVHSGDATLVTPAQDMNKLTLDRIKDITFRIAEAFNVNGPFNMQLIAKNNELK--VIECNLRVSRSFPFVSKTLDYDFVALATRAMMASDSPAIRATIK--PTATLLKGKGRVGVKVPQFSFSRLA 1282          
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Fly
Match: r (gene:FBgn0003189 transcript:FBtr0089734)

HSP 1 Score: 1031.55 bits (2666), Expect = 0.000e+0
Identity = 516/897 (57.53%), Postives = 665/897 (74.14%), Query Frame = 3
Query: 2346 SVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYV-----EKFTESGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKIIKCLNELEEPRTYLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMS---EPFSLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDWDTGNQASSD--SKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQALRKAIYKKKICVASPTIDCITSQKIYRFPGLVDIHVHTRDPGQVHKEDWSTVTKXXXXXXXXXXFAMPNTAPPITNLESFELAKKRASSLAHCDYGLYVGASNDNWESLAELAPEAIGLKMYLNPTFSTLQMNNFSTWAKHFKHFPENRPICCHAEGETMAAVILLAQLHNRHVHICHVSRKQEIELIRLAKSQGLKVTCEVSPHH 5006
            SVGE+M++GR FEEAFQKALRMVD  + GFDP V     E+  E  LS PTDRR  V+A AL+ G+S++E++ LT IDYWFL K  +II   + L    +     +LL AK  GFSD QIA+ +KSTE+AVR  R E G+RP V QIDTV+ EWP  TNYLY +Y+G +HD+ F GG+ +V+GSGVYRIGSSVEFDWCAV C++EL+++++ TIM+N NPETVSTDYDMCD L+FEE+S E V+DI+ +E  +G+I+SMGGQLPNNIAM LHR++  + GTSP  ID AENRFKFSRMLD  GI QP+WKELT+ +SAI FC +V YPCLVRPSYVLSGAAMNVA+S  DL  YL  A  V+++HPVVISKF+ +AKEIDVDAVA  G++L  AVSEHVENAG+HSGDATLVTPPQD+N +TL+ I +I  ++A  L V+GPFNMQLIAK++ L VIECN+RVSRSFPFVSK L ++ +A ATRAI+    EP     + L G   KV VKVP FSF+RL GADV LGVEM STGEVACFG++R EA+LKA ++ G +IP+    + +SIGS+KHK ELL S+R L  +GY LYAS+GT DFY E G++V +V W        D   + +  ++++   + DL+INLP    G RR S  +T+GY+ RRLA+DY I L+T+VKCTKL V+++R    K  +   +   DC+TS++I + PG +D+HVH R+PG  HKED+++ T AA+AGG+T + AMPNT P I + E+F   ++ A + A CDY LYVGAS+DNW  + ELA  A GLKMYLN TF TL++++ ++W +H  H+P+  PI CHAE ++ AAVI+LA L +R VHICHV+RK+EI+LIR AK +G+KVTCEV PHH
Sbjct:  772 SVGEVMAIGRNFEEAFQKALRMVDSDVLGFDPDVVPLNKEQLAEQ-LSEPTDRRPFVIAAALQLGMSLRELHQLTNIDYWFLEKLERIILLQSLLTRNGSRTDAALLLKAKRFGFSDKQIAKYIKSTELAVRHQRQEFGIRPHVKQIDTVAGEWPASTNYLYHTYNGSEHDVDFPGGHTIVVGSGVYRIGSSVEFDWCAVGCLRELRKLQRPTIMINYNPETVSTDYDMCDRLYFEEISFEVVMDIYEMENSEGIILSMGGQLPNNIAMDLHRQQAKVLGTSPESIDCAENRFKFSRMLDRKGILQPRWKELTNLQSAIEFCEEVGYPCLVRPSYVLSGAAMNVAYSNQDLETYLNAASEVSREHPVVISKFLTEAKEIDVDAVASDGRILCMAVSEHVENAGVHSGDATLVTPPQDLNAETLEAIKRITCDLASVLDVTGPFNMQLIAKNNELKVIECNVRVSRSFPFVSKTLDHDFVATATRAIVGLDVEPL----DVLHGV-GKVGVKVPQFSFSRLAGADVQLGVEMASTGEVACFGDNRYEAYLKAMMSTGFQIPK--NAVLLSIGSFKHKMELLPSIRDLAKMGYKLYASMGTGDFYAEHGVNVESVQWTFDKTTPDDINGELRHLAEFLANKQFDLVINLPMSGGGARRVSSFMTHGYRTRRLAVDYSIPLVTDVKCTKLLVESMRMNGGKPPMKTHT---DCMTSRRIVKLPGFIDVHVHLREPGATHKEDFASGTAAALAGGVTLVCAMPNTNPSIVDRETFTQFQELAKAGARCDYALYVGASDDNWAQVNELASHACGLKMYLNDTFGTLKLSDMTSWQRHLSHWPKRSPIVCHAERQSTAAVIMLAHLLDRSVHICHVARKEEIQLIRSAKEKGVKVTCEVCPHH 1657          

HSP 2 Score: 845.499 bits (2183), Expect = 0.000e+0
Identity = 471/778 (60.54%), Postives = 573/778 (73.65%), Query Frame = 2
Query:   47 LILSDETVYIGNLFGAI------KQG-KGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGV-SDDKMLDQWGLPKSFESAK--IHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLINPLNNPELFIDPNERNLVEEVSINEIRHY-NKNG-NIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNADEYDALFISNGPGDPVKCTETIETIKNWIT-SEKPFMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVTAVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKPKKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
            L L D TV  G  FG +      K G  GEVVFQTGMVGYTE+L+D SY  Q+LVLTYP+IG+YGV + D+  D+ GLP  FE  K  + AT L+V E + E  +W    TL  WL++H V GI  IDTR LTKKLRE GS+ G IV  K  +   P ++   F+DPN RNL +E S+ E + Y N NG    + I+DCG+K NQ+RC  + GA VT++P++A +  +++DALF+SNGPG+P  C + ++ ++  I   +KP  GICLGHQLLA AIGC T+KMKYGNRGHN PC H  T RC MTSQNHG+AV    +PD W ELF N ND +NEGI+H   P+ SVQFHPEH +GP D E LF VF+E +   K  T    ++QRL      + T   +    ++   P+K+LILGSGGLSIGQAGEFDYSG+QA+KA+RE  IQTVL+NPNIATVQT+ G+ADK Y LP+T  YV +VIK ERP+GV LTFGGQTALNCG++LE +GVF  Y V +LGT I++I  TEDR+ F+E + EI E+VAPS A Y+V + +DAA +LGYPVM RAAF+LGGLGSGFANN  EL  LA  A AH+SQ++VDKSL+GWKE+EYEVVRD Y+NCITVCNMEN DPLGIHTGES+VVAPSQTLS+ EY MLR  ALKV+R+ GVVGECNIQYAL P+S +YYIIEVNARLSRSSALASKATGYPLAYVAAKL LG+ L  ++NSVT  TTACFEPS+DYCVVKIPRWDL KF +V   I SSM
Sbjct:    8 LALEDGTVLPGYSFGYVPSENESKVGFGGEVVFQTGMVGYTEALTDRSYSGQILVLTYPLIGNYGVPAPDE--DEHGLPLHFEWMKGVVQATALVVGEVAEEAFHWRKWKTLPDWLKQHKVPGIQDIDTRALTKKLREQGSMLGKIVYEKPPVEGLPKSS---FVDPNVRNLAKECSVKERQVYGNPNGKGPRIAILDCGLKLNQLRCLLQRGASVTLLPWSARLEDEQFDALFLSNGPGNPESCDQIVQQVRKVIEEGQKPVFGICLGHQLLAKAIGCSTYKMKYGNRGHNLPCLHRATGRCLMTSQNHGYAVDLEQLPDGWSELFVNANDGTNEGIVHASKPYFSVQFHPEHHAGPQDTEFLFDVFMESIQQ-KDLTIPQLIEQRL------RPTTPAIDSAPVM---PRKVLILGSGGLSIGQAGEFDYSGSQAIKAMRESNIQTVLINPNIATVQTSKGMADKCYFLPLTPHYVEQVIKSERPNGVLLTFGGQTALNCGVQLERAGVFSKYNVRILGTPIQSIIETEDRKLFAERVNEIGEQVAPSEAVYSVAQALDAASRLGYPVMARAAFSLGGLGSGFANNEEELQSLAQQALAHSSQLIVDKSLKGWKEVEYEVVRDAYNNCITVCNMENFDPLGIHTGESIVVAPSQTLSDREYQMLRSTALKVIRHFGVVGECNIQYALCPHSEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGLPLPDIKNSVTGNTTACFEPSLDYCVVKIPRWDLAKFVRVSKHIGSSM 770          

HSP 3 Score: 139.043 bits (349), Expect = 2.525e-32
Identity = 106/388 (27.32%), Postives = 182/388 (46.91%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHRE------KIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAV--AYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQ--LIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRG------EP--NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            +++LGSG   IG + EFD+   + IK ++    +T+++N N  TV T   M D  +F  L+   V  +   E+P+GV+++ GGQ   N  + L R        + I GT    I   E+R  F+  ++ IG      + +     A++  + + YP + R ++ L G     A +E +L     QA+A +    +++ K ++  KE++ + V  AY    +     E+ +  GIH+G++ +V P Q ++++  Q +     ++ +   V G  N+Q  L    +   +IE N R+SRS    SKA GY +   A +  +  P       + G      EP  +   VK+P +  A+       +G  M S GEV   G +  EAF KA
Sbjct:  406 VLILGSGGLSIGQAGEFDYSGSQAIKAMRESNIQTVLINPNIATVQTSKGMADKCYFLPLTPHYVEQVIKSERPNGVLLTFGGQTALNCGVQLERAGVFSKYNVRILGTPIQSIIETEDRKLFAERVNEIGEQVAPSEAVYSVAQALDAASRLGYPVMARAAFSLGGLGSGFANNEEELQSLAQQALAHSSQ--LIVDKSLKGWKEVEYEVVRDAY-NNCITVCNMENFDPLGIHTGESIVVAPSQTLSDREYQMLRSTALKVIRHFGVVGECNIQYALCPHSEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGLPLPDIKNSVTGNTTACFEPSLDYCVVKIPRWDLAKFVRVSKHIGSSMKSVGEVMAIGRNFEEAFQKA 790          

HSP 4 Score: 98.9821 bits (245), Expect = 3.263e-20
Identity = 78/278 (28.06%), Postives = 137/278 (49.28%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYT-VKECIDAAEQLGYPVMIRXX--XXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYE-VVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVN 2113
            EFD+     L+ LR+    T+++N N  TV T   + D+ Y   I+ + V ++ +ME  +G+ L+ GGQ   N  ++L         +  VLGTS E+I   E+R +FS +L+  K  + P     T ++  I+  E++GYP ++R +   +   +   ++N   E    A++  +    V++ K L   KEI+ + V  D    C+ V   E+V+  G+H+G++ +V P Q L+      +++    +   L V G  N+Q     N  K  +IE N
Sbjct:  964 EFDWCAVGCLRELRKLQRPTIMINYNPETVSTDYDMCDRLYFEEISFEVVMDIYEMENSEGIILSMGGQLPNNIAMDLHRQ------QAKVLGTSPESIDCAENRFKFSRMLDR-KGILQPRWKELTNLQSAIEFCEEVGYPCLVRPSYVLSGAAMNVAYSNQDLETYLNAASEVSREHPVVISKFLTEAKEIDVDAVASDGRILCMAVS--EHVENAGVHSGDATLVTPPQDLNAETLEAIKRITCDLASVLDVTGPFNMQLIAKNNELK--VIECN 1230          
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Fly
Match: r (gene:FBgn0003189 transcript:FBtr0340156)

HSP 1 Score: 1031.55 bits (2666), Expect = 0.000e+0
Identity = 516/897 (57.53%), Postives = 665/897 (74.14%), Query Frame = 3
Query: 2346 SVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYV-----EKFTESGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKIIKCLNELEEPRTYLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMS---EPFSLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDWDTGNQASSD--SKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQALRKAIYKKKICVASPTIDCITSQKIYRFPGLVDIHVHTRDPGQVHKEDWSTVTKXXXXXXXXXXFAMPNTAPPITNLESFELAKKRASSLAHCDYGLYVGASNDNWESLAELAPEAIGLKMYLNPTFSTLQMNNFSTWAKHFKHFPENRPICCHAEGETMAAVILLAQLHNRHVHICHVSRKQEIELIRLAKSQGLKVTCEVSPHH 5006
            SVGE+M++GR FEEAFQKALRMVD  + GFDP V     E+  E  LS PTDRR  V+A AL+ G+S++E++ LT IDYWFL K  +II   + L    +     +LL AK  GFSD QIA+ +KSTE+AVR  R E G+RP V QIDTV+ EWP  TNYLY +Y+G +HD+ F GG+ +V+GSGVYRIGSSVEFDWCAV C++EL+++++ TIM+N NPETVSTDYDMCD L+FEE+S E V+DI+ +E  +G+I+SMGGQLPNNIAM LHR++  + GTSP  ID AENRFKFSRMLD  GI QP+WKELT+ +SAI FC +V YPCLVRPSYVLSGAAMNVA+S  DL  YL  A  V+++HPVVISKF+ +AKEIDVDAVA  G++L  AVSEHVENAG+HSGDATLVTPPQD+N +TL+ I +I  ++A  L V+GPFNMQLIAK++ L VIECN+RVSRSFPFVSK L ++ +A ATRAI+    EP     + L G   KV VKVP FSF+RL GADV LGVEM STGEVACFG++R EA+LKA ++ G +IP+    + +SIGS+KHK ELL S+R L  +GY LYAS+GT DFY E G++V +V W        D   + +  ++++   + DL+INLP    G RR S  +T+GY+ RRLA+DY I L+T+VKCTKL V+++R    K  +   +   DC+TS++I + PG +D+HVH R+PG  HKED+++ T AA+AGG+T + AMPNT P I + E+F   ++ A + A CDY LYVGAS+DNW  + ELA  A GLKMYLN TF TL++++ ++W +H  H+P+  PI CHAE ++ AAVI+LA L +R VHICHV+RK+EI+LIR AK +G+KVTCEV PHH
Sbjct:  772 SVGEVMAIGRNFEEAFQKALRMVDSDVLGFDPDVVPLNKEQLAEQ-LSEPTDRRPFVIAAALQLGMSLRELHQLTNIDYWFLEKLERIILLQSLLTRNGSRTDAALLLKAKRFGFSDKQIAKYIKSTELAVRHQRQEFGIRPHVKQIDTVAGEWPASTNYLYHTYNGSEHDVDFPGGHTIVVGSGVYRIGSSVEFDWCAVGCLRELRKLQRPTIMINYNPETVSTDYDMCDRLYFEEISFEVVMDIYEMENSEGIILSMGGQLPNNIAMDLHRQQAKVLGTSPESIDCAENRFKFSRMLDRKGILQPRWKELTNLQSAIEFCEEVGYPCLVRPSYVLSGAAMNVAYSNQDLETYLNAASEVSREHPVVISKFLTEAKEIDVDAVASDGRILCMAVSEHVENAGVHSGDATLVTPPQDLNAETLEAIKRITCDLASVLDVTGPFNMQLIAKNNELKVIECNVRVSRSFPFVSKTLDHDFVATATRAIVGLDVEPL----DVLHGV-GKVGVKVPQFSFSRLAGADVQLGVEMASTGEVACFGDNRYEAYLKAMMSTGFQIPK--NAVLLSIGSFKHKMELLPSIRDLAKMGYKLYASMGTGDFYAEHGVNVESVQWTFDKTTPDDINGELRHLAEFLANKQFDLVINLPMSGGGARRVSSFMTHGYRTRRLAVDYSIPLVTDVKCTKLLVESMRMNGGKPPMKTHT---DCMTSRRIVKLPGFIDVHVHLREPGATHKEDFASGTAAALAGGVTLVCAMPNTNPSIVDRETFTQFQELAKAGARCDYALYVGASDDNWAQVNELASHACGLKMYLNDTFGTLKLSDMTSWQRHLSHWPKRSPIVCHAERQSTAAVIMLAHLLDRSVHICHVARKEEIQLIRSAKEKGVKVTCEVCPHH 1657          

HSP 2 Score: 845.499 bits (2183), Expect = 0.000e+0
Identity = 471/778 (60.54%), Postives = 573/778 (73.65%), Query Frame = 2
Query:   47 LILSDETVYIGNLFGAI------KQG-KGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGV-SDDKMLDQWGLPKSFESAK--IHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLINPLNNPELFIDPNERNLVEEVSINEIRHY-NKNG-NIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNADEYDALFISNGPGDPVKCTETIETIKNWIT-SEKPFMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVTAVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKPKKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
            L L D TV  G  FG +      K G  GEVVFQTGMVGYTE+L+D SY  Q+LVLTYP+IG+YGV + D+  D+ GLP  FE  K  + AT L+V E + E  +W    TL  WL++H V GI  IDTR LTKKLRE GS+ G IV  K  +   P ++   F+DPN RNL +E S+ E + Y N NG    + I+DCG+K NQ+RC  + GA VT++P++A +  +++DALF+SNGPG+P  C + ++ ++  I   +KP  GICLGHQLLA AIGC T+KMKYGNRGHN PC H  T RC MTSQNHG+AV    +PD W ELF N ND +NEGI+H   P+ SVQFHPEH +GP D E LF VF+E +   K  T    ++QRL      + T   +    ++   P+K+LILGSGGLSIGQAGEFDYSG+QA+KA+RE  IQTVL+NPNIATVQT+ G+ADK Y LP+T  YV +VIK ERP+GV LTFGGQTALNCG++LE +GVF  Y V +LGT I++I  TEDR+ F+E + EI E+VAPS A Y+V + +DAA +LGYPVM RAAF+LGGLGSGFANN  EL  LA  A AH+SQ++VDKSL+GWKE+EYEVVRD Y+NCITVCNMEN DPLGIHTGES+VVAPSQTLS+ EY MLR  ALKV+R+ GVVGECNIQYAL P+S +YYIIEVNARLSRSSALASKATGYPLAYVAAKL LG+ L  ++NSVT  TTACFEPS+DYCVVKIPRWDL KF +V   I SSM
Sbjct:    8 LALEDGTVLPGYSFGYVPSENESKVGFGGEVVFQTGMVGYTEALTDRSYSGQILVLTYPLIGNYGVPAPDE--DEHGLPLHFEWMKGVVQATALVVGEVAEEAFHWRKWKTLPDWLKQHKVPGIQDIDTRALTKKLREQGSMLGKIVYEKPPVEGLPKSS---FVDPNVRNLAKECSVKERQVYGNPNGKGPRIAILDCGLKLNQLRCLLQRGASVTLLPWSARLEDEQFDALFLSNGPGNPESCDQIVQQVRKVIEEGQKPVFGICLGHQLLAKAIGCSTYKMKYGNRGHNLPCLHRATGRCLMTSQNHGYAVDLEQLPDGWSELFVNANDGTNEGIVHASKPYFSVQFHPEHHAGPQDTEFLFDVFMESIQQ-KDLTIPQLIEQRL------RPTTPAIDSAPVM---PRKVLILGSGGLSIGQAGEFDYSGSQAIKAMRESNIQTVLINPNIATVQTSKGMADKCYFLPLTPHYVEQVIKSERPNGVLLTFGGQTALNCGVQLERAGVFSKYNVRILGTPIQSIIETEDRKLFAERVNEIGEQVAPSEAVYSVAQALDAASRLGYPVMARAAFSLGGLGSGFANNEEELQSLAQQALAHSSQLIVDKSLKGWKEVEYEVVRDAYNNCITVCNMENFDPLGIHTGESIVVAPSQTLSDREYQMLRSTALKVIRHFGVVGECNIQYALCPHSEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGLPLPDIKNSVTGNTTACFEPSLDYCVVKIPRWDLAKFVRVSKHIGSSM 770          

HSP 3 Score: 139.043 bits (349), Expect = 2.525e-32
Identity = 106/388 (27.32%), Postives = 182/388 (46.91%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHRE------KIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAV--AYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQ--LIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRG------EP--NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            +++LGSG   IG + EFD+   + IK ++    +T+++N N  TV T   M D  +F  L+   V  +   E+P+GV+++ GGQ   N  + L R        + I GT    I   E+R  F+  ++ IG      + +     A++  + + YP + R ++ L G     A +E +L     QA+A +    +++ K ++  KE++ + V  AY    +     E+ +  GIH+G++ +V P Q ++++  Q +     ++ +   V G  N+Q  L    +   +IE N R+SRS    SKA GY +   A +  +  P       + G      EP  +   VK+P +  A+       +G  M S GEV   G +  EAF KA
Sbjct:  406 VLILGSGGLSIGQAGEFDYSGSQAIKAMRESNIQTVLINPNIATVQTSKGMADKCYFLPLTPHYVEQVIKSERPNGVLLTFGGQTALNCGVQLERAGVFSKYNVRILGTPIQSIIETEDRKLFAERVNEIGEQVAPSEAVYSVAQALDAASRLGYPVMARAAFSLGGLGSGFANNEEELQSLAQQALAHSSQ--LIVDKSLKGWKEVEYEVVRDAY-NNCITVCNMENFDPLGIHTGESIVVAPSQTLSDREYQMLRSTALKVIRHFGVVGECNIQYALCPHSEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGLPLPDIKNSVTGNTTACFEPSLDYCVVKIPRWDLAKFVRVSKHIGSSMKSVGEVMAIGRNFEEAFQKA 790          

HSP 4 Score: 98.9821 bits (245), Expect = 3.263e-20
Identity = 78/278 (28.06%), Postives = 137/278 (49.28%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYT-VKECIDAAEQLGYPVMIRXX--XXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYE-VVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVN 2113
            EFD+     L+ LR+    T+++N N  TV T   + D+ Y   I+ + V ++ +ME  +G+ L+ GGQ   N  ++L         +  VLGTS E+I   E+R +FS +L+  K  + P     T ++  I+  E++GYP ++R +   +   +   ++N   E    A++  +    V++ K L   KEI+ + V  D    C+ V   E+V+  G+H+G++ +V P Q L+      +++    +   L V G  N+Q     N  K  +IE N
Sbjct:  964 EFDWCAVGCLRELRKLQRPTIMINYNPETVSTDYDMCDRLYFEEISFEVVMDIYEMENSEGIILSMGGQLPNNIAMDLHRQ------QAKVLGTSPESIDCAENRFKFSRMLDR-KGILQPRWKELTNLQSAIEFCEEVGYPCLVRPSYVLSGAAMNVAYSNQDLETYLNAASEVSREHPVVISKFLTEAKEIDVDAVASDGRILCMAVS--EHVENAGVHSGDATLVTPPQDLNAETLEAIKRITCDLASVLDVTGPFNMQLIAKNNELK--VIECN 1230          
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Fly
Match: r (gene:FBgn0003189 transcript:FBtr0340155)

HSP 1 Score: 1031.55 bits (2666), Expect = 0.000e+0
Identity = 516/897 (57.53%), Postives = 665/897 (74.14%), Query Frame = 3
Query: 2346 SVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYV-----EKFTESGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKIIKCLNELEEPRTYLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMS---EPFSLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDWDTGNQASSD--SKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQALRKAIYKKKICVASPTIDCITSQKIYRFPGLVDIHVHTRDPGQVHKEDWSTVTKXXXXXXXXXXFAMPNTAPPITNLESFELAKKRASSLAHCDYGLYVGASNDNWESLAELAPEAIGLKMYLNPTFSTLQMNNFSTWAKHFKHFPENRPICCHAEGETMAAVILLAQLHNRHVHICHVSRKQEIELIRLAKSQGLKVTCEVSPHH 5006
            SVGE+M++GR FEEAFQKALRMVD  + GFDP V     E+  E  LS PTDRR  V+A AL+ G+S++E++ LT IDYWFL K  +II   + L    +     +LL AK  GFSD QIA+ +KSTE+AVR  R E G+RP V QIDTV+ EWP  TNYLY +Y+G +HD+ F GG+ +V+GSGVYRIGSSVEFDWCAV C++EL+++++ TIM+N NPETVSTDYDMCD L+FEE+S E V+DI+ +E  +G+I+SMGGQLPNNIAM LHR++  + GTSP  ID AENRFKFSRMLD  GI QP+WKELT+ +SAI FC +V YPCLVRPSYVLSGAAMNVA+S  DL  YL  A  V+++HPVVISKF+ +AKEIDVDAVA  G++L  AVSEHVENAG+HSGDATLVTPPQD+N +TL+ I +I  ++A  L V+GPFNMQLIAK++ L VIECN+RVSRSFPFVSK L ++ +A ATRAI+    EP     + L G   KV VKVP FSF+RL GADV LGVEM STGEVACFG++R EA+LKA ++ G +IP+    + +SIGS+KHK ELL S+R L  +GY LYAS+GT DFY E G++V +V W        D   + +  ++++   + DL+INLP    G RR S  +T+GY+ RRLA+DY I L+T+VKCTKL V+++R    K  +   +   DC+TS++I + PG +D+HVH R+PG  HKED+++ T AA+AGG+T + AMPNT P I + E+F   ++ A + A CDY LYVGAS+DNW  + ELA  A GLKMYLN TF TL++++ ++W +H  H+P+  PI CHAE ++ AAVI+LA L +R VHICHV+RK+EI+LIR AK +G+KVTCEV PHH
Sbjct:  772 SVGEVMAIGRNFEEAFQKALRMVDSDVLGFDPDVVPLNKEQLAEQ-LSEPTDRRPFVIAAALQLGMSLRELHQLTNIDYWFLEKLERIILLQSLLTRNGSRTDAALLLKAKRFGFSDKQIAKYIKSTELAVRHQRQEFGIRPHVKQIDTVAGEWPASTNYLYHTYNGSEHDVDFPGGHTIVVGSGVYRIGSSVEFDWCAVGCLRELRKLQRPTIMINYNPETVSTDYDMCDRLYFEEISFEVVMDIYEMENSEGIILSMGGQLPNNIAMDLHRQQAKVLGTSPESIDCAENRFKFSRMLDRKGILQPRWKELTNLQSAIEFCEEVGYPCLVRPSYVLSGAAMNVAYSNQDLETYLNAASEVSREHPVVISKFLTEAKEIDVDAVASDGRILCMAVSEHVENAGVHSGDATLVTPPQDLNAETLEAIKRITCDLASVLDVTGPFNMQLIAKNNELKVIECNVRVSRSFPFVSKTLDHDFVATATRAIVGLDVEPL----DVLHGV-GKVGVKVPQFSFSRLAGADVQLGVEMASTGEVACFGDNRYEAYLKAMMSTGFQIPK--NAVLLSIGSFKHKMELLPSIRDLAKMGYKLYASMGTGDFYAEHGVNVESVQWTFDKTTPDDINGELRHLAEFLANKQFDLVINLPMSGGGARRVSSFMTHGYRTRRLAVDYSIPLVTDVKCTKLLVESMRMNGGKPPMKTHT---DCMTSRRIVKLPGFIDVHVHLREPGATHKEDFASGTAAALAGGVTLVCAMPNTNPSIVDRETFTQFQELAKAGARCDYALYVGASDDNWAQVNELASHACGLKMYLNDTFGTLKLSDMTSWQRHLSHWPKRSPIVCHAERQSTAAVIMLAHLLDRSVHICHVARKEEIQLIRSAKEKGVKVTCEVCPHH 1657          

HSP 2 Score: 845.499 bits (2183), Expect = 0.000e+0
Identity = 471/778 (60.54%), Postives = 573/778 (73.65%), Query Frame = 2
Query:   47 LILSDETVYIGNLFGAI------KQG-KGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGV-SDDKMLDQWGLPKSFESAK--IHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLINPLNNPELFIDPNERNLVEEVSINEIRHY-NKNG-NIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNADEYDALFISNGPGDPVKCTETIETIKNWIT-SEKPFMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVTAVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKPKKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
            L L D TV  G  FG +      K G  GEVVFQTGMVGYTE+L+D SY  Q+LVLTYP+IG+YGV + D+  D+ GLP  FE  K  + AT L+V E + E  +W    TL  WL++H V GI  IDTR LTKKLRE GS+ G IV  K  +   P ++   F+DPN RNL +E S+ E + Y N NG    + I+DCG+K NQ+RC  + GA VT++P++A +  +++DALF+SNGPG+P  C + ++ ++  I   +KP  GICLGHQLLA AIGC T+KMKYGNRGHN PC H  T RC MTSQNHG+AV    +PD W ELF N ND +NEGI+H   P+ SVQFHPEH +GP D E LF VF+E +   K  T    ++QRL      + T   +    ++   P+K+LILGSGGLSIGQAGEFDYSG+QA+KA+RE  IQTVL+NPNIATVQT+ G+ADK Y LP+T  YV +VIK ERP+GV LTFGGQTALNCG++LE +GVF  Y V +LGT I++I  TEDR+ F+E + EI E+VAPS A Y+V + +DAA +LGYPVM RAAF+LGGLGSGFANN  EL  LA  A AH+SQ++VDKSL+GWKE+EYEVVRD Y+NCITVCNMEN DPLGIHTGES+VVAPSQTLS+ EY MLR  ALKV+R+ GVVGECNIQYAL P+S +YYIIEVNARLSRSSALASKATGYPLAYVAAKL LG+ L  ++NSVT  TTACFEPS+DYCVVKIPRWDL KF +V   I SSM
Sbjct:    8 LALEDGTVLPGYSFGYVPSENESKVGFGGEVVFQTGMVGYTEALTDRSYSGQILVLTYPLIGNYGVPAPDE--DEHGLPLHFEWMKGVVQATALVVGEVAEEAFHWRKWKTLPDWLKQHKVPGIQDIDTRALTKKLREQGSMLGKIVYEKPPVEGLPKSS---FVDPNVRNLAKECSVKERQVYGNPNGKGPRIAILDCGLKLNQLRCLLQRGASVTLLPWSARLEDEQFDALFLSNGPGNPESCDQIVQQVRKVIEEGQKPVFGICLGHQLLAKAIGCSTYKMKYGNRGHNLPCLHRATGRCLMTSQNHGYAVDLEQLPDGWSELFVNANDGTNEGIVHASKPYFSVQFHPEHHAGPQDTEFLFDVFMESIQQ-KDLTIPQLIEQRL------RPTTPAIDSAPVM---PRKVLILGSGGLSIGQAGEFDYSGSQAIKAMRESNIQTVLINPNIATVQTSKGMADKCYFLPLTPHYVEQVIKSERPNGVLLTFGGQTALNCGVQLERAGVFSKYNVRILGTPIQSIIETEDRKLFAERVNEIGEQVAPSEAVYSVAQALDAASRLGYPVMARAAFSLGGLGSGFANNEEELQSLAQQALAHSSQLIVDKSLKGWKEVEYEVVRDAYNNCITVCNMENFDPLGIHTGESIVVAPSQTLSDREYQMLRSTALKVIRHFGVVGECNIQYALCPHSEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGLPLPDIKNSVTGNTTACFEPSLDYCVVKIPRWDLAKFVRVSKHIGSSM 770          

HSP 3 Score: 139.043 bits (349), Expect = 2.525e-32
Identity = 106/388 (27.32%), Postives = 182/388 (46.91%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHRE------KIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAV--AYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQ--LIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRG------EP--NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            +++LGSG   IG + EFD+   + IK ++    +T+++N N  TV T   M D  +F  L+   V  +   E+P+GV+++ GGQ   N  + L R        + I GT    I   E+R  F+  ++ IG      + +     A++  + + YP + R ++ L G     A +E +L     QA+A +    +++ K ++  KE++ + V  AY    +     E+ +  GIH+G++ +V P Q ++++  Q +     ++ +   V G  N+Q  L    +   +IE N R+SRS    SKA GY +   A +  +  P       + G      EP  +   VK+P +  A+       +G  M S GEV   G +  EAF KA
Sbjct:  406 VLILGSGGLSIGQAGEFDYSGSQAIKAMRESNIQTVLINPNIATVQTSKGMADKCYFLPLTPHYVEQVIKSERPNGVLLTFGGQTALNCGVQLERAGVFSKYNVRILGTPIQSIIETEDRKLFAERVNEIGEQVAPSEAVYSVAQALDAASRLGYPVMARAAFSLGGLGSGFANNEEELQSLAQQALAHSSQ--LIVDKSLKGWKEVEYEVVRDAY-NNCITVCNMENFDPLGIHTGESIVVAPSQTLSDREYQMLRSTALKVIRHFGVVGECNIQYALCPHSEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGLPLPDIKNSVTGNTTACFEPSLDYCVVKIPRWDLAKFVRVSKHIGSSMKSVGEVMAIGRNFEEAFQKA 790          

HSP 4 Score: 98.9821 bits (245), Expect = 3.263e-20
Identity = 78/278 (28.06%), Postives = 137/278 (49.28%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYT-VKECIDAAEQLGYPVMIRXX--XXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYE-VVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVN 2113
            EFD+     L+ LR+    T+++N N  TV T   + D+ Y   I+ + V ++ +ME  +G+ L+ GGQ   N  ++L         +  VLGTS E+I   E+R +FS +L+  K  + P     T ++  I+  E++GYP ++R +   +   +   ++N   E    A++  +    V++ K L   KEI+ + V  D    C+ V   E+V+  G+H+G++ +V P Q L+      +++    +   L V G  N+Q     N  K  +IE N
Sbjct:  964 EFDWCAVGCLRELRKLQRPTIMINYNPETVSTDYDMCDRLYFEEISFEVVMDIYEMENSEGIILSMGGQLPNNIAMDLHRQ------QAKVLGTSPESIDCAENRFKFSRMLDR-KGILQPRWKELTNLQSAIEFCEEVGYPCLVRPSYVLSGAAMNVAYSNQDLETYLNAASEVSREHPVVISKFLTEAKEIDVDAVASDGRILCMAVS--EHVENAGVHSGDATLVTPPQDLNAETLEAIKRITCDLASVLDVTGPFNMQLIAKNNELK--VIECN 1230          
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Zebrafish
Match: cad (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:ZFIN;Acc:ZDB-GENE-021030-4])

HSP 1 Score: 1083.17 bits (2800), Expect = 0.000e+0
Identity = 538/892 (60.31%), Postives = 691/892 (77.47%), Query Frame = 3
Query: 2346 SVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYVEKFTESGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKII---KCLNELEEPRTYLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDW--DTGNQASSDSKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQALRKAIYKKKICVASPTIDCITSQKIYRFPGLVDIHVHTRDPGQVHKEDWSTVTKXXXXXXXXXXFAMPNTAPPITNLESFELAKKRASSLAHCDYGLYVGASNDNWESLAELAPEAIGLKMYLNPTFSTLQMNNFSTWAKHFKHFPENRPICCHAEGETMAAVILLAQLHNRHVHICHVSRKQEIELIRLAKSQGLKVTCEVSPHH 5006
            SVGE+M++GR FEEAFQKALRMVDE   GFD  ++  +E  L +PTD+R+ VLA AL  G +V+ +Y+LTKID+WFL+K   I    K L   ++  + +  +I+  AK LGFSD QIA+AV+STE+AVR+LR +  + P+V QIDTV+AEWP  TNYLYL+Y G + D+ FE  ++MV+GSGVYRIGSSVEFDWCAV CI EL++M  KTIMVN NPETVSTDYDMCD L+F+E+S E V+DI+ +E P+GVI+SMGGQLPNNIAM LHR++  I GTSP  IDNAENRFKFSRMLD+IGI QP+WKEL+D+ESA+NFC  V YPCLVRPSYVLSGAAMNVA+S++D+ ++L+ AVAV+K+HPVVISKFI++AKEIDVDAVA  G+++  AVSEHVENAG+HSGDATLVTPPQD+N+KT+++I  I+  I QEL+V+GPFN+QLIAKDD L VIECN+RVSRSFP+VSK LG +++A ATR I+ E        +RG    V VKVP FSF+RL GADV+LGVEM STGEVACFGE+R EA+LKA L+ G KIP+   NI +SIGSYK+K ELL +V+ L SLGYNLYASLGTADFY E G+ V AVDW  +  +   +  K++   DY+ E+  DL+INL  RNSG RR S  +T GY+ RR+AID+ + L+T++KCTKLFVQAL++     ++      +D +TSQK+ R PGL+D+HVH R+PG  HKED+S+ T AA+AGGIT + AMPNT P I +  SF +A+K A +   CDY L+VGAS+DN   L  +A    GLKMYLN T+STL+M+N S W +HF+ +P++ PI  HAE +T+AA++L+AQL+ R VHICHV++K+EI +IR AK +G++VTCEV+PHH
Sbjct:  764 SVGEVMAIGRSFEEAFQKALRMVDENCVGFDHTIKPESEEELQTPTDKRIFVLAAALHAGYTVERLYELTKIDHWFLHKMKNIADHKKLLETYKQDESAMPPEIMRKAKQLGFSDKQIAQAVQSTELAVRKLRRDWKIFPVVKQIDTVAAEWPAQTNYLYLTYHGSESDVVFEQPHVMVIGSGVYRIGSSVEFDWCAVGCIMELRKMGYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYEMENPEGVILSMGGQLPNNIAMSLHRQQCRILGTSPEFIDNAENRFKFSRMLDTIGISQPRWKELSDTESAVNFCETVGYPCLVRPSYVLSGAAMNVAYSDTDMEKFLSSAVAVSKEHPVVISKFIQEAKEIDVDAVACDGEVIAIAVSEHVENAGVHSGDATLVTPPQDINQKTMERIKMIVHAIGQELQVTGPFNLQLIAKDDQLKVIECNVRVSRSFPYVSKTLGVDLVALATRVILGEEVE-AVGLMRGN-GIVGVKVPQFSFSRLAGADVVLGVEMTSTGEVACFGENRYEAYLKAMLSTGFKIPK--KNILLSIGSYKNKSELLPTVQTLESLGYNLYASLGTADFYTEHGVKVMAVDWPFEEESDCPNKDKQRNIMDYLEENHFDLVINLSMRNSGGRRLSSFVTKGYRTRRMAIDFSVPLITDIKCTKLFVQALKQIGQAPRV---KTHVDSMTSQKLIRLPGLIDVHVHLREPGATHKEDFSSGTAAALAGGITMVCAMPNTNPAIIDPNSFTMAQKLAKAGCRCDYALFVGASSDNAALLPSIASSTAGLKMYLNDTYSTLKMDNVSLWMEHFEKWPKHLPIVAHAEKQTVAAILLVAQLYQRPVHICHVAKKEEILIIRAAKQKGIQVTCEVAPHH 1648          

HSP 2 Score: 916.761 bits (2368), Expect = 0.000e+0
Identity = 477/771 (61.87%), Postives = 599/771 (77.69%), Query Frame = 2
Query:   41 GALILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLI--NPLNNPELFIDPNERNLVEEVSINEIRHYNKNGNIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNADEYDALFISNGPGDPVKCTETIETIKN--WITSEKPFMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVTAVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKPKKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
             +L+L D T + G LFGA+    GEVVFQTGMVGY E+L+DPSY SQ+L LTYP+IG+YG+  D+   ++GL K FES++IHA  LIV E S   S+W+A  +L +WL + G+ G+ G+DTR LTKK+RE G++ G       KL++   P +N   F +P+ RNLV+EVS+   + +N  G + +  IDCG+K NQIRC C+ GARVTV+P++  ++++++D LFISNGPG+P  C ET+E I+    + + KP  GICLGHQLL+L IG KT+KMKYGNRGHNQPC H  T RC++TSQNHGFAV   ++P +W  LF N ND+++EGI+H   P  SVQFHPEHM+GPTD+  LF VF++ V  VK N A  S+ QRL   LT+  +            +P+K+L+LGSGGLSIGQAGEFDYSG+QA+KA++EE IQT+L+NPNIATVQT+ G+ADK Y LPIT +YVT+VIK ERPDGV LTFGGQTALNCG+EL++ GV + YKV VLGT + +I+MTEDR+ F E +EEI E VAPS AA +V++ + AAE+LGYPV++R+AFALGGLGSGFANN  E++ L + AFAHTSQVLVDKSL+GWKEIEYEVVRD YDNC+TVCNMEN+DPLGIHTGES+VVAPSQTL++YEY MLR  A+KV+R+LGVVGECNIQYAL+P S +YYIIEVNARLSRSSALASKATGYPLAYVAAKL LG+ L  L+NSVT  TTA FEPS+DYCVVK+PRWDL+KF +V  KI SSM
Sbjct:    6 ASLVLEDGTTFKGRLFGAVSSVSGEVVFQTGMVGYPEALTDPSYKSQILTLTYPMIGNYGIPKDED-GEFGLSKWFESSQIHAAALIVGEVSENPSHWSAAKSLDEWLREQGIPGLQGVDTRCLTKKIREKGTMLG-------KLVVEGTPADNIP-FDNPDARNLVKEVSMKAPKVFNPEGTVRITAIDCGIKYNQIRCLCQRGARVTVVPWDQPLDSNDFDGLFISNGPGNPEYCKETVENIRKVACVENPKPIFGICLGHQLLSLVIGAKTYKMKYGNRGHNQPCIHKGTSRCYITSQNHGFAVDPETLPKDWDVLFTNANDQTSEGIVHNHKPLFSVQFHPEHMAGPTDLVGLFDVFLDTVRDVKENKAGKSVKQRLMEHLTFPGSPDPNAFV-----RPRKVLVLGSGGLSIGQAGEFDYSGSQAIKAMKEENIQTILINPNIATVQTSKGLADKVYFLPITPEYVTQVIKNERPDGVLLTFGGQTALNCGVELKKQGVLEKYKVRVLGTPVASIEMTEDRKIFVEKMEEINEHVAPSEAAMSVEQAVAAAERLGYPVLVRSAFALGGLGSGFANNRDEMITLVTQAFAHTSQVLVDKSLKGWKEIEYEVVRDAYDNCVTVCNMENIDPLGIHTGESIVVAPSQTLNDYEYNMLRNTAIKVIRHLGVVGECNIQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLSLGIPLPVLKNSVTNSTTANFEPSLDYCVVKVPRWDLSKFLRVSTKIGSSM 762          

HSP 3 Score: 142.124 bits (357), Expect = 3.618e-33
Identity = 112/391 (28.64%), Postives = 184/391 (47.06%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHRE------KIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAV--AYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQ--LIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPF---------SLECEFLRGEP--NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            ++VLGSG   IG + EFD+   + IK ++    +TI++N N  TV T   + D ++F  ++ E V  +   E+PDGV+++ GGQ   N  + L ++      K+ + GT    I+  E+R  F   ++ I       +     E A+     + YP LVR ++ L G     A +  ++   +TQA A      V++ K ++  KEI+ + V  AY   +    + E+++  GIH+G++ +V P Q +N+     +     ++ + L V G  N+Q  L  + +   +IE N R+SRS    SKA GY +   A +  +  P          S    F   EP  +   VKVP +  ++       +G  M S GEV   G    EAF KA
Sbjct:  398 VLVLGSGGLSIGQAGEFDYSGSQAIKAMKEENIQTILINPNIATVQTSKGLADKVYFLPITPEYVTQVIKNERPDGVLLTFGGQTALNCGVELKKQGVLEKYKVRVLGTPVASIEMTEDRKIFVEKMEEINEHVAPSEAAMSVEQAVAAAERLGYPVLVRSAFALGGLGSGFANNRDEMITLVTQAFAHTSQ--VLVDKSLKGWKEIEYEVVRDAYDNCVTVCNM-ENIDPLGIHTGESIVVAPSQTLNDYEYNMLRNTAIKVIRHLGVVGECNIQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLSLGIPLPVLKNSVTNSTTANF---EPSLDYCVVKVPRWDLSKFLRVSTKIGSSMKSVGEVMAIGRSFEEAFQKA 782          

HSP 4 Score: 101.679 bits (252), Expect = 6.911e-21
Identity = 87/304 (28.62%), Postives = 150/304 (49.34%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQ--VLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLG 2197
            EFD+     +  LR+ G +T++VN N  TV T   + D+ Y   I+ + V ++ +ME P+GV L+ GGQ   N  + L         +  +LGTS E I   E+R +FS +L+ I             +  ++  E +GYP ++R ++ L G     A + T++    S+A A + +  V++ K ++  KEI+ + V       I +   E+V+  G+H+G++ +V P Q ++      ++     + + L V G  N+Q  L     +  +IE N R+SRS    SK  G  L  +A ++ LG
Sbjct:  955 EFDWCAVGCIMELRKMGYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYEMENPEGVILSMGGQLPNNIAMSLHRQ------QCRILGTSPEFIDNAENRFKFSRMLDTIGISQPRWKELSDTESAVNFCETVGYPCLVRPSYVLSGAAMNVAYSDTDMEKFLSSAVAVSKEHPVVISKFIQEAKEIDVDAVA-CDGEVIAIAVSEHVENAGVHSGDATLVTPPQDINQKTMERIKMIVHAIGQELQVTGPFNLQ--LIAKDDQLKVIECNVRVSRSFPYVSKTLGVDLVALATRVILG 1249          
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Zebrafish
Match: cps1 (carbamoyl-phosphate synthase 1, mitochondrial [Source:ZFIN;Acc:ZDB-GENE-081105-17])

HSP 1 Score: 761.525 bits (1965), Expect = 0.000e+0
Identity = 410/778 (52.70%), Postives = 545/778 (70.05%), Query Frame = 2
Query:   47 LILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLINPLNNPELFIDPNERNLVEEVSINEIRHYNKNGNIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNADEYDALFISNGPGDPVKCTETIETIKNWITSEKP--FMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVTAVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKP--------KKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTT-MGV--ADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
            L+L D T   G  FG  +   GE+VF TG+VGY E+L+DPSY  Q+L LTYPI+G+YGV + + LD+ GL K+ ES +I  +GL+V +YS EYS+W +  +L+QWL++  V  + GIDTR LTK +R+ G++ G       K+  +    P    DPN+RNLV EVS  +I+ + K   + V  +DCG+K+N IR   K GA V ++P++  + + EYD LFISNGPGDP      I+ ++  + S++P    GIC+G+Q+ ALA G +++K+  GNRG NQP  ++ T + F+T+QNHG+ + + S+P  W  LF N ND +NEGI+H   P  + QFHPE   GPTD E LF  FI  +                           E ++ +++  KP         K+L+LGSGGLSIGQAGEFDYSG+QA+KA+REE +QTVL+NPNIA+VQT  +G   AD  Y LP+T ++VT+VI +ERPDG+ L+ GGQTALNCG+EL +SGV + Y V VLGT +E+I  TEDRQ FS+ L EI E++APS A  TV + + AA+++GYPVM+R+A+ALGGLGSG   N  +L D A  A A +SQ+LV+KSL GWKE+EYEVVRD+ DNC+TVCNMEN DPLGIHTG+S+VVAPSQTLSN EY+MLR+ A+KVVR+LG+VGECNIQYAL P+S +Y IIEVNARLSRSSALASKATGYPLA+VAAKL LG+ L  ++N+V+  TTACFEPS+DY V KIPRWDL++F  +  +I S+M
Sbjct:   37 LVLEDGTKMKGYSFGHDQSAAGELVFNTGLVGYPEALTDPSYRGQILTLTYPIVGNYGVPNTQELDELGLKKNVESDRIQVSGLLVQDYSAEYSHWNSVKSLAQWLQEEKVPALFGIDTRMLTKIIRDKGTVLG-------KIEFD--GQPVEITDPNQRNLVSEVSTKDIQVFGKGNPVKVVAVDCGIKHNIIRLLVKRGAEVHLVPWDQDLMSLEYDGLFISNGPGDPSLAKTLIQNVRKVLESDRPQPVFGICMGNQITALAAGAQSYKLPMGNRGQNQPVVNVMTGQAFITAQNHGYGIDSESLPPGWSPLFINANDGTNEGIMHNTKPVFTAQFHPEAKGGPTDTEFLFDAFISLI-----------------------RKGREGSIASVMPKKPAVPPRIQVSKVLVLGSGGLSIGQAGEFDYSGSQAVKAMREENLQTVLINPNIASVQTNEVGTKQADSVYFLPVTPEFVTQVISVERPDGILLSMGGQTALNCGVELFQSGVLEKYGVKVLGTPVESIMATEDRQLFSDKLMEINEKIAPSFAVKTVADALKAADEIGYPVMLRSAYALGGLGSGLCANKEKLEDTAHKALAMSSQILVEKSLLGWKEVEYEVVRDIADNCVTVCNMENFDPLGIHTGDSIVVAPSQTLSNEEYHMLRETAIKVVRHLGIVGECNIQYALHPSSLEYCIIEVNARLSRSSALASKATGYPLAFVAAKLALGIPLPEIKNAVSEQTTACFEPSLDYIVTKIPRWDLDRFHGMSREIGSAM 782          

HSP 2 Score: 599.742 bits (1545), Expect = 0.000e+0
Identity = 320/698 (45.85%), Postives = 454/698 (65.04%), Query Frame = 3
Query: 2346 SVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYV--------EKFTESGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKIIKCLNELEEPRT-YLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPF------SLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDWDTGNQASSDSKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQALR 4394
            SVGE+M+VGR FEE+ QKALRM    + GF P +        ++  +  LS P+  R+  LA AL  GV+V +I+DLT ID WFL+K   I +    L + ++  + +D+LL AK+ GFSD Q+ +A+  +E   R LR+   +RP V QIDT++AE+P  TNYLY +Y G +HD+ F+    MV+G G Y IGSSVEFDWCAV  I+ L++M K+T++VN NPETVSTD+D CD L+FEEL+LE +LDI   E   G IVS+GGQ+PNN+AM LH   + I GT+P  ID AE R  FS +LD +G+ Q  W+ L+  E A++F ++V YPCL+RPSYVLSG+AMNV + E ++  +L +A  V++DHPVVI+KFI  A+E++VDAVA  GK+L  A++EHVE+AG+HSGDATL+ P Q +++  L+K+     +IA+  ++SGPFN Q + K ++++VIECNLR SRSFPFVSK +G + I  ATR ++ E        SLE   +    + V +K PMFS+ RL  AD +L  EM STGEVACFG +   AFLKA L+ G K+P+ G  I I I  +  +   L +  QL   G+ LYA+ GT+ +   + +    V W +    ++ +   + S  I E  +DL++NLP  NS        + + ++ RR+A+DYG+ L+TN +  KLF +A+R
Sbjct:  784 SVGEVMAVGRSFEESIQKALRMCHPSVDGFVPRLPLKKAWAEQQDLQRELSMPSSTRIFSLAQALHSGVTVDQIHDLTAIDKWFLHKLKHITEMEQRLGQYKSATVPRDLLLKAKMDGFSDRQVGQAMDISEGEARVLRLNQNIRPWVKQIDTLAAEYPAATNYLYCTYHGQEHDLDFKDHGTMVVGCGPYHIGSSVEFDWCAVSSIRALRQMGKRTVVVNHNPETVSTDFDECDRLYFEELTLERILDITQQEGCTGCIVSVGGQIPNNLAMPLHLNGVKILGTNPAQIDRAEERSVFSSILDDLGVGQAPWRALSSLEDAVSFASNVGYPCLLRPSYVLSGSAMNVVYGEDEMKRFLEEATQVSQDHPVVITKFIRGAREVEVDAVARMGKVLAHAITEHVEDAGVHSGDATLMLPTQTISQGALEKVKTATQKIAKAFEISGPFNTQFLVKGNDVMVIECNLRASRSFPFVSKTIGVDFIDVATRVMVGERMDESRLPSLENPII--PVDFVGIKAPMFSWPRLREADPVLRCEMASTGEVACFGPNIYSAFLKAMLSTGFKLPQKG--ILIGI-QHSFRPNFLSTAHQLHEEGFKLYATEGTSAWLNANDVPTIPVAWPS--VETNTTHLPSISRLISEGHIDLVVNLPNNNSKF------LKDNFQIRRMAVDYGVPLITNFQVVKLFAEAIR 1468          

HSP 3 Score: 122.479 bits (306), Expect = 2.998e-27
Identity = 103/391 (26.34%), Postives = 185/391 (47.31%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTD---YDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHR----EK--IPIFGTSPICIDNAENRFKFSRMLDSIG-ICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVA-YGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNL--LVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFS------LECEFLRGEP--NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            ++VLGSG   IG + EFD+   + +K ++    +T+++N N  +V T+       D ++F  ++ E V  +  +E+PDG+++SMGGQ   N  + L +    EK  + + GT    I   E+R  FS  L  I     P +   T ++ A+   +++ YP ++R +Y L G    +  ++  L +   +A+A++    +++ K +   KE++ + V       +     E+ +  GIH+GD+ +V P Q ++ +    + +   ++ + L + G  N+Q      +L   +IE N R+SRS    SKA GY +   A +  +  P         E      EP  + +  K+P +   R  G    +G  M S GEV   G    E+  KA
Sbjct:  415 VLVLGSGGLSIGQAGEFDYSGSQAVKAMREENLQTVLINPNIASVQTNEVGTKQADSVYFLPVTPEFVTQVISVERPDGILLSMGGQTALNCGVELFQSGVLEKYGVKVLGTPVESIMATEDRQLFSDKLMEINEKIAPSFAVKTVAD-ALKAADEIGYPVMLRSAYALGGLGSGLCANKEKLEDTAHKALAMSSQ--ILVEKSLLGWKEVEYEVVRDIADNCVTVCNMENFDPLGIHTGDSIVVAPSQTLSNEEYHMLRETAIKVVRHLGIVGECNIQYALHPSSLEYCIIEVNARLSRSSALASKATGYPLAFVAAKLALGIPLPEIKNAVSEQTTACFEPSLDYIVTKIPRWDLDRFHGMSREIGSAMKSVGEVMAVGRSFEESIQKA 802          

HSP 4 Score: 109.383 bits (272), Expect = 2.698e-23
Identity = 98/373 (26.27%), Postives = 171/373 (45.84%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAA--FAHTSQVLVDKSLRGWKEIEYEVVR---DVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLG-----MSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKV-----CNKISSSMXKCW*NNV 2365
            EFD+    +++ALR+ G +TV+VN N  TV T     D+ Y   +T + + ++ + E   G  ++ GGQ   N  + L  +G      V +LGT+   I   E+R  FS IL+++    AP  A  ++++ +  A  +GYP ++R ++ L G          E+      A   +    V++ K +RG +E+E + V     V  + IT    E+V+  G+H+G++ ++ P+QT+S      ++    K+ +   + G  N Q+ +  N     +IE N R SRS    SK  G     VA ++ +G       L SL N +  V         D+  +K P +   +  +      C   S+    C+  N+
Sbjct:  981 EFDWCAVSSIRALRQMGKRTVVVNHNPETVSTDFDECDRLYFEELTLERILDITQQEGCTGCIVSVGGQIPNNLAMPLHLNG------VKILGTNPAQIDRAEERSVFSSILDDLGVGQAPWRALSSLEDAVSFASNVGYPCLLRPSYVLSGSAMNVVYGEDEMKRFLEEATQVSQDHPVVITKFIRGAREVEVDAVARMGKVLAHAIT----EHVEDAGVHSGDATLMLPTQTISQGALEKVKTATQKIAKAFEISGPFNTQFLVKGND--VMVIECNLRASRSFPFVSKTIGVDFIDVATRVMVGERMDESRLPSLENPIIPV---------DFVGIKAPMFSWPRLREADPVLRCEMASTGEVACFGPNI 1332          
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Zebrafish
Match: cps1 (carbamoyl-phosphate synthase 1, mitochondrial [Source:ZFIN;Acc:ZDB-GENE-081105-17])

HSP 1 Score: 761.14 bits (1964), Expect = 0.000e+0
Identity = 410/778 (52.70%), Postives = 545/778 (70.05%), Query Frame = 2
Query:   47 LILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLINPLNNPELFIDPNERNLVEEVSINEIRHYNKNGNIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNADEYDALFISNGPGDPVKCTETIETIKNWITSEKP--FMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVTAVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKP--------KKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTT-MGV--ADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
            L+L D T   G  FG  +   GE+VF TG+VGY E+L+DPSY  Q+L LTYPI+G+YGV + + LD+ GL K+ ES +I  +GL+V +YS EYS+W +  +L+QWL++  V  + GIDTR LTK +R+ G++ G       K+  +    P    DPN+RNLV EVS  +I+ + K   + V  +DCG+K+N IR   K GA V ++P++  + + EYD LFISNGPGDP      I+ ++  + S++P    GIC+G+Q+ ALA G +++K+  GNRG NQP  ++ T + F+T+QNHG+ + + S+P  W  LF N ND +NEGI+H   P  + QFHPE   GPTD E LF  FI  +                           E ++ +++  KP         K+L+LGSGGLSIGQAGEFDYSG+QA+KA+REE +QTVL+NPNIA+VQT  +G   AD  Y LP+T ++VT+VI +ERPDG+ L+ GGQTALNCG+EL +SGV + Y V VLGT +E+I  TEDRQ FS+ L EI E++APS A  TV + + AA+++GYPVM+R+A+ALGGLGSG   N  +L D A  A A +SQ+LV+KSL GWKE+EYEVVRD+ DNC+TVCNMEN DPLGIHTG+S+VVAPSQTLSN EY+MLR+ A+KVVR+LG+VGECNIQYAL P+S +Y IIEVNARLSRSSALASKATGYPLA+VAAKL LG+ L  ++N+V+  TTACFEPS+DY V KIPRWDL++F  +  +I S+M
Sbjct:   37 LVLEDGTKMKGYSFGHDQSAAGELVFNTGLVGYPEALTDPSYRGQILTLTYPIVGNYGVPNTQELDELGLKKNVESDRIQVSGLLVQDYSAEYSHWNSVKSLAQWLQEEKVPALFGIDTRMLTKIIRDKGTVLG-------KIEFD--GQPVEITDPNQRNLVSEVSTKDIQVFGKGNPVKVVAVDCGIKHNIIRLLVKRGAEVHLVPWDQDLMSLEYDGLFISNGPGDPSLAKTLIQNVRKVLESDRPQPVFGICMGNQITALAAGAQSYKLPMGNRGQNQPVVNVMTGQAFITAQNHGYGIDSESLPPGWSPLFINANDGTNEGIMHNTKPVFTAQFHPEAKGGPTDTEFLFDAFISLI-----------------------RKGREGSIASVMPKKPAVPPRIQVSKVLVLGSGGLSIGQAGEFDYSGSQAVKAMREENLQTVLINPNIASVQTNEVGTKQADSVYFLPVTPEFVTQVISVERPDGILLSMGGQTALNCGVELFQSGVLEKYGVKVLGTPVESIMATEDRQLFSDKLMEINEKIAPSFAVKTVADALKAADEIGYPVMLRSAYALGGLGSGLCANKEKLEDTAHKALAMSSQILVEKSLLGWKEVEYEVVRDIADNCVTVCNMENFDPLGIHTGDSIVVAPSQTLSNEEYHMLRETAIKVVRHLGIVGECNIQYALHPSSLEYCIIEVNARLSRSSALASKATGYPLAFVAAKLALGIPLPEIKNAVSEQTTACFEPSLDYIVTKIPRWDLDRFHGMSREIGSAM 782          

HSP 2 Score: 600.127 bits (1546), Expect = 0.000e+0
Identity = 320/698 (45.85%), Postives = 454/698 (65.04%), Query Frame = 3
Query: 2346 SVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYV--------EKFTESGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKIIKCLNELEEPRT-YLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPF------SLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDWDTGNQASSDSKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQALR 4394
            SVGE+M+VGR FEE+ QKALRM    + GF P +        ++  +  LS P+  R+  LA AL  GV+V +I+DLT ID WFL+K   I +    L + ++  + +D+LL AK+ GFSD Q+ +A+  +E   R LR+   +RP V QIDT++AE+P  TNYLY +Y G +HD+ F+    MV+G G Y IGSSVEFDWCAV  I+ L++M K+T++VN NPETVSTD+D CD L+FEEL+LE +LDI   E   G IVS+GGQ+PNN+AM LH   + I GT+P  ID AE R  FS +LD +G+ Q  W+ L+  E A++F ++V YPCL+RPSYVLSG+AMNV + E ++  +L +A  V++DHPVVI+KFI  A+E++VDAVA  GK+L  A++EHVE+AG+HSGDATL+ P Q +++  L+K+     +IA+  ++SGPFN Q + K ++++VIECNLR SRSFPFVSK +G + I  ATR ++ E        SLE   +    + V +K PMFS+ RL  AD +L  EM STGEVACFG +   AFLKA L+ G K+P+ G  I I I  +  +   L +  QL   G+ LYA+ GT+ +   + +    V W +    ++ +   + S  I E  +DL++NLP  NS        + + ++ RR+A+DYG+ L+TN +  KLF +A+R
Sbjct:  784 SVGEVMAVGRSFEESIQKALRMCHPSVDGFVPRLPLKKAWAEQQDLQRELSMPSSTRIFSLAQALHSGVTVDQIHDLTAIDKWFLHKLKHITEMEQRLGQYKSATVPRDLLLKAKMDGFSDRQVGQAMDISEGEARVLRLNQNIRPWVKQIDTLAAEYPAATNYLYCTYHGQEHDLDFKDHGTMVVGCGPYHIGSSVEFDWCAVSSIRALRQMGKRTVVVNHNPETVSTDFDECDRLYFEELTLERILDITQQEGCTGCIVSVGGQIPNNLAMPLHLNGVKILGTNPAQIDRAEERSVFSSILDDLGVGQAPWRALSSLEDAVSFASNVGYPCLLRPSYVLSGSAMNVVYGEDEMKRFLEEATQVSQDHPVVITKFIRGAREVEVDAVARMGKVLAHAITEHVEDAGVHSGDATLMLPTQTISQGALEKVKTATQKIAKAFEISGPFNTQFLVKGNDVMVIECNLRASRSFPFVSKTIGVDFIDVATRVMVGERMDESRLPSLENPII--PVDFVGIKAPMFSWPRLREADPVLRCEMASTGEVACFGPNIYSAFLKAMLSTGFKLPQKG--ILIGI-QHSFRPNFLSTAHQLHEEGFKLYATEGTSAWLNANDVPTIPVAWPS--VETNTTHLPSISRLISEGHIDLVVNLPNNNSKF------LKDNFQIRRMAVDYGVPLITNFQVVKLFAEAIR 1468          

HSP 3 Score: 122.479 bits (306), Expect = 2.905e-27
Identity = 103/391 (26.34%), Postives = 185/391 (47.31%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTD---YDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHR----EK--IPIFGTSPICIDNAENRFKFSRMLDSIG-ICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVA-YGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNL--LVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFS------LECEFLRGEP--NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            ++VLGSG   IG + EFD+   + +K ++    +T+++N N  +V T+       D ++F  ++ E V  +  +E+PDG+++SMGGQ   N  + L +    EK  + + GT    I   E+R  FS  L  I     P +   T ++ A+   +++ YP ++R +Y L G    +  ++  L +   +A+A++    +++ K +   KE++ + V       +     E+ +  GIH+GD+ +V P Q ++ +    + +   ++ + L + G  N+Q      +L   +IE N R+SRS    SKA GY +   A +  +  P         E      EP  + +  K+P +   R  G    +G  M S GEV   G    E+  KA
Sbjct:  415 VLVLGSGGLSIGQAGEFDYSGSQAVKAMREENLQTVLINPNIASVQTNEVGTKQADSVYFLPVTPEFVTQVISVERPDGILLSMGGQTALNCGVELFQSGVLEKYGVKVLGTPVESIMATEDRQLFSDKLMEINEKIAPSFAVKTVAD-ALKAADEIGYPVMLRSAYALGGLGSGLCANKEKLEDTAHKALAMSSQ--ILVEKSLLGWKEVEYEVVRDIADNCVTVCNMENFDPLGIHTGDSIVVAPSQTLSNEEYHMLRETAIKVVRHLGIVGECNIQYALHPSSLEYCIIEVNARLSRSSALASKATGYPLAFVAAKLALGIPLPEIKNAVSEQTTACFEPSLDYIVTKIPRWDLDRFHGMSREIGSAMKSVGEVMAVGRSFEESIQKA 802          

HSP 4 Score: 109.383 bits (272), Expect = 2.824e-23
Identity = 98/373 (26.27%), Postives = 171/373 (45.84%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAA--FAHTSQVLVDKSLRGWKEIEYEVVR---DVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLG-----MSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKV-----CNKISSSMXKCW*NNV 2365
            EFD+    +++ALR+ G +TV+VN N  TV T     D+ Y   +T + + ++ + E   G  ++ GGQ   N  + L  +G      V +LGT+   I   E+R  FS IL+++    AP  A  ++++ +  A  +GYP ++R ++ L G          E+      A   +    V++ K +RG +E+E + V     V  + IT    E+V+  G+H+G++ ++ P+QT+S      ++    K+ +   + G  N Q+ +  N     +IE N R SRS    SK  G     VA ++ +G       L SL N +  V         D+  +K P +   +  +      C   S+    C+  N+
Sbjct:  981 EFDWCAVSSIRALRQMGKRTVVVNHNPETVSTDFDECDRLYFEELTLERILDITQQEGCTGCIVSVGGQIPNNLAMPLHLNG------VKILGTNPAQIDRAEERSVFSSILDDLGVGQAPWRALSSLEDAVSFASNVGYPCLLRPSYVLSGSAMNVVYGEDEMKRFLEEATQVSQDHPVVITKFIRGAREVEVDAVARMGKVLAHAIT----EHVEDAGVHSGDATLMLPTQTISQGALEKVKTATQKIAKAFEISGPFNTQFLVKGND--VMVIECNLRASRSFPFVSKTIGVDFIDVATRVMVGERMDESRLPSLENPIIPV---------DFVGIKAPMFSWPRLREADPVLRCEMASTGEVACFGPNI 1332          
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Zebrafish
Match: cps1 (carbamoyl-phosphate synthase 1, mitochondrial [Source:ZFIN;Acc:ZDB-GENE-081105-17])

HSP 1 Score: 756.133 bits (1951), Expect = 0.000e+0
Identity = 410/780 (52.56%), Postives = 545/780 (69.87%), Query Frame = 2
Query:   47 LILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLINPLNNPELFIDPNERNLVEEVSINEIRHYNKNGNIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNADEYDALFISNGPGDPVKCTETIETIKNWITSEKP--FMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNE--GIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVTAVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKP--------KKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTT-MGV--ADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
            L+L D T   G  FG  +   GE+VF TG+VGY E+L+DPSY  Q+L LTYPI+G+YGV + + LD+ GL K+ ES +I  +GL+V +YS EYS+W +  +L+QWL++  V  + GIDTR LTK +R+ G++ G       K+  +    P    DPN+RNLV EVS  +I+ + K   + V  +DCG+K+N IR   K GA V ++P++  + + EYD LFISNGPGDP      I+ ++  + S++P    GIC+G+Q+ ALA G +++K+  GNRG NQP  ++ T + F+T+QNHG+ + + S+P  W  LF N ND +NE  GI+H   P  + QFHPE   GPTD E LF  FI  +                           E ++ +++  KP         K+L+LGSGGLSIGQAGEFDYSG+QA+KA+REE +QTVL+NPNIA+VQT  +G   AD  Y LP+T ++VT+VI +ERPDG+ L+ GGQTALNCG+EL +SGV + Y V VLGT +E+I  TEDRQ FS+ L EI E++APS A  TV + + AA+++GYPVM+R+A+ALGGLGSG   N  +L D A  A A +SQ+LV+KSL GWKE+EYEVVRD+ DNC+TVCNMEN DPLGIHTG+S+VVAPSQTLSN EY+MLR+ A+KVVR+LG+VGECNIQYAL P+S +Y IIEVNARLSRSSALASKATGYPLA+VAAKL LG+ L  ++N+V+  TTACFEPS+DY V KIPRWDL++F  +  +I S+M
Sbjct:   39 LVLEDGTKMKGYSFGHDQSAAGELVFNTGLVGYPEALTDPSYRGQILTLTYPIVGNYGVPNTQELDELGLKKNVESDRIQVSGLLVQDYSAEYSHWNSVKSLAQWLQEEKVPALFGIDTRMLTKIIRDKGTVLG-------KIEFD--GQPVEITDPNQRNLVSEVSTKDIQVFGKGNPVKVVAVDCGIKHNIIRLLVKRGAEVHLVPWDQDLMSLEYDGLFISNGPGDPSLAKTLIQNVRKVLESDRPQPVFGICMGNQITALAAGAQSYKLPMGNRGQNQPVVNVMTGQAFITAQNHGYGIDSESLPPGWSPLFINANDGTNEVWGIMHNTKPVFTAQFHPEAKGGPTDTEFLFDAFISLI-----------------------RKGREGSIASVMPKKPAVPPRIQVSKVLVLGSGGLSIGQAGEFDYSGSQAVKAMREENLQTVLINPNIASVQTNEVGTKQADSVYFLPVTPEFVTQVISVERPDGILLSMGGQTALNCGVELFQSGVLEKYGVKVLGTPVESIMATEDRQLFSDKLMEINEKIAPSFAVKTVADALKAADEIGYPVMLRSAYALGGLGSGLCANKEKLEDTAHKALAMSSQILVEKSLLGWKEVEYEVVRDIADNCVTVCNMENFDPLGIHTGDSIVVAPSQTLSNEEYHMLRETAIKVVRHLGIVGECNIQYALHPSSLEYCIIEVNARLSRSSALASKATGYPLAFVAAKLALGIPLPEIKNAVSEQTTACFEPSLDYIVTKIPRWDLDRFHGMSREIGSAM 786          

HSP 2 Score: 599.742 bits (1545), Expect = 0.000e+0
Identity = 320/698 (45.85%), Postives = 454/698 (65.04%), Query Frame = 3
Query: 2346 SVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYV--------EKFTESGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKIIKCLNELEEPRT-YLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPF------SLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDWDTGNQASSDSKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQALR 4394
            SVGE+M+VGR FEE+ QKALRM    + GF P +        ++  +  LS P+  R+  LA AL  GV+V +I+DLT ID WFL+K   I +    L + ++  + +D+LL AK+ GFSD Q+ +A+  +E   R LR+   +RP V QIDT++AE+P  TNYLY +Y G +HD+ F+    MV+G G Y IGSSVEFDWCAV  I+ L++M K+T++VN NPETVSTD+D CD L+FEEL+LE +LDI   E   G IVS+GGQ+PNN+AM LH   + I GT+P  ID AE R  FS +LD +G+ Q  W+ L+  E A++F ++V YPCL+RPSYVLSG+AMNV + E ++  +L +A  V++DHPVVI+KFI  A+E++VDAVA  GK+L  A++EHVE+AG+HSGDATL+ P Q +++  L+K+     +IA+  ++SGPFN Q + K ++++VIECNLR SRSFPFVSK +G + I  ATR ++ E        SLE   +    + V +K PMFS+ RL  AD +L  EM STGEVACFG +   AFLKA L+ G K+P+ G  I I I  +  +   L +  QL   G+ LYA+ GT+ +   + +    V W +    ++ +   + S  I E  +DL++NLP  NS        + + ++ RR+A+DYG+ L+TN +  KLF +A+R
Sbjct:  788 SVGEVMAVGRSFEESIQKALRMCHPSVDGFVPRLPLKKAWAEQQDLQRELSMPSSTRIFSLAQALHSGVTVDQIHDLTAIDKWFLHKLKHITEMEQRLGQYKSATVPRDLLLKAKMDGFSDRQVGQAMDISEGEARVLRLNQNIRPWVKQIDTLAAEYPAATNYLYCTYHGQEHDLDFKDHGTMVVGCGPYHIGSSVEFDWCAVSSIRALRQMGKRTVVVNHNPETVSTDFDECDRLYFEELTLERILDITQQEGCTGCIVSVGGQIPNNLAMPLHLNGVKILGTNPAQIDRAEERSVFSSILDDLGVGQAPWRALSSLEDAVSFASNVGYPCLLRPSYVLSGSAMNVVYGEDEMKRFLEEATQVSQDHPVVITKFIRGAREVEVDAVARMGKVLAHAITEHVEDAGVHSGDATLMLPTQTISQGALEKVKTATQKIAKAFEISGPFNTQFLVKGNDVMVIECNLRASRSFPFVSKTIGVDFIDVATRVMVGERMDESRLPSLENPII--PVDFVGIKAPMFSWPRLREADPVLRCEMASTGEVACFGPNIYSAFLKAMLSTGFKLPQKG--ILIGI-QHSFRPNFLSTAHQLHEEGFKLYATEGTSAWLNANDVPTIPVAWPS--VETNTTHLPSISRLISEGHIDLVVNLPNNNSKF------LKDNFQIRRMAVDYGVPLITNFQVVKLFAEAIR 1472          

HSP 3 Score: 122.094 bits (305), Expect = 3.393e-27
Identity = 103/391 (26.34%), Postives = 185/391 (47.31%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTD---YDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHR----EK--IPIFGTSPICIDNAENRFKFSRMLDSIG-ICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVA-YGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNL--LVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFS------LECEFLRGEP--NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            ++VLGSG   IG + EFD+   + +K ++    +T+++N N  +V T+       D ++F  ++ E V  +  +E+PDG+++SMGGQ   N  + L +    EK  + + GT    I   E+R  FS  L  I     P +   T ++ A+   +++ YP ++R +Y L G    +  ++  L +   +A+A++    +++ K +   KE++ + V       +     E+ +  GIH+GD+ +V P Q ++ +    + +   ++ + L + G  N+Q      +L   +IE N R+SRS    SKA GY +   A +  +  P         E      EP  + +  K+P +   R  G    +G  M S GEV   G    E+  KA
Sbjct:  419 VLVLGSGGLSIGQAGEFDYSGSQAVKAMREENLQTVLINPNIASVQTNEVGTKQADSVYFLPVTPEFVTQVISVERPDGILLSMGGQTALNCGVELFQSGVLEKYGVKVLGTPVESIMATEDRQLFSDKLMEINEKIAPSFAVKTVAD-ALKAADEIGYPVMLRSAYALGGLGSGLCANKEKLEDTAHKALAMSSQ--ILVEKSLLGWKEVEYEVVRDIADNCVTVCNMENFDPLGIHTGDSIVVAPSQTLSNEEYHMLRETAIKVVRHLGIVGECNIQYALHPSSLEYCIIEVNARLSRSSALASKATGYPLAFVAAKLALGIPLPEIKNAVSEQTTACFEPSLDYIVTKIPRWDLDRFHGMSREIGSAMKSVGEVMAVGRSFEESIQKA 806          

HSP 4 Score: 109.383 bits (272), Expect = 2.642e-23
Identity = 98/373 (26.27%), Postives = 171/373 (45.84%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAA--FAHTSQVLVDKSLRGWKEIEYEVVR---DVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLG-----MSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKV-----CNKISSSMXKCW*NNV 2365
            EFD+    +++ALR+ G +TV+VN N  TV T     D+ Y   +T + + ++ + E   G  ++ GGQ   N  + L  +G      V +LGT+   I   E+R  FS IL+++    AP  A  ++++ +  A  +GYP ++R ++ L G          E+      A   +    V++ K +RG +E+E + V     V  + IT    E+V+  G+H+G++ ++ P+QT+S      ++    K+ +   + G  N Q+ +  N     +IE N R SRS    SK  G     VA ++ +G       L SL N +  V         D+  +K P +   +  +      C   S+    C+  N+
Sbjct:  985 EFDWCAVSSIRALRQMGKRTVVVNHNPETVSTDFDECDRLYFEELTLERILDITQQEGCTGCIVSVGGQIPNNLAMPLHLNG------VKILGTNPAQIDRAEERSVFSSILDDLGVGQAPWRALSSLEDAVSFASNVGYPCLLRPSYVLSGSAMNVVYGEDEMKRFLEEATQVSQDHPVVITKFIRGAREVEVDAVARMGKVLAHAIT----EHVEDAGVHSGDATLMLPTQTISQGALEKVKTATQKIAKAFEISGPFNTQFLVKGND--VMVIECNLRASRSFPFVSKTIGVDFIDVATRVMVGERMDESRLPSLENPIIPV---------DFVGIKAPMFSWPRLREADPVLRCEMASTGEVACFGPNI 1336          
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Zebrafish
Match: cps1 (carbamoyl-phosphate synthase 1, mitochondrial [Source:ZFIN;Acc:ZDB-GENE-081105-17])

HSP 1 Score: 733.791 bits (1893), Expect = 0.000e+0
Identity = 395/746 (52.95%), Postives = 526/746 (70.51%), Query Frame = 2
Query:  143 YTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLINPLNNPELFIDPNERNLVEEVSINEIRHYNKNGNIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNADEYDALFISNGPGDPVKCTETIETIKNWITSEKP--FMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVTAVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKP--------KKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTT-MGV--ADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
            Y E+L+DPSY  Q+L LTYPI+G+YGV + + LD+ GL K+ ES +I  +GL+V +YS EYS+W +  +L+QWL++  V  + GIDTR LTK +R+ G++ G       K+  +    P    DPN+RNLV EVS  +I+ + K   + V  +DCG+K+N IR   K GA V ++P++  + + EYD LFISNGPGDP      I+ ++  + S++P    GIC+G+Q+ ALA G +++K+  GNRG NQP  ++ T + F+T+QNHG+ + + S+P  W  LF N ND +NEGI+H   P  + QFHPE   GPTD E LF  FI  +                           E ++ +++  KP         K+L+LGSGGLSIGQAGEFDYSG+QA+KA+REE +QTVL+NPNIA+VQT  +G   AD  Y LP+T ++VT+VI +ERPDG+ L+ GGQTALNCG+EL +SGV + Y V VLGT +E+I  TEDRQ FS+ L EI E++APS A  TV + + AA+++GYPVM+R+A+ALGGLGSG   N  +L D A  A A +SQ+LV+KSL GWKE+EYEVVRD+ DNC+TVCNMEN DPLGIHTG+S+VVAPSQTLSN EY+MLR+ A+KVVR+LG+VGECNIQYAL P+S +Y IIEVNARLSRSSALASKATGYPLA+VAAKL LG+ L  ++N+V+  TTACFEPS+DY V KIPRWDL++F  +  +I S+M
Sbjct:   55 YPEALTDPSYRGQILTLTYPIVGNYGVPNTQELDELGLKKNVESDRIQVSGLLVQDYSAEYSHWNSVKSLAQWLQEEKVPALFGIDTRMLTKIIRDKGTVLG-------KIEFD--GQPVEITDPNQRNLVSEVSTKDIQVFGKGNPVKVVAVDCGIKHNIIRLLVKRGAEVHLVPWDQDLMSLEYDGLFISNGPGDPSLAKTLIQNVRKVLESDRPQPVFGICMGNQITALAAGAQSYKLPMGNRGQNQPVVNVMTGQAFITAQNHGYGIDSESLPPGWSPLFINANDGTNEGIMHNTKPVFTAQFHPEAKGGPTDTEFLFDAFISLI-----------------------RKGREGSIASVMPKKPAVPPRIQVSKVLVLGSGGLSIGQAGEFDYSGSQAVKAMREENLQTVLINPNIASVQTNEVGTKQADSVYFLPVTPEFVTQVISVERPDGILLSMGGQTALNCGVELFQSGVLEKYGVKVLGTPVESIMATEDRQLFSDKLMEINEKIAPSFAVKTVADALKAADEIGYPVMLRSAYALGGLGSGLCANKEKLEDTAHKALAMSSQILVEKSLLGWKEVEYEVVRDIADNCVTVCNMENFDPLGIHTGDSIVVAPSQTLSNEEYHMLRETAIKVVRHLGIVGECNIQYALHPSSLEYCIIEVNARLSRSSALASKATGYPLAFVAAKLALGIPLPEIKNAVSEQTTACFEPSLDYIVTKIPRWDLDRFHGMSREIGSAM 768          

HSP 2 Score: 593.193 bits (1528), Expect = 0.000e+0
Identity = 320/705 (45.39%), Postives = 455/705 (64.54%), Query Frame = 3
Query: 2346 SVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYV--------EKFTESGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKIIKCLNELEEPRT-YLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPF------SLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDWDTGNQASSDSKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTN-------VKCTKLFVQALR 4394
            SVGE+M+VGR FEE+ QKALRM    + GF P +        ++  +  LS P+  R+  LA AL  GV+V +I+DLT ID WFL+K   I +    L + ++  + +D+LL AK+ GFSD Q+ +A+  +E   R LR+   +RP V QIDT++AE+P  TNYLY +Y G +HD+ F+    MV+G G Y IGSSVEFDWCAV  I+ L++M K+T++VN NPETVSTD+D CD L+FEEL+LE +LDI   E   G IVS+GGQ+PNN+AM LH   + I GT+P  ID AE R  FS +LD +G+ Q  W+ L+  E A++F ++V YPCL+RPSYVLSG+AMNV + E ++  +L +A  V++DHPVVI+KFI  A+E++VDAVA  GK+L  A++EHVE+AG+HSGDATL+ P Q +++  L+K+     +IA+  ++SGPFN Q + K ++++VIECNLR SRSFPFVSK +G + I  ATR ++ E        SLE   +    + V +K PMFS+ RL  AD +L  EM STGEVACFG +   AFLKA L+ G K+P+ G  I I I  +  +   L +  QL   G+ LYA+ GT+ +   + +    V W +    ++ +   + S  I E  +DL++NLP  NS        + + ++ RR+A+DYG+ L+TN       ++  KLF +A+R
Sbjct:  770 SVGEVMAVGRSFEESIQKALRMCHPSVDGFVPRLPLKKAWAEQQDLQRELSMPSSTRIFSLAQALHSGVTVDQIHDLTAIDKWFLHKLKHITEMEQRLGQYKSATVPRDLLLKAKMDGFSDRQVGQAMDISEGEARVLRLNQNIRPWVKQIDTLAAEYPAATNYLYCTYHGQEHDLDFKDHGTMVVGCGPYHIGSSVEFDWCAVSSIRALRQMGKRTVVVNHNPETVSTDFDECDRLYFEELTLERILDITQQEGCTGCIVSVGGQIPNNLAMPLHLNGVKILGTNPAQIDRAEERSVFSSILDDLGVGQAPWRALSSLEDAVSFASNVGYPCLLRPSYVLSGSAMNVVYGEDEMKRFLEEATQVSQDHPVVITKFIRGAREVEVDAVARMGKVLAHAITEHVEDAGVHSGDATLMLPTQTISQGALEKVKTATQKIAKAFEISGPFNTQFLVKGNDVMVIECNLRASRSFPFVSKTIGVDFIDVATRVMVGERMDESRLPSLENPII--PVDFVGIKAPMFSWPRLREADPVLRCEMASTGEVACFGPNIYSAFLKAMLSTGFKLPQKG--ILIGI-QHSFRPNFLSTAHQLHEEGFKLYATEGTSAWLNANDVPTIPVAWPS--VETNTTHLPSISRLISEGHIDLVVNLPNNNSKF------LKDNFQIRRMAVDYGVPLITNFQVFFSFLQVVKLFAEAIR 1461          

HSP 3 Score: 122.094 bits (305), Expect = 3.862e-27
Identity = 103/391 (26.34%), Postives = 185/391 (47.31%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTD---YDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHR----EK--IPIFGTSPICIDNAENRFKFSRMLDSIG-ICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVA-YGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNL--LVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFS------LECEFLRGEP--NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            ++VLGSG   IG + EFD+   + +K ++    +T+++N N  +V T+       D ++F  ++ E V  +  +E+PDG+++SMGGQ   N  + L +    EK  + + GT    I   E+R  FS  L  I     P +   T ++ A+   +++ YP ++R +Y L G    +  ++  L +   +A+A++    +++ K +   KE++ + V       +     E+ +  GIH+GD+ +V P Q ++ +    + +   ++ + L + G  N+Q      +L   +IE N R+SRS    SKA GY +   A +  +  P         E      EP  + +  K+P +   R  G    +G  M S GEV   G    E+  KA
Sbjct:  401 VLVLGSGGLSIGQAGEFDYSGSQAVKAMREENLQTVLINPNIASVQTNEVGTKQADSVYFLPVTPEFVTQVISVERPDGILLSMGGQTALNCGVELFQSGVLEKYGVKVLGTPVESIMATEDRQLFSDKLMEINEKIAPSFAVKTVAD-ALKAADEIGYPVMLRSAYALGGLGSGLCANKEKLEDTAHKALAMSSQ--ILVEKSLLGWKEVEYEVVRDIADNCVTVCNMENFDPLGIHTGDSIVVAPSQTLSNEEYHMLRETAIKVVRHLGIVGECNIQYALHPSSLEYCIIEVNARLSRSSALASKATGYPLAFVAAKLALGIPLPEIKNAVSEQTTACFEPSLDYIVTKIPRWDLDRFHGMSREIGSAMKSVGEVMAVGRSFEESIQKA 788          

HSP 4 Score: 109.383 bits (272), Expect = 2.543e-23
Identity = 98/373 (26.27%), Postives = 171/373 (45.84%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAA--FAHTSQVLVDKSLRGWKEIEYEVVR---DVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLG-----MSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKV-----CNKISSSMXKCW*NNV 2365
            EFD+    +++ALR+ G +TV+VN N  TV T     D+ Y   +T + + ++ + E   G  ++ GGQ   N  + L  +G      V +LGT+   I   E+R  FS IL+++    AP  A  ++++ +  A  +GYP ++R ++ L G          E+      A   +    V++ K +RG +E+E + V     V  + IT    E+V+  G+H+G++ ++ P+QT+S      ++    K+ +   + G  N Q+ +  N     +IE N R SRS    SK  G     VA ++ +G       L SL N +  V         D+  +K P +   +  +      C   S+    C+  N+
Sbjct:  967 EFDWCAVSSIRALRQMGKRTVVVNHNPETVSTDFDECDRLYFEELTLERILDITQQEGCTGCIVSVGGQIPNNLAMPLHLNG------VKILGTNPAQIDRAEERSVFSSILDDLGVGQAPWRALSSLEDAVSFASNVGYPCLLRPSYVLSGSAMNVVYGEDEMKRFLEEATQVSQDHPVVITKFIRGAREVEVDAVARMGKVLAHAIT----EHVEDAGVHSGDATLMLPTQTISQGALEKVKTATQKIAKAFEISGPFNTQFLVKGND--VMVIECNLRASRSFPFVSKTIGVDFIDVATRVMVGERMDESRLPSLENPIIPV---------DFVGIKAPMFSWPRLREADPVLRCEMASTGEVACFGPNI 1318          
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Xenopus
Match: CAD (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:NCBI gene;Acc:100125119])

HSP 1 Score: 1067.76 bits (2760), Expect = 0.000e+0
Identity = 536/896 (59.82%), Postives = 691/896 (77.12%), Query Frame = 3
Query: 2346 SVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYVEKFTESGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKI---IKCLNELEEPRTYLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDW---DTGNQASSDSKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQALRKAIYKKKICVASPT---IDCITSQKIYRFPGLVDIHVHTRDPGQVHKEDWSTVTKXXXXXXXXXXFAMPNTAPPITNLESFELAKKRASSLAHCDYGLYVGASNDNWESLAELAPEAIGLKMYLNPTFSTLQMNNFSTWAKHFKHFPENRPICCHAEGETMAAVILLAQLHNRHVHICHVSRKQEIELIRLAKSQGLKVTCEVSPHH 5006
            SVGE+MSVGR FEEAFQKALRMVDE   GFD  ++  ++  L +PTD+R+ VLA AL+ G +++ +Y+LTKID WFL+K   I   +  L    +  T + +++LL AK LGFSD QIA AV+STE+AVR++R EL + P+V Q+DTV+AEWP  TNYLYL+Y+G +HD+ FE  ++MV+GSGVYRIGSSVEFDWCAV CI+EL++M  KTIMVN NPETVSTDYDMCD L+F+E+S E V+DI+ +E P+G+I+SMGGQLPNNIAM LHR++  + GTSP  ID+AENRFKFSRMLD+IGI QP+WKEL+D ESA+ FCN V +PC+VRPSYVLSGAAMNVA S+ DL + L+ AVAV+K+HPVVISKFI++AKEIDVDAVA  G ++  A+SEHVENAG+HSGDATLVTP QD+  KTL++I  I+  +  EL+V+GPFN+QLIAKDD L VIECN+RVSRSFPFVSK LG N++A AT+ IM E   +E   +      V VKVP FSF+RL GADV+LGVEM STGEVACFGE+R EA+LKA L+ G KIP+   NI ++IGSYK+K ELL +VR + SLGY+LYASLGTADFY E GI V A+DW   ++ N      K+ +  D++ E+  DL+INL  RNSG RR S  +T GY+ RRLA+DY + L+ ++KCTKLFV+ALR      +I  A P    +DC+TSQK+ R PGLVDIHVH R+PG  HKED+S+ T AA+AGGIT + AMPNT+P IT+  SF LA+K A + A CD+ L++GAS++N  SL+ +A  A GLKMYLN T+S L+M+N S W +HF+ +P + PI  HAE +T+AA++++AQL+ R VHICHV++K+EI +I+ AK +G++VTCEV+PHH
Sbjct:  386 SVGEVMSVGRNFEEAFQKALRMVDENCVGFDHCIKSASDEELETPTDKRIFVLAAALRAGYTIERLYELTKIDRWFLHKMKNITDQVATLESYHQDETLMPREVLLRAKQLGFSDKQIALAVQSTELAVRKMRQELLILPVVKQLDTVAAEWPAQTNYLYLTYNGTEHDLAFEEPHVMVIGSGVYRIGSSVEFDWCAVGCIQELRKMGFKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGIILSMGGQLPNNIAMSLHRQQCRVLGTSPEAIDSAENRFKFSRMLDTIGISQPQWKELSDMESAVQFCNTVGFPCVVRPSYVLSGAAMNVAHSDGDLEKVLSNAVAVSKEHPVVISKFIQEAKEIDVDAVACDGVVVAVAISEHVENAGVHSGDATLVTPAQDITPKTLERIKAIVHAVGLELQVNGPFNLQLIAKDDQLKVIECNVRVSRSFPFVSKTLGVNLVALATQVIMGE--EVEPVGVMTGTGIVGVKVPQFSFSRLAGADVVLGVEMTSTGEVACFGENRYEAYLKAMLSTGFKIPQ--KNILLTIGSYKNKSELLPTVRAMESLGYSLYASLGTADFYTEHGIKVKAMDWPFEESENDGPLREKQGSIMDHLSENHFDLVINLSMRNSGGRRLSSFVTRGYRARRLAVDYSVPLIIDIKCTKLFVEALR------QIGGAPPVKTHVDCMTSQKLIRLPGLVDIHVHLREPGATHKEDFSSGTAAALAGGITLVCAMPNTSPAITDASSFSLAQKLAEAGARCDFALFLGASSENAASLSSMASSAAGLKMYLNDTYSQLKMDNVSVWMEHFEKWPAHMPIVAHAEKQTVAAILMVAQLYQRPVHICHVAKKEEILIIKAAKQKGIQVTCEVAPHH 1271          

HSP 2 Score: 364.77 bits (935), Expect = 5.169e-102
Identity = 234/397 (58.94%), Postives = 288/397 (72.54%), Query Frame = 2
Query: 1163 QRLTNRLTYQHTQHELTLTALLENKPKKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVK----ECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
            QR+T  LTY+ +    ++T L  ++P K+LILGSGGLSIGQAGEFDYSG+QA+KAL+EE IQTVL+NPNIATVQT+ G+ADK Y LPIT +              Y+T    + L   ++   S ++K     V   S+ ++ +                   P+   + +     +   AAE+LGYPV++R+A+ALGGLGSGFA+   EL  L   AFAHT+QVLVDKSL+GWKEIEYEVVRD Y+NC+TVCNMENVDPLGIHTGES+VVAPSQTL++ EY MLR  A+KV+++LG+VGECNIQYAL+P S +YYIIEVNARLSRSSALASKATGYPLAYVAAKL LG+ L  LRNSVT  TTA FEPS+DYCVVK+PRWDL+KF +V  KI SSM
Sbjct:   21 QRVTELLTYKESP---SVTDLEASRPHKVLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTVLINPNIATVQTSKGLADKVYFLPITPE--------------YVTQVSVSLLILSLQQGGSCLYKGLTKWVEHHSLVSLPICP----------------VPTCCFFILMLLCLQAQAAAERLGYPVLVRSAYALGGLGSGFASTKEELTALVCQAFAHTTQVLVDKSLKGWKEIEYEVVRDAYNNCVTVCNMENVDPLGIHTGESIVVAPSQTLNDREYNMLRNTAIKVIQHLGIVGECNIQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPVLRNSVTNSTTANFEPSLDYCVVKVPRWDLSKFLRVSTKIGSSM 384          

HSP 3 Score: 93.2041 bits (230), Expect = 3.660e-18
Identity = 85/305 (27.87%), Postives = 151/305 (49.51%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQ--VLVDKSLRGWKEIEYEVVRDVYDN-CITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLG 2197
            EFD+     ++ LR+ G +T++VN N  TV T   + D+ Y   I+ + V ++ ++E P+G+ L+ GGQ   N  + L         +  VLGTS E I   E+R +FS +L+ I            ++  +     +G+P ++R ++ L G     A++  +L  + S A A + +  V++ K ++  KEI+ + V    D   + V   E+V+  G+H+G++ +V P+Q ++      ++     V   L V G  N+Q  L     +  +IE N R+SRS    SK  G  L  +A ++ +G
Sbjct:  577 EFDWCAVGCIQELRKMGFKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGIILSMGGQLPNNIAMSLHRQ------QCRVLGTSPEAIDSAENRFKFSRMLDTIGISQPQWKELSDMESAVQFCNTVGFPCVVRPSYVLSGAAMNVAHSDGDLEKVLSNAVAVSKEHPVVISKFIQEAKEIDVDAV--ACDGVVVAVAISEHVENAGVHSGDATLVTPAQDITPKTLERIKAIVHAVGLELQVNGPFNLQ--LIAKDDQLKVIECNVRVSRSFPFVSKTLGVNLVALATQVIMG 871          

HSP 4 Score: 92.0485 bits (227), Expect = 7.306e-18
Identity = 72/237 (30.38%), Postives = 112/237 (47.26%), Query Frame = 3
Query: 3309 YPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAV--AYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQ--LIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPF---------SLECEFLRGEP--NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            YP LVR +Y L G     A ++ +LT  + QA A      V++ K ++  KEI+ + V  AY   +    + E+V+  GIH+G++ +V P Q +N++    +     ++ Q L + G  N+Q  L  + +   +IE N R+SRS    SKA GY +   A +  +  P          S    F   EP  +   VKVP +  ++       +G  M S GEV   G +  EAF KA
Sbjct:  174 YPVLVRSAYALGGLGSGFASTKEELTALVCQAFAHTTQ--VLVDKSLKGWKEIEYEVVRDAYNNCVTVCNM-ENVDPLGIHTGESIVVAPSQTLNDREYNMLRNTAIKVIQHLGIVGECNIQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPVLRNSVTNSTTANF---EPSLDYCVVKVPRWDLSKFLRVSTKIGSSMKSVGEVMSVGRNFEEAFQKA 404          
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Xenopus
Match: CAD (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:NCBI gene;Acc:100125119])

HSP 1 Score: 1067.37 bits (2759), Expect = 0.000e+0
Identity = 536/896 (59.82%), Postives = 691/896 (77.12%), Query Frame = 3
Query: 2346 SVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYVEKFTESGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKI---IKCLNELEEPRTYLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDW---DTGNQASSDSKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQALRKAIYKKKICVASPT---IDCITSQKIYRFPGLVDIHVHTRDPGQVHKEDWSTVTKXXXXXXXXXXFAMPNTAPPITNLESFELAKKRASSLAHCDYGLYVGASNDNWESLAELAPEAIGLKMYLNPTFSTLQMNNFSTWAKHFKHFPENRPICCHAEGETMAAVILLAQLHNRHVHICHVSRKQEIELIRLAKSQGLKVTCEVSPHH 5006
            SVGE+MSVGR FEEAFQKALRMVDE   GFD  ++  ++  L +PTD+R+ VLA AL+ G +++ +Y+LTKID WFL+K   I   +  L    +  T + +++LL AK LGFSD QIA AV+STE+AVR++R EL + P+V Q+DTV+AEWP  TNYLYL+Y+G +HD+ FE  ++MV+GSGVYRIGSSVEFDWCAV CI+EL++M  KTIMVN NPETVSTDYDMCD L+F+E+S E V+DI+ +E P+G+I+SMGGQLPNNIAM LHR++  + GTSP  ID+AENRFKFSRMLD+IGI QP+WKEL+D ESA+ FCN V +PC+VRPSYVLSGAAMNVA S+ DL + L+ AVAV+K+HPVVISKFI++AKEIDVDAVA  G ++  A+SEHVENAG+HSGDATLVTP QD+  KTL++I  I+  +  EL+V+GPFN+QLIAKDD L VIECN+RVSRSFPFVSK LG N++A AT+ IM E   +E   +      V VKVP FSF+RL GADV+LGVEM STGEVACFGE+R EA+LKA L+ G KIP+   NI ++IGSYK+K ELL +VR + SLGY+LYASLGTADFY E GI V A+DW   ++ N      K+ +  D++ E+  DL+INL  RNSG RR S  +T GY+ RRLA+DY + L+ ++KCTKLFV+ALR      +I  A P    +DC+TSQK+ R PGLVDIHVH R+PG  HKED+S+ T AA+AGGIT + AMPNT+P IT+  SF LA+K A + A CD+ L++GAS++N  SL+ +A  A GLKMYLN T+S L+M+N S W +HF+ +P + PI  HAE +T+AA++++AQL+ R VHICHV++K+EI +I+ AK +G++VTCEV+PHH
Sbjct:  395 SVGEVMSVGRNFEEAFQKALRMVDENCVGFDHCIKSASDEELETPTDKRIFVLAAALRAGYTIERLYELTKIDRWFLHKMKNITDQVATLESYHQDETLMPREVLLRAKQLGFSDKQIALAVQSTELAVRKMRQELLILPVVKQLDTVAAEWPAQTNYLYLTYNGTEHDLAFEEPHVMVIGSGVYRIGSSVEFDWCAVGCIQELRKMGFKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGIILSMGGQLPNNIAMSLHRQQCRVLGTSPEAIDSAENRFKFSRMLDTIGISQPQWKELSDMESAVQFCNTVGFPCVVRPSYVLSGAAMNVAHSDGDLEKVLSNAVAVSKEHPVVISKFIQEAKEIDVDAVACDGVVVAVAISEHVENAGVHSGDATLVTPAQDITPKTLERIKAIVHAVGLELQVNGPFNLQLIAKDDQLKVIECNVRVSRSFPFVSKTLGVNLVALATQVIMGE--EVEPVGVMTGTGIVGVKVPQFSFSRLAGADVVLGVEMTSTGEVACFGENRYEAYLKAMLSTGFKIPQ--KNILLTIGSYKNKSELLPTVRAMESLGYSLYASLGTADFYTEHGIKVKAMDWPFEESENDGPLREKQGSIMDHLSENHFDLVINLSMRNSGGRRLSSFVTRGYRARRLAVDYSVPLIIDIKCTKLFVEALR------QIGGAPPVKTHVDCMTSQKLIRLPGLVDIHVHLREPGATHKEDFSSGTAAALAGGITLVCAMPNTSPAITDASSFSLAQKLAEAGARCDFALFLGASSENAASLSSMASSAAGLKMYLNDTYSQLKMDNVSVWMEHFEKWPAHMPIVAHAEKQTVAAILMVAQLYQRPVHICHVAKKEEILIIKAAKQKGIQVTCEVAPHH 1280          

HSP 2 Score: 373.629 bits (958), Expect = 7.467e-105
Identity = 244/405 (60.25%), Postives = 291/405 (71.85%), Query Frame = 2
Query: 1163 QRLTNRLTYQHTQHELTLTALLENKPKKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECI------------DAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
            QR+T  LTY+ +    ++T L  ++P K+LILGSGGLSIGQAGEFDYSG+QA+KAL+EE IQTVL+NPNIATVQT+ G+ADK Y LPIT +YVT+V        V L           + L++ G    YK   L  ++    +   R R            A SL    V  C              AAE+LGYPV++R+A+ALGGLGSGFA+   EL  L   AFAHT+QVLVDKSL+GWKEIEYEVVRD Y+NC+TVCNMENVDPLGIHTGES+VVAPSQTL++ EY MLR  A+KV+++LG+VGECNIQYAL+P S +YYIIEVNARLSRSSALASKATGYPLAYVAAKL LG+ L  LRNSVT  TTA FEPS+DYCVVK+PRWDL+KF +V  KI SSM
Sbjct:   21 QRVTELLTYKESP---SVTDLEASRPHKVLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTVLINPNIATVQTSKGLADKVYFLPITPEYVTQV-------SVSLLI---------LSLQQGGSCL-YKGPPLVIALYVPSVPPVRAR------------AHSLPICPVPTCCFFILMLLCLQAQAAAERLGYPVLVRSAYALGGLGSGFASTKEELTALVCQAFAHTTQVLVDKSLKGWKEIEYEVVRDAYNNCVTVCNMENVDPLGIHTGESIVVAPSQTLNDREYNMLRNTAIKVIQHLGIVGECNIQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPVLRNSVTNSTTANFEPSLDYCVVKVPRWDLSKFLRVSTKIGSSM 393          

HSP 3 Score: 105.916 bits (263), Expect = 5.501e-22
Identity = 107/397 (26.95%), Postives = 177/397 (44.58%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXV------LDIFHIEQP-----DGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAV--AYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQ--LIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRG----------EP--NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            +++LGSG   IG + EFD+   + IK L+    +T+++N N  TV T   + D ++F  ++ E V      L I  ++Q       G  + +   +P+   +      +PI      C         F  ML    +C         +++A      + YP LVR +Y L G     A ++ +LT  + QA A      V++ K ++  KEI+ + V  AY   +    + E+V+  GIH+G++ +V P Q +N++    +     ++ Q L + G  N+Q  L  + +   +IE N R+SRS    SKA GY +   A +  +  P  +    LR           EP  +   VKVP +  ++       +G  M S GEV   G +  EAF KA
Sbjct:   46 VLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTVLINPNIATVQTSKGLADKVYFLPITPEYVTQVSVSLLILSLQQGGSCLYKGPPLVIALYVPSVPPVRARAHSLPICPVPTCCF--------FILML----LC-------LQAQAA---AERLGYPVLVRSAYALGGLGSGFASTKEELTALVCQAFAHTTQ--VLVDKSLKGWKEIEYEVVRDAYNNCVTVCNM-ENVDPLGIHTGESIVVAPSQTLNDREYNMLRNTAIKVIQHLGIVGECNIQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPV----LRNSVTNSTTANFEPSLDYCVVKVPRWDLSKFLRVSTKIGSSMKSVGEVMSVGRNFEEAFQKA 413          

HSP 4 Score: 93.2041 bits (230), Expect = 3.854e-18
Identity = 85/305 (27.87%), Postives = 151/305 (49.51%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQ--VLVDKSLRGWKEIEYEVVRDVYDN-CITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLG 2197
            EFD+     ++ LR+ G +T++VN N  TV T   + D+ Y   I+ + V ++ ++E P+G+ L+ GGQ   N  + L         +  VLGTS E I   E+R +FS +L+ I            ++  +     +G+P ++R ++ L G     A++  +L  + S A A + +  V++ K ++  KEI+ + V    D   + V   E+V+  G+H+G++ +V P+Q ++      ++     V   L V G  N+Q  L     +  +IE N R+SRS    SK  G  L  +A ++ +G
Sbjct:  586 EFDWCAVGCIQELRKMGFKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGIILSMGGQLPNNIAMSLHRQ------QCRVLGTSPEAIDSAENRFKFSRMLDTIGISQPQWKELSDMESAVQFCNTVGFPCVVRPSYVLSGAAMNVAHSDGDLEKVLSNAVAVSKEHPVVISKFIQEAKEIDVDAV--ACDGVVVAVAISEHVENAGVHSGDATLVTPAQDITPKTLERIKAIVHAVGLELQVNGPFNLQ--LIAKDDQLKVIECNVRVSRSFPFVSKTLGVNLVALATQVIMG 880          
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Xenopus
Match: CAD (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:NCBI gene;Acc:100125119])

HSP 1 Score: 1065.83 bits (2755), Expect = 0.000e+0
Identity = 536/896 (59.82%), Postives = 691/896 (77.12%), Query Frame = 3
Query: 2346 SVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYVEKFTESGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKI---IKCLNELEEPRTYLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDW---DTGNQASSDSKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQALRKAIYKKKICVASPT---IDCITSQKIYRFPGLVDIHVHTRDPGQVHKEDWSTVTKXXXXXXXXXXFAMPNTAPPITNLESFELAKKRASSLAHCDYGLYVGASNDNWESLAELAPEAIGLKMYLNPTFSTLQMNNFSTWAKHFKHFPENRPICCHAEGETMAAVILLAQLHNRHVHICHVSRKQEIELIRLAKSQGLKVTCEVSPHH 5006
            SVGE+MSVGR FEEAFQKALRMVDE   GFD  ++  ++  L +PTD+R+ VLA AL+ G +++ +Y+LTKID WFL+K   I   +  L    +  T + +++LL AK LGFSD QIA AV+STE+AVR++R EL + P+V Q+DTV+AEWP  TNYLYL+Y+G +HD+ FE  ++MV+GSGVYRIGSSVEFDWCAV CI+EL++M  KTIMVN NPETVSTDYDMCD L+F+E+S E V+DI+ +E P+G+I+SMGGQLPNNIAM LHR++  + GTSP  ID+AENRFKFSRMLD+IGI QP+WKEL+D ESA+ FCN V +PC+VRPSYVLSGAAMNVA S+ DL + L+ AVAV+K+HPVVISKFI++AKEIDVDAVA  G ++  A+SEHVENAG+HSGDATLVTP QD+  KTL++I  I+  +  EL+V+GPFN+QLIAKDD L VIECN+RVSRSFPFVSK LG N++A AT+ IM E   +E   +      V VKVP FSF+RL GADV+LGVEM STGEVACFGE+R EA+LKA L+ G KIP+   NI ++IGSYK+K ELL +VR + SLGY+LYASLGTADFY E GI V A+DW   ++ N      K+ +  D++ E+  DL+INL  RNSG RR S  +T GY+ RRLA+DY + L+ ++KCTKLFV+ALR      +I  A P    +DC+TSQK+ R PGLVDIHVH R+PG  HKED+S+ T AA+AGGIT + AMPNT+P IT+  SF LA+K A + A CD+ L++GAS++N  SL+ +A  A GLKMYLN T+S L+M+N S W +HF+ +P + PI  HAE +T+AA++++AQL+ R VHICHV++K+EI +I+ AK +G++VTCEV+PHH
Sbjct:  541 SVGEVMSVGRNFEEAFQKALRMVDENCVGFDHCIKSASDEELETPTDKRIFVLAAALRAGYTIERLYELTKIDRWFLHKMKNITDQVATLESYHQDETLMPREVLLRAKQLGFSDKQIALAVQSTELAVRKMRQELLILPVVKQLDTVAAEWPAQTNYLYLTYNGTEHDLAFEEPHVMVIGSGVYRIGSSVEFDWCAVGCIQELRKMGFKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGIILSMGGQLPNNIAMSLHRQQCRVLGTSPEAIDSAENRFKFSRMLDTIGISQPQWKELSDMESAVQFCNTVGFPCVVRPSYVLSGAAMNVAHSDGDLEKVLSNAVAVSKEHPVVISKFIQEAKEIDVDAVACDGVVVAVAISEHVENAGVHSGDATLVTPAQDITPKTLERIKAIVHAVGLELQVNGPFNLQLIAKDDQLKVIECNVRVSRSFPFVSKTLGVNLVALATQVIMGE--EVEPVGVMTGTGIVGVKVPQFSFSRLAGADVVLGVEMTSTGEVACFGENRYEAYLKAMLSTGFKIPQ--KNILLTIGSYKNKSELLPTVRAMESLGYSLYASLGTADFYTEHGIKVKAMDWPFEESENDGPLREKQGSIMDHLSENHFDLVINLSMRNSGGRRLSSFVTRGYRARRLAVDYSVPLIIDIKCTKLFVEALR------QIGGAPPVKTHVDCMTSQKLIRLPGLVDIHVHLREPGATHKEDFSSGTAAALAGGITLVCAMPNTSPAITDASSFSLAQKLAEAGARCDFALFLGASSENAASLSSMASSAAGLKMYLNDTYSQLKMDNVSVWMEHFEKWPAHMPIVAHAEKQTVAAILMVAQLYQRPVHICHVAKKEEILIIKAAKQKGIQVTCEVAPHH 1426          

HSP 2 Score: 619.002 bits (1595), Expect = 0.000e+0
Identity = 336/513 (65.50%), Postives = 413/513 (80.51%), Query Frame = 2
Query:  806 CLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVTAVKS-NTATVSLDQRLTNRLTYQHTQHELTLTALLENKPKKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
            C   ++LA+ I        YGNRGHNQPC H  ++RCF+TSQNHG+AV  +++P+ W  LF N ND+SNEGIIH   PF SVQFHPEH +GP D+  LF VF++ V   K+ ++   ++ QR+T  LTY+ +    ++T L  ++P K+LILGSGGLSIGQAGEFDYSG+QA+KAL+EE IQTVL+NPNIATVQT+ G+ADK Y LPIT +YVT+VIK ERPDG+ LTFGGQTALNCG+EL + GV + Y V VLGT +++I+MTEDR+ F E +EEI E VAPS AA+++++   AAE+LGYPV++R+A+ALGGLGSGFA+   EL  L   AFAHT+QVLVDKSL+GWKEIEYEVVRD Y+NC+TVCNMENVDPLGIHTGES+VVAPSQTL++ EY MLR  A+KV+++LG+VGECNIQYAL+P S +YYIIEVNARLSRSSALASKATGYPLAYVAAKL LG+ L  LRNSVT  TTA FEPS+DYCVVK+PRWDL+KF +V  KI SSM
Sbjct:   36 CFMAEILAICITA------YGNRGHNQPCIHESSRRCFITSQNHGYAVDPNTLPEGWSPLFTNANDQSNEGIIHDSKPFFSVQFHPEHCAGPMDLVGLFDVFLDTVRDRKAGDSGEKTVKQRVTELLTYKESP---SVTDLEASRPHKVLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTVLINPNIATVQTSKGLADKVYFLPITPEYVTQVIKNERPDGILLTFGGQTALNCGVELTKQGVLEKYNVRVLGTPVKSIEMTEDRKVFVEKMEEIGEHVAPSEAAFSLEQAQAAAERLGYPVLVRSAYALGGLGSGFASTKEELTALVCQAFAHTTQVLVDKSLKGWKEIEYEVVRDAYNNCVTVCNMENVDPLGIHTGESIVVAPSQTLNDREYNMLRNTAIKVIQHLGIVGECNIQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPVLRNSVTNSTTANFEPSLDYCVVKVPRWDLSKFLRVSTKIGSSM 539          

HSP 3 Score: 145.591 bits (366), Expect = 4.426e-34
Identity = 113/392 (28.83%), Postives = 187/392 (47.70%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHRE------KIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAV--AYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQ--LIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRG----------EP--NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            +++LGSG   IG + EFD+   + IK L+    +T+++N N  TV T   + D ++F  ++ E V  +   E+PDG++++ GGQ   N  + L ++       + + GT    I+  E+R  F   ++ IG      +     E A      + YP LVR +Y L G     A ++ +LT  + QA A      V++ K ++  KEI+ + V  AY   +    + E+V+  GIH+G++ +V P Q +N++    +     ++ Q L + G  N+Q  L  + +   +IE N R+SRS    SKA GY +   A +  +  P  +    LR           EP  +   VKVP +  ++       +G  M S GEV   G +  EAF KA
Sbjct:  175 VLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTVLINPNIATVQTSKGLADKVYFLPITPEYVTQVIKNERPDGILLTFGGQTALNCGVELTKQGVLEKYNVRVLGTPVKSIEMTEDRKVFVEKMEEIGEHVAPSEAAFSLEQAQAAAERLGYPVLVRSAYALGGLGSGFASTKEELTALVCQAFAHTTQ--VLVDKSLKGWKEIEYEVVRDAYNNCVTVCNM-ENVDPLGIHTGESIVVAPSQTLNDREYNMLRNTAIKVIQHLGIVGECNIQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPV----LRNSVTNSTTANFEPSLDYCVVKVPRWDLSKFLRVSTKIGSSMKSVGEVMSVGRNFEEAFQKA 559          

HSP 4 Score: 93.5893 bits (231), Expect = 2.756e-18
Identity = 85/305 (27.87%), Postives = 151/305 (49.51%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQ--VLVDKSLRGWKEIEYEVVRDVYDN-CITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLG 2197
            EFD+     ++ LR+ G +T++VN N  TV T   + D+ Y   I+ + V ++ ++E P+G+ L+ GGQ   N  + L         +  VLGTS E I   E+R +FS +L+ I            ++  +     +G+P ++R ++ L G     A++  +L  + S A A + +  V++ K ++  KEI+ + V    D   + V   E+V+  G+H+G++ +V P+Q ++      ++     V   L V G  N+Q  L     +  +IE N R+SRS    SK  G  L  +A ++ +G
Sbjct:  732 EFDWCAVGCIQELRKMGFKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGIILSMGGQLPNNIAMSLHRQ------QCRVLGTSPEAIDSAENRFKFSRMLDTIGISQPQWKELSDMESAVQFCNTVGFPCVVRPSYVLSGAAMNVAHSDGDLEKVLSNAVAVSKEHPVVISKFIQEAKEIDVDAV--ACDGVVVAVAISEHVENAGVHSGDATLVTPAQDITPKTLERIKAIVHAVGLELQVNGPFNLQ--LIAKDDQLKVIECNVRVSRSFPFVSKTLGVNLVALATQVIMG 1026          
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Xenopus
Match: CAD (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:NCBI gene;Acc:100125119])

HSP 1 Score: 756.133 bits (1951), Expect = 0.000e+0
Identity = 401/749 (53.54%), Postives = 515/749 (68.76%), Query Frame = 3
Query: 2346 SVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYVEKFTESGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKI---IKCLNELEEPRTYLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDW---DTGNQASSDSKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQ----------------ALRKAIY---------KKKICVASPT---IDCITSQKIYRFPGLVDI 4490
            SVGE+MSVGR FEEAFQKALRMVDE   GFD  ++  ++  L +PTD+R+ VLA AL+ G +++ +Y+LTKID WFL+K   I   +  L    +  T + +++LL AK LGFSD QIA AV  TE+AVR++R EL + P+V Q+DTV+AEWP  TNYLYL+Y+G +HD+ FE  ++MV+GSGVYRIGSSVEFDWCAV CI+EL++M  KTIMVN NPETVSTDYDMCD L+F+E+S E V+DI+ +E P+G+I+SMGGQLPNNIAM LHR++  + GTSP  ID+AENRFKFSRMLD+IGI QP+WKEL+D ESA+ FCN V +PC+VRPSYVLSGAAMNVA S+ DL + L+ AVAV+K+HPVVISKFI++AKEIDVDAVA  G ++  A+SEHVENAG+HSGDATLVTP QD+  KTL++I  I+      L           A+DD L VIECN+RVSRSFPFVSK LG N++A AT+ IM E   +E   +      V VKVP FSF+RL GADV+LGVEM STGEVACFGE+R EA+LKA L+ G KIP+   NI ++IGSYK                             +  G    A+DW   ++ N      K+ +  D++ E+  DL+INL  RNSG RR S  +T GY+ RRLA+DY + L+ ++KCTKLFV+                A+   ++          ++I  A P    +DC+TSQK+ R PG  D+
Sbjct:  475 SVGEVMSVGRNFEEAFQKALRMVDENCVGFDHCIKSASDEELETPTDKRIFVLAAALRAGYTIERLYELTKIDRWFLHKMKNITDQVATLESYHQDETLMPREVLLRAKQLGFSDKQIALAV--TELAVRKMRQELLILPVVKQLDTVAAEWPAQTNYLYLTYNGTEHDLAFEEPHVMVIGSGVYRIGSSVEFDWCAVGCIQELRKMGFKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGIILSMGGQLPNNIAMSLHRQQCRVLGTSPEAIDSAENRFKFSRMLDTIGISQPQWKELSDMESAVQFCNTVGFPCVVRPSYVLSGAAMNVAHSDGDLEKVLSNAVAVSKEHPVVISKFIQEAKEIDVDAVACDGVVVAVAISEHVENAGVHSGDATLVTPAQDITPKTLERIKAIVHASISPLP----------AQDDQLKVIECNVRVSRSFPFVSKTLGVNLVALATQVIMGE--EVEPVGVMTGTGIVGVKVPQFSFSRLAGADVVLGVEMTSTGEVACFGENRYEAYLKAMLSTGFKIPQK--NILLTIGSYK-----------------------------VRGGRPKLAMDWPFEESENDGPLREKQGSIMDHLSENHFDLVINLSMRNSGGRRLSSFVTRGYRARRLAVDYSVPLIIDIKCTKLFVEVRGLVGGGFQPSHCFVAISSLVFIPLVPPSQALRQIGGAPPVKTHVDCMTSQKLIRLPGEGDL 1178          

HSP 2 Score: 585.104 bits (1507), Expect = 0.000e+0
Identity = 324/493 (65.72%), Postives = 386/493 (78.30%), Query Frame = 2
Query:  863 YGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVTAVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKPKKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
            YGNRGHNQPC H  ++RCF+TSQNHG+AV  +++P+ W  LF N ND+SNEGIIH   PF SVQFHPEH +GP D+  LF VF++ V   K+  +    D                    L  ++P K+LILGSGGLSIGQAGEFDYSG+QA+KAL+EE IQTVL+NPNIATVQT+ G+ADK Y LPIT +YVT+VIK ERPDG+ LTFGGQTALNCG+EL + GV + Y V VLGT +++I+MTEDR+ F E +EEI E VAPS      +    AAE+LGYPV++R+A+ALGGLGSGFA+   EL  L   AFAHT+QVLVDKSL+GWKEIEYEVVRD Y+NC+TVCNMENVDPLGIHTGES+VVAPSQTL++ EY MLR  A+KV+++LG+VGECNIQYAL+P S +YYIIEVNARLSRSSALASKATGYPLAYVAAKL LG+ L  LRNSVT  TTA FEPS+DYCVVK+PRWDL+KF +V  KI SSM
Sbjct:    7 YGNRGHNQPCIHESSRRCFITSQNHGYAVDPNTLPEGWSPLFTNANDQSNEGIIHDSKPFFSVQFHPEHCAGPMDLVGLFDVFLDTVRDRKAGDSGEKTD--------------------LEASRPHKVLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTVLINPNIATVQTSKGLADKVYFLPITPEYVTQVIKNERPDGILLTFGGQTALNCGVELTKQGVLEKYNVRVLGTPVKSIEMTEDRKVFVEKMEEIGEHVAPS------EAAQAAAERLGYPVLVRSAYALGGLGSGFASTKEELTALVCQAFAHTTQVLVDKSLKGWKEIEYEVVRDAYNNCVTVCNMENVDPLGIHTGESIVVAPSQTLNDREYNMLRNTAIKVIQHLGIVGECNIQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPVLRNSVTNSTTANFEPSLDYCVVKVPRWDLSKFLRVSTKIGSSM 473          

HSP 3 Score: 146.747 bits (369), Expect = 1.344e-34
Identity = 114/391 (29.16%), Postives = 188/391 (48.08%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHRE------KIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAV--AYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQ--LIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPF---------SLECEFLRGEP--NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            +++LGSG   IG + EFD+   + IK L+    +T+++N N  TV T   + D ++F  ++ E V  +   E+PDG++++ GGQ   N  + L ++       + + GT    I+  E+R  F   ++ IG      + +  SE+A      + YP LVR +Y L G     A ++ +LT  + QA A      V++ K ++  KEI+ + V  AY    +     E+V+  GIH+G++ +V P Q +N++    +     ++ Q L + G  N+Q  L  + +   +IE N R+SRS    SKA GY +   A +  +  P          S    F   EP  +   VKVP +  ++       +G  M S GEV   G +  EAF KA
Sbjct:  115 VLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTVLINPNIATVQTSKGLADKVYFLPITPEYVTQVIKNERPDGILLTFGGQTALNCGVELTKQGVLEKYNVRVLGTPVKSIEMTEDRKVFVEKMEEIG------EHVAPSEAAQAAAERLGYPVLVRSAYALGGLGSGFASTKEELTALVCQAFAHTTQ--VLVDKSLKGWKEIEYEVVRDAY-NNCVTVCNMENVDPLGIHTGESIVVAPSQTLNDREYNMLRNTAIKVIQHLGIVGECNIQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPVLRNSVTNSTTANF---EPSLDYCVVKVPRWDLSKFLRVSTKIGSSMKSVGEVMSVGRNFEEAFQKA 493          

HSP 4 Score: 90.1225 bits (222), Expect = 2.787e-17
Identity = 65/234 (27.78%), Postives = 121/234 (51.71%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQ--VLVDKSLRGWKEIEYEVVRDVYDN-CITVCNMENVDPLGIHTGESVVVAPSQTLS 1984
            EFD+     ++ LR+ G +T++VN N  TV T   + D+ Y   I+ + V ++ ++E P+G+ L+ GGQ   N  + L         +  VLGTS E I   E+R +FS +L+ I            ++  +     +G+P ++R ++ L G     A++  +L  + S A A + +  V++ K ++  KEI+ + V    D   + V   E+V+  G+H+G++ +V P+Q ++
Sbjct:  664 EFDWCAVGCIQELRKMGFKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGIILSMGGQLPNNIAMSLHRQ------QCRVLGTSPEAIDSAENRFKFSRMLDTIGISQPQWKELSDMESAVQFCNTVGFPCVVRPSYVLSGAAMNVAHSDGDLEKVLSNAVAVSKEHPVVISKFIQEAKEIDVDAV--ACDGVVVAVAISEHVENAGVHSGDATLVTPAQDIT 889          
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Xenopus
Match: ENSXETT00000045303.1 (carbamoyl-phosphate synthase 1 [Source:NCBI gene;Acc:100158506])

HSP 1 Score: 683.33 bits (1762), Expect = 0.000e+0
Identity = 379/768 (49.35%), Postives = 505/768 (65.76%), Query Frame = 2
Query:   47 LILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLINPLNNPELFIDPNERNLVEEVSINEIRHYNKNGNIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNADEYDALFISNGPGDPVKCTETIETIKNWITSEKPFMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVTAVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKPKKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTT---MGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
            L+L D T   G  FG      GEVVF TG+ GY E+++DP Y  Q+L LT PIIG+ G  D K LD +GL K  ES  I  +GL+V +Y+ E+S+W A  +LS+WL +  V  + GIDTR L KK+R+ G++ G I              P   +DPN+RNL++EVS  EI+ Y K   + +  +DCGVK+N IR   +  +++  +P     N+D                C     T         P  G+ +G+++ ALA G +T+++   NRG NQP  +    + F+T+QNH + V ++S+P+ W+ LF N ND SNEGI+H+  P  + QFHPE   GP D E LF VF+  +   K  T        +  +   Q  + E++   +L +          GGLSIGQAGEFDYSG+QA+KA++EE ++TVL+NPNIA+VQT    +  AD  Y LP+T  +VTEVIK ERPDG+ L  GGQTALNCG+EL + GV K+Y V VLGTS+E+I  TEDRQ FS+ L EI E +APS A  T+K+ +DAA+++GYPVMIR+A+ALGGLGSG   +   L+DL + A A ++Q+LV++S+ GWKEIEYEVVRD  DNC+TVCNMEN+D +G+HTG+S+VVAPSQTLSN E+ MLR CA+KVVR+LG+VGECNIQ+AL P S +Y IIEVNARLSRSSALASKATGYPLA++AAK+ LG+ L  ++N V+  TTACFEPS+DY V KIPRWDL++F      I SSM
Sbjct:   10 LVLEDGTKLKGYSFGHPTSVAGEVVFNTGLAGYVEAITDPGYRGQILTLTNPIIGNGGAPDTKALDSYGLMKFIESEHIQVSGLLVLDYTNEHSHWRAVKSLSEWLHEEKVPALCGIDTRMLAKKIRDKGTVLGKI---------EFEGKPVELVDPNKRNLIDEVSTKEIKVYGKGNPVKIVAVDCGVKHNTIRQLVQV-SKIRKLP-----NSD----------------CIYKYRT--------PPVFGVSMGNEIAALAAGARTYRLPMANRGQNQPVMNTMNGQAFITAQNHAYGVDSNSLPEGWKPLFVNINDHSNEGIMHETKPIFTAQFHPEGSPGPADTEFLFDVFMSMIKKGKGTTLA-----SVMPKPALQSKRIEVSKVLILGS----------GGLSIGQAGEFDYSGSQAVKAMKEENVKTVLMNPNIASVQTNEIGLKQADSVYFLPVTPQFVTEVIKAERPDGIILGMGGQTALNCGVELFKRGVLKEYGVKVLGTSVESIMATEDRQLFSDKLMEINEPIAPSFAVETIKDAVDAADKIGYPVMIRSAYALGGLGSGLCPDKETLMDLGTKALAMSNQILVERSVVGWKEIEYEVVRDAADNCVTVCNMENMDAMGVHTGDSIVVAPSQTLSNEEFQMLRSCAIKVVRHLGIVGECNIQFALHPTSLEYVIIEVNARLSRSSALASKATGYPLAFIAAKIALGIPLPEIKNVVSGKTTACFEPSLDYMVTKIPRWDLDRFHGTSGVIGSSM 723          

HSP 2 Score: 568.155 bits (1463), Expect = 0.000e+0
Identity = 309/697 (44.33%), Postives = 438/697 (62.84%), Query Frame = 3
Query: 2346 SVGEIMSVGRGFEEAFQKALRMVDEKLKGFD---PYVEKFTESG-----LSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKIIKCLNELEEPRT-YLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRI-GSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRGEP----NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDWDTGNQASSDSKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQALR 4394
            SVGE+M++GR FEE+FQKALRM    + GF    P  + +         ++ PT  R+  +A  L+ G+ + EI+ LT ID WFL+K   I+     L   R+  + ++ L  AK +GFSD  I + +  +E   R+LR+   V+P V QIDT++AE+P  TNYLYL+Y+G  +   F    + +  S ++ + GSSVEFDWCAV  I+ L+++ KKT++VNCNPETVSTD+D CD L+FEELS E +LD+F  E  DG I+S+GGQ+PNN+A+ L++  + I GTSP+ ID AE+R  FS +LD + I Q  WK +   + A+ F N V YPCL+RPSYVLSG+AMNV   E +L  +L +A  V+++HPVVI+KFI+ A+E+++DAVA  G+++  A+SEHVE+AG+HSGDATL+ P Q +++  L+K+     +IA    +SGPFNMQ + + +++LVIECNLR SRSFPFVSK LG + I  AT+ +  E            P    + V +K PMFS+ RL GAD +L  EM STGEVACFGE+   AFLKA ++ G K+P+ G  I I I  +  +   L + +QL   GY LYA+  TAD+   + +    V W +  Q    S   +    I E  +D++INLP  N+   R + +I      RR A D GI LLTN +  KLF +A++
Sbjct:  725 SVGEVMAIGRNFEESFQKALRMCHPSVDGFTANLPMNKSWAADANLRKEMAEPTSTRVYSMAKGLETGIHMDEIHKLTSIDKWFLHKMQGILNMEKTLRSTRSESVPEETLRRAKQIGFSDRYIGKCLGLSEAQTRELRLNKNVKPWVKQIDTLAAEYPAITNYLYLTYNGQPYMCPF----VSINASCLFPMTGSSVEFDWCAVSSIRTLRQLGKKTVVVNCNPETVSTDFDECDRLYFEELSQERILDVFQQEHCDGCIISVGGQIPNNLAVPLYKNGVKIMGTSPLQIDRAEDRSTFSAILDELQIAQAPWKAVNSLDDALQFTNTVGYPCLLRPSYVLSGSAMNVVHGEEELKNFLAEATRVSQEHPVVITKFIQGAREVEMDAVAKEGRVICHAISEHVEDAGVHSGDATLMIPTQTISQGALEKVKIATKKIANAFAISGPFNMQFLVRGNDVLVIECNLRASRSFPFVSKTLGVDFIDVATKVMTGEKVDEAALPTLASPIIPADYVGIKAPMFSWPRLRGADPVLRCEMASTGEVACFGENIYSAFLKAMISTGFKLPQKG--ILIGI-QHSFRPHFLGTAQQLKEEGYKLYATEATADWLNANDVPATHVAWPS--QEGKSSSSPSIYKLIKEGNIDMVINLPNNNTKHVRDNYLI------RRTAADCGIALLTNFQVVKLFAEAMK 1406          

HSP 3 Score: 136.732 bits (343), Expect = 1.825e-31
Identity = 101/390 (25.90%), Postives = 186/390 (47.69%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTD---YDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHRE------KIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGG-KLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNL--LVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRG------EP--NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            +++LGSG   IG + EFD+   + +K ++    KT+++N N  +V T+       D ++F  ++ + V ++   E+PDG+I+ MGGQ   N  + L +        + + GTS   I   E+R  FS  L  I         +   + A++  + + YP ++R +Y L G    +   +  L +  T+A+A++    +++ + +   KEI+ + V       +     E+++  G+H+GD+ +V P Q ++ +  Q +     ++ + L + G  N+Q      +L  ++IE N R+SRS    SKA GY +   A +  +  P       + G      EP  + +  K+P +   R  G   ++G  M S GEV   G +  E+F KA
Sbjct:  356 VLILGSGGLSIGQAGEFDYSGSQAVKAMKEENVKTVLMNPNIASVQTNEIGLKQADSVYFLPVTPQFVTEVIKAERPDGIILGMGGQTALNCGVELFKRGVLKEYGVKVLGTSVESIMATEDRQLFSDKLMEINEPIAPSFAVETIKDAVDAADKIGYPVMIRSAYALGGLGSGLCPDKETLMDLGTKALAMSNQ--ILVERSVVGWKEIEYEVVRDAADNCVTVCNMENMDAMGVHTGDSIVVAPSQTLSNEEFQMLRSCAIKVVRHLGIVGECNIQFALHPTSLEYVIIEVNARLSRSSALASKATGYPLAFIAAKIALGIPLPEIKNVVSGKTTACFEPSLDYMVTKIPRWDLDRFHGTSGVIGSSMKSVGEVMAIGRNFEESFQKA 743          

HSP 4 Score: 112.849 bits (281), Expect = 3.022e-24
Identity = 96/367 (26.16%), Postives = 170/367 (46.32%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAA--FAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNM--ENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKV-----CNKISSSMXKCW*NNV 2365
            EFD+    +++ LR+ G +TV+VN N  TV T     D+ Y   ++++ + +V + E  DG  ++ GGQ   N  + L ++GV       ++GTS   I   EDR  FS IL+E++   AP  A  ++ + +     +GYP ++R ++ L G      +   EL +  + A   +    V++ K ++G +E+E + V         +C+   E+V+  G+H+G++ ++ P+QT+S      ++    K+     + G  N+Q+ +  N     +IE N R SRS    SK  G     VA K+  G  +    +     T A      DY  +K P +   +         C   S+    C+  N+
Sbjct:  919 EFDWCAVSSIRTLRQLGKKTVVVNCNPETVSTDFDECDRLYFEELSQERILDVFQQEHCDGCIISVGGQIPNNLAVPLYKNGV------KIMGTSPLQIDRAEDRSTFSAILDELQIAQAPWKAVNSLDDALQFTNTVGYPCLLRPSYVLSGSAMNVVHGEEELKNFLAEATRVSQEHPVVITKFIQGAREVEMDAVA---KEGRVICHAISEHVEDAGVHSGDATLMIPTQTISQGALEKVKIATKKIANAFAISGPFNMQFLVRGND--VLVIECNLRASRSFPFVSKTLGVDFIDVATKVMTGEKV----DEAALPTLASPIIPADYVGIKAPMFSWPRLRGADPVLRCEMASTGEVACFGENI 1270          
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Mouse
Match: Cad (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:MGI Symbol;Acc:MGI:1916969])

HSP 1 Score: 1034.63 bits (2674), Expect = 0.000e+0
Identity = 524/903 (58.03%), Postives = 677/903 (74.97%), Query Frame = 3
Query: 2313 KCAIKLAVL*XSVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYVEKFTESGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKIIKCLNELEEPR-TYLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDWDTGNQASSD-SKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQALRKAIYKKKICVASPT---IDCITSQKIYRFPGLVDIHVHTRDPGQVHKEDWSTVTKXXXXXXXXXXFAMPNTAPPITNLESFELAKKRASSLAHCDYGLYVGASNDNWESLAELAPEAIGLKMYLNPTFSTLQMNNFSTWAKHFKHFPENRPICCHAEGETMAAVILLAQLHNRHVHICHVSRKQEIELIRLAKSQGLKVTCEVSPHH 5006
            + + K+     SVGE+M +GR FEEAFQKALRMVDE   GFD  V+  ++  L +PTD+R+ V+A AL  G SV+ +Y+LT+ID WFL++  +I+     LE+ R   L +D+L  AK LGFSD QIA AV STE+AVR+LR ELG+ P V QIDTV+AEWP  TNYLYL+Y G  HD+ F   +++VLGSGVYRIGSSVEFDWCAV CI++L++M  KTIMVN NPETVSTDYDMCD L+F+E+S E V+DI+ +E P+GVI+SMGGQLPNN+AM LHR++  + GTSP  ID+AENRFKFSR+LD+IGI QP+W+EL+D ESA  FC+ V YPC+VRPSYVLSGAAMNVA+++ DL  +L+ A AV+K+HPVVISKFI++AKEIDVDAVA  G +   A+SEHVENAG+HSGDATLVTPPQD+  KTL++I  I+  + QEL+V+GPFN+QLIAKDD L VIECN+RVSRSFPFVSK LG +++A ATR IM E   +E   L      V VKVP FSF+RL GADV+LGVEM STGEVA FGE R EA+LKA L+ G KIP    NI ++IGSYK+K ELL +VR L SLGY+LYASLGTADFY E G+ V AVDW        +   +++  D + E+  +L+INL  R +G RR S  +T GY+ RRLA D+ + L+ ++KCTKLFV+AL       +I  A P    +DC+TSQK+ R PGL+D+HVH R+PG  HKED+++ T AA+AGG+T + AMPNT PPI +  +  LA+K A + A CD+ L++GAS++N  +L  +A  A GLK+YLN TFS L++++ + W +HF+ +P + PI  HAE +++AAV+++AQL  R VHICHV+RK+EI LI+ AK+QGL VTCEV+PHH
Sbjct:  687 RVSTKIGSCMKSVGEVMGIGRSFEEAFQKALRMVDENCVGFDHTVKPVSDMELETPTDKRIFVVAAALWAGYSVERLYELTRIDCWFLHRMKRIVTHAQLLEQHRGQALPQDLLHQAKCLGFSDKQIALAVLSTELAVRKLRQELGICPAVKQIDTVAAEWPAQTNYLYLTYWGNTHDLDFRAPHVLVLGSGVYRIGSSVEFDWCAVGCIQQLRKMGYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGVILSMGGQLPNNMAMALHRQQCRVLGTSPEAIDSAENRFKFSRLLDTIGISQPQWRELSDLESARQFCHTVGYPCVVRPSYVLSGAAMNVAYTDGDLERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAVACDGIVSAIAISEHVENAGVHSGDATLVTPPQDITPKTLERIKAIVHAVGQELQVTGPFNLQLIAKDDQLKVIECNVRVSRSFPFVSKTLGVDLVALATRIIMGE--KVEPVGLMTGSGVVGVKVPQFSFSRLAGADVVLGVEMTSTGEVAGFGESRCEAYLKAMLSTGFKIPE--KNILLTIGSYKNKSELLPTVRLLESLGYSLYASLGTADFYTEHGVKVTAVDWHFEEAVDGECPPQRSILDQLAENHFELVINLSMRGAGGRRLSSFVTKGYRTRRLAADFSVPLIIDIKCTKLFVEAL------GQIGPAPPLKVHVDCMTSQKLVRLPGLIDVHVHLREPGGTHKEDFASGTAAALAGGVTMVCAMPNTRPPIIDAPALALAQKLAEAGARCDFTLFLGASSENAGTLGAVAGSAAGLKLYLNETFSELRLDSVAQWMEHFETWPAHLPIVAHAERQSVAAVLMVAQLTQRPVHICHVARKEEILLIKTAKAQGLPVTCEVAPHH 1579          

HSP 2 Score: 682.559 bits (1760), Expect = 0.000e+0
Identity = 363/624 (58.17%), Postives = 454/624 (72.76%), Query Frame = 2
Query:   41 GALILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLINPLNNPELFIDPNERNLVEEVSINEIRHYNKNGNIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNADEYDALFISNGPGDPVKCTETIETIKNWIT--SEKPFMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVT-AVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKPKKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCIT 1903
             AL+L D +V  G  FGA     GEVVFQTGMVGY E+L+DPSY +Q+LVLTYP+IG+YG+  D+  D++GL K FES++IH  GL+V E     S+W+A  TL +WL++ G+ G+ G+DTR LTKKLRE GS+ G +V    +    P   P  F+DPN R L  EVSI   R +N  G   +C +DCG+K NQIRC C+ GA VTV+P++  +++ +YD LF+SNGPGDP      + T+   ++  + +P  GICLGHQLLALAIG KT+KM+YGNRGHNQPC  + T RCF+TSQNHGFAV A S+P  W  LF N ND SNEGI+H  LPF SVQFHPEH +GP+DMELLF VF+E V  A   N    ++ +RL  RL       EL +       P+K+LILGSGGLSIGQAGEFDYSG+QA+KAL+EE IQT+L+NPNIATVQT+ G+ADK Y LPIT  YVT+VI+ ERPDGV LTFGGQTALNCG+EL ++GV   Y V VLGT +ETI++TEDR+ F+  + EI E VAPS AA ++++   AAE+LGYPV++RAAFALGGLGSGFA+   EL  L + AFAHTSQVL+DKSL+GWKEIEYEVVRD Y NC+T
Sbjct:    2 AALVLEDGSVLQGRPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILVLTYPLIGNYGIPSDEE-DEFGLSKWFESSEIHVAGLVVGECCPTPSHWSANCTLHEWLQQRGIPGLQGVDTRELTKKLREQGSLLGKLV----QKGTEPSALP--FVDPNARPLAPEVSIKTPRVFNAGGAPRICALDCGLKYNQIRCLCQLGAEVTVVPWDHELDSQKYDGLFLSNGPGDPASYPGVVSTLSRVLSEPNPRPVFGICLGHQLLALAIGAKTYKMRYGNRGHNQPCLLVGTGRCFLTSQNHGFAVDADSLPAGWAPLFTNANDCSNEGIVHDSLPFFSVQFHPEHRAGPSDMELLFDVFLETVREAAAGNIGGQTVRERLAQRLC----PPELPIPGSGLPPPRKVLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTLLINPNIATVQTSQGLADKVYFLPITLHYVTQVIRNERPDGVLLTFGGQTALNCGVELTKAGVLARYGVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQAQAAAERLGYPVLVRAAFALGGLGSGFASTKEELSALVAPAFAHTSQVLIDKSLKGWKEIEYEVVRDAYGNCVT 614          

HSP 3 Score: 106.686 bits (265), Expect = 2.479e-22
Identity = 67/87 (77.01%), Postives = 71/87 (81.61%), Query Frame = 2
Query: 2081 NSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
            N   YYIIEVNARLSRSSALASKATGYPLAYVAAKL LG+ L  LRNSVT   TA FEPS+DYCVVKIPRWDL+KF +V  KI S M
Sbjct:  611 NCVTYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPELRNSVTG-GTAAFEPSLDYCVVKIPRWDLSKFLRVSTKIGSCM 696          

HSP 4 Score: 94.7449 bits (234), Expect = 9.013e-19
Identity = 89/309 (28.80%), Postives = 154/309 (49.84%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQ----LGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQ--VLVDKSLRGWKEIEYEVVRDVYDNCITVCNM-ENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLG 2197
            EFD+     ++ LR+ G +T++VN N  TV T   + D+ Y   I+ + V ++ ++E P+GV L+ GGQ   N  + L         +  VLGTS E I   E+R +FS +L+ I      S   +     +++A Q    +GYP ++R ++ L G     A    +L    S+A A + +  V++ K ++  KEI+ + V    D  ++   + E+V+  G+H+G++ +V P Q ++      ++     V + L V G  N+Q  L     +  +IE N R+SRS    SK  G  L  +A ++ +G
Sbjct:  887 EFDWCAVGCIQQLRKMGYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGVILSMGGQLPNNMAMALHRQ------QCRVLGTSPEAIDSAENRFKFSRLLDTI----GISQPQWRELSDLESARQFCHTVGYPCVVRPSYVLSGAAMNVAYTDGDLERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAV--ACDGIVSAIAISEHVENAGVHSGDATLVTPPQDITPKTLERIKAIVHAVGQELQVTGPFNLQ--LIAKDDQLKVIECNVRVSRSFPFVSKTLGVDLVALATRIIMG 1181          

HSP 5 Score: 87.0409 bits (214), Expect = 2.080e-16
Identity = 64/217 (29.49%), Postives = 106/217 (48.85%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMG------LHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAV--AYG 3491
            +++LGSG   IG + EFD+   + IK L+    +T+++N N  TV T   + D ++F  ++L  V  +   E+PDGV+++ GGQ   N  +       L R  + + GT    I+  E+R  F+  +  IG      +     E A      + YP LVR ++ L G     A ++ +L+  +  A A      V+I K ++  KEI+ + V  AYG
Sbjct:  396 VLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTLLINPNIATVQTSQGLADKVYFLPITLHYVTQVIRNERPDGVLLTFGGQTALNCGVELTKAGVLARYGVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQAQAAAERLGYPVLVRAAFALGGLGSGFASTKEELSALVAPAFAHTSQ--VLIDKSLKGWKEIEYEVVRDAYG 610          
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Mouse
Match: Cad (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:MGI Symbol;Acc:MGI:1916969])

HSP 1 Score: 1034.63 bits (2674), Expect = 0.000e+0
Identity = 524/903 (58.03%), Postives = 677/903 (74.97%), Query Frame = 3
Query: 2313 KCAIKLAVL*XSVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYVEKFTESGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKIIKCLNELEEPR-TYLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDWDTGNQASSD-SKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQALRKAIYKKKICVASPT---IDCITSQKIYRFPGLVDIHVHTRDPGQVHKEDWSTVTKXXXXXXXXXXFAMPNTAPPITNLESFELAKKRASSLAHCDYGLYVGASNDNWESLAELAPEAIGLKMYLNPTFSTLQMNNFSTWAKHFKHFPENRPICCHAEGETMAAVILLAQLHNRHVHICHVSRKQEIELIRLAKSQGLKVTCEVSPHH 5006
            + + K+     SVGE+M +GR FEEAFQKALRMVDE   GFD  V+  ++  L +PTD+R+ V+A AL  G SV+ +Y+LT+ID WFL++  +I+     LE+ R   L +D+L  AK LGFSD QIA AV STE+AVR+LR ELG+ P V QIDTV+AEWP  TNYLYL+Y G  HD+ F   +++VLGSGVYRIGSSVEFDWCAV CI++L++M  KTIMVN NPETVSTDYDMCD L+F+E+S E V+DI+ +E P+GVI+SMGGQLPNN+AM LHR++  + GTSP  ID+AENRFKFSR+LD+IGI QP+W+EL+D ESA  FC+ V YPC+VRPSYVLSGAAMNVA+++ DL  +L+ A AV+K+HPVVISKFI++AKEIDVDAVA  G +   A+SEHVENAG+HSGDATLVTPPQD+  KTL++I  I+  + QEL+V+GPFN+QLIAKDD L VIECN+RVSRSFPFVSK LG +++A ATR IM E   +E   L      V VKVP FSF+RL GADV+LGVEM STGEVA FGE R EA+LKA L+ G KIP    NI ++IGSYK+K ELL +VR L SLGY+LYASLGTADFY E G+ V AVDW        +   +++  D + E+  +L+INL  R +G RR S  +T GY+ RRLA D+ + L+ ++KCTKLFV+AL       +I  A P    +DC+TSQK+ R PGL+D+HVH R+PG  HKED+++ T AA+AGG+T + AMPNT PPI +  +  LA+K A + A CD+ L++GAS++N  +L  +A  A GLK+YLN TFS L++++ + W +HF+ +P + PI  HAE +++AAV+++AQL  R VHICHV+RK+EI LI+ AK+QGL VTCEV+PHH
Sbjct:  750 RVSTKIGSCMKSVGEVMGIGRSFEEAFQKALRMVDENCVGFDHTVKPVSDMELETPTDKRIFVVAAALWAGYSVERLYELTRIDCWFLHRMKRIVTHAQLLEQHRGQALPQDLLHQAKCLGFSDKQIALAVLSTELAVRKLRQELGICPAVKQIDTVAAEWPAQTNYLYLTYWGNTHDLDFRAPHVLVLGSGVYRIGSSVEFDWCAVGCIQQLRKMGYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGVILSMGGQLPNNMAMALHRQQCRVLGTSPEAIDSAENRFKFSRLLDTIGISQPQWRELSDLESARQFCHTVGYPCVVRPSYVLSGAAMNVAYTDGDLERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAVACDGIVSAIAISEHVENAGVHSGDATLVTPPQDITPKTLERIKAIVHAVGQELQVTGPFNLQLIAKDDQLKVIECNVRVSRSFPFVSKTLGVDLVALATRIIMGE--KVEPVGLMTGSGVVGVKVPQFSFSRLAGADVVLGVEMTSTGEVAGFGESRCEAYLKAMLSTGFKIPE--KNILLTIGSYKNKSELLPTVRLLESLGYSLYASLGTADFYTEHGVKVTAVDWHFEEAVDGECPPQRSILDQLAENHFELVINLSMRGAGGRRLSSFVTKGYRTRRLAADFSVPLIIDIKCTKLFVEAL------GQIGPAPPLKVHVDCMTSQKLVRLPGLIDVHVHLREPGGTHKEDFASGTAAALAGGVTMVCAMPNTRPPIIDAPALALAQKLAEAGARCDFTLFLGASSENAGTLGAVAGSAAGLKLYLNETFSELRLDSVAQWMEHFETWPAHLPIVAHAERQSVAAVLMVAQLTQRPVHICHVARKEEILLIKTAKAQGLPVTCEVAPHH 1642          

HSP 2 Score: 884.789 bits (2285), Expect = 0.000e+0
Identity = 473/770 (61.43%), Postives = 581/770 (75.45%), Query Frame = 2
Query:   41 GALILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLINPLNNPELFIDPNERNLVEEVSINEIRHYNKNGNIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNADEYDALFISNGPGDPVKCTETIETIKNWIT--SEKPFMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVT-AVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKPKKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
             AL+L D +V  G  FGA     GEVVFQTGMVGY E+L+DPSY +Q+LVLTYP+IG+YG+  D+  D++GL K FES++IH  GL+V E     S+W+A  TL +WL++ G+ G+ G+DTR LTKKLRE GS+ G +V    +    P   P  F+DPN R L  EVSI   R +N  G   +C +DCG+K NQIRC C+ GA VTV+P++  +++ +YD LF+SNGPGDP      + T+   ++  + +P  GICLGHQLLALAIG KT+KM+YGNRGHNQPC  + T RCF+TSQNHGFAV A S+P  W  LF N ND SNEGI+H  LPF SVQFHPEH +GP+DMELLF VF+E V  A   N    ++ +RL  RL       EL +       P+K+LILGSGGLSIGQAGEFDYSG+QA+KAL+EE IQT+L+NPNIATVQT+ G+ADK Y LPIT  YVT+VI+ ERPDGV LTFGGQTALNCG+EL ++GV   Y V VLGT +ETI++TEDR+ F+  + EI E VAPS AA ++++   AAE+LGYPV++RAAFALGGLGSGFA+   EL  L + AFAHTSQVL+DKSL+GWKEIEYEVVRD Y NC+TVCNMEN+DPLGIHTGES+VVAPSQTL++ EY +LR+ A+KV ++LG+VGECN+QYAL+P S +YYIIEVNARLSRSSALASKATGYPLAYVAAKL LG+ L  LRNSVT   TA FEPS+DYCVVKIPRWDL+KF +V  KI S M
Sbjct:    2 AALVLEDGSVLQGRPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILVLTYPLIGNYGIPSDEE-DEFGLSKWFESSEIHVAGLVVGECCPTPSHWSANCTLHEWLQQRGIPGLQGVDTRELTKKLREQGSLLGKLV----QKGTEPSALP--FVDPNARPLAPEVSIKTPRVFNAGGAPRICALDCGLKYNQIRCLCQLGAEVTVVPWDHELDSQKYDGLFLSNGPGDPASYPGVVSTLSRVLSEPNPRPVFGICLGHQLLALAIGAKTYKMRYGNRGHNQPCLLVGTGRCFLTSQNHGFAVDADSLPAGWAPLFTNANDCSNEGIVHDSLPFFSVQFHPEHRAGPSDMELLFDVFLETVREAAAGNIGGQTVRERLAQRLC----PPELPIPGSGLPPPRKVLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTLLINPNIATVQTSQGLADKVYFLPITLHYVTQVIRNERPDGVLLTFGGQTALNCGVELTKAGVLARYGVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQAQAAAERLGYPVLVRAAFALGGLGSGFASTKEELSALVAPAFAHTSQVLIDKSLKGWKEIEYEVVRDAYGNCVTVCNMENLDPLGIHTGESIVVAPSQTLNDREYQLLRRTAIKVTQHLGIVGECNVQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPELRNSVTG-GTAAFEPSLDYCVVKIPRWDLSKFLRVSTKIGSCM 759          

HSP 3 Score: 144.436 bits (363), Expect = 7.525e-34
Identity = 112/387 (28.94%), Postives = 185/387 (47.80%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMG------LHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAV--AYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQ--LIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRG-----EP--NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            +++LGSG   IG + EFD+   + IK L+    +T+++N N  TV T   + D ++F  ++L  V  +   E+PDGV+++ GGQ   N  +       L R  + + GT    I+  E+R  F+  +  IG      +     E A      + YP LVR ++ L G     A ++ +L+  +  A A      V+I K ++  KEI+ + V  AY G  +     E+++  GIH+G++ +V P Q +N++  Q + +   ++ Q L + G  N+Q  L  + +   +IE N R+SRS    SKA GY +   A +  +  P       + G     EP  +   VK+P +  ++       +G  M S GEV   G    EAF KA
Sbjct:  396 VLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTLLINPNIATVQTSQGLADKVYFLPITLHYVTQVIRNERPDGVLLTFGGQTALNCGVELTKAGVLARYGVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQAQAAAERLGYPVLVRAAFALGGLGSGFASTKEELSALVAPAFAHTSQ--VLIDKSLKGWKEIEYEVVRDAY-GNCVTVCNMENLDPLGIHTGESIVVAPSQTLNDREYQLLRRTAIKVTQHLGIVGECNVQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPELRNSVTGGTAAFEPSLDYCVVKIPRWDLSKFLRVSTKIGSCMKSVGEVMGIGRSFEEAFQKA 779          

HSP 4 Score: 94.7449 bits (234), Expect = 8.997e-19
Identity = 89/309 (28.80%), Postives = 154/309 (49.84%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQ----LGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQ--VLVDKSLRGWKEIEYEVVRDVYDNCITVCNM-ENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLG 2197
            EFD+     ++ LR+ G +T++VN N  TV T   + D+ Y   I+ + V ++ ++E P+GV L+ GGQ   N  + L         +  VLGTS E I   E+R +FS +L+ I      S   +     +++A Q    +GYP ++R ++ L G     A    +L    S+A A + +  V++ K ++  KEI+ + V    D  ++   + E+V+  G+H+G++ +V P Q ++      ++     V + L V G  N+Q  L     +  +IE N R+SRS    SK  G  L  +A ++ +G
Sbjct:  950 EFDWCAVGCIQQLRKMGYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGVILSMGGQLPNNMAMALHRQ------QCRVLGTSPEAIDSAENRFKFSRLLDTI----GISQPQWRELSDLESARQFCHTVGYPCVVRPSYVLSGAAMNVAYTDGDLERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAV--ACDGIVSAIAISEHVENAGVHSGDATLVTPPQDITPKTLERIKAIVHAVGQELQVTGPFNLQ--LIAKDDQLKVIECNVRVSRSFPFVSKTLGVDLVALATRIIMG 1244          
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Mouse
Match: Cad (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:MGI Symbol;Acc:MGI:1916969])

HSP 1 Score: 1033.86 bits (2672), Expect = 0.000e+0
Identity = 524/903 (58.03%), Postives = 677/903 (74.97%), Query Frame = 3
Query: 2313 KCAIKLAVL*XSVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYVEKFTESGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKIIKCLNELEEPR-TYLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDWDTGNQASSD-SKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQALRKAIYKKKICVASPT---IDCITSQKIYRFPGLVDIHVHTRDPGQVHKEDWSTVTKXXXXXXXXXXFAMPNTAPPITNLESFELAKKRASSLAHCDYGLYVGASNDNWESLAELAPEAIGLKMYLNPTFSTLQMNNFSTWAKHFKHFPENRPICCHAEGETMAAVILLAQLHNRHVHICHVSRKQEIELIRLAKSQGLKVTCEVSPHH 5006
            + + K+     SVGE+M +GR FEEAFQKALRMVDE   GFD  V+  ++  L +PTD+R+ V+A AL  G SV+ +Y+LT+ID WFL++  +I+     LE+ R   L +D+L  AK LGFSD QIA AV STE+AVR+LR ELG+ P V QIDTV+AEWP  TNYLYL+Y G  HD+ F   +++VLGSGVYRIGSSVEFDWCAV CI++L++M  KTIMVN NPETVSTDYDMCD L+F+E+S E V+DI+ +E P+GVI+SMGGQLPNN+AM LHR++  + GTSP  ID+AENRFKFSR+LD+IGI QP+W+EL+D ESA  FC+ V YPC+VRPSYVLSGAAMNVA+++ DL  +L+ A AV+K+HPVVISKFI++AKEIDVDAVA  G +   A+SEHVENAG+HSGDATLVTPPQD+  KTL++I  I+  + QEL+V+GPFN+QLIAKDD L VIECN+RVSRSFPFVSK LG +++A ATR IM E   +E   L      V VKVP FSF+RL GADV+LGVEM STGEVA FGE R EA+LKA L+ G KIP    NI ++IGSYK+K ELL +VR L SLGY+LYASLGTADFY E G+ V AVDW        +   +++  D + E+  +L+INL  R +G RR S  +T GY+ RRLA D+ + L+ ++KCTKLFV+AL       +I  A P    +DC+TSQK+ R PGL+D+HVH R+PG  HKED+++ T AA+AGG+T + AMPNT PPI +  +  LA+K A + A CD+ L++GAS++N  +L  +A  A GLK+YLN TFS L++++ + W +HF+ +P + PI  HAE +++AAV+++AQL  R VHICHV+RK+EI LI+ AK+QGL VTCEV+PHH
Sbjct:  750 RVSTKIGSCMKSVGEVMGIGRSFEEAFQKALRMVDENCVGFDHTVKPVSDMELETPTDKRIFVVAAALWAGYSVERLYELTRIDCWFLHRMKRIVTHAQLLEQHRGQALPQDLLHQAKCLGFSDKQIALAVLSTELAVRKLRQELGICPAVKQIDTVAAEWPAQTNYLYLTYWGNTHDLDFRAPHVLVLGSGVYRIGSSVEFDWCAVGCIQQLRKMGYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGVILSMGGQLPNNMAMALHRQQCRVLGTSPEAIDSAENRFKFSRLLDTIGISQPQWRELSDLESARQFCHTVGYPCVVRPSYVLSGAAMNVAYTDGDLERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAVACDGIVSAIAISEHVENAGVHSGDATLVTPPQDITPKTLERIKAIVHAVGQELQVTGPFNLQLIAKDDQLKVIECNVRVSRSFPFVSKTLGVDLVALATRIIMGE--KVEPVGLMTGSGVVGVKVPQFSFSRLAGADVVLGVEMTSTGEVAGFGESRCEAYLKAMLSTGFKIPE--KNILLTIGSYKNKSELLPTVRLLESLGYSLYASLGTADFYTEHGVKVTAVDWHFEEAVDGECPPQRSILDQLAENHFELVINLSMRGAGGRRLSSFVTKGYRTRRLAADFSVPLIIDIKCTKLFVEAL------GQIGPAPPLKVHVDCMTSQKLVRLPGLIDVHVHLREPGGTHKEDFASGTAAALAGGVTMVCAMPNTRPPIIDAPALALAQKLAEAGARCDFTLFLGASSENAGTLGAVAGSAAGLKLYLNETFSELRLDSVAQWMEHFETWPAHLPIVAHAERQSVAAVLMVAQLTQRPVHICHVARKEEILLIKTAKAQGLPVTCEVAPHH 1642          

HSP 2 Score: 883.634 bits (2282), Expect = 0.000e+0
Identity = 472/770 (61.30%), Postives = 580/770 (75.32%), Query Frame = 2
Query:   41 GALILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLINPLNNPELFIDPNERNLVEEVSINEIRHYNKNGNIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNADEYDALFISNGPGDPVKCTETIETIKNWIT--SEKPFMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVT-AVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKPKKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
             AL+L D +V  G  FGA     GEVVFQTGMVGY E+L+DPSY +Q+LVLTYP+IG+YG+  D+  D++GL K FES++IH  GL+V E     S+W+A  TL +WL++ G+ G+ G+DTR LTKKLRE GS+ G +V    +    P      F+DPN R L  EVSI   R +N  G   +C +DCG+K NQIRC C+ GA VTV+P++  +++ +YD LF+SNGPGDP      + T+   ++  + +P  GICLGHQLLALAIG KT+KM+YGNRGHNQPC  + T RCF+TSQNHGFAV A S+P  W  LF N ND SNEGI+H  LPF SVQFHPEH +GP+DMELLF VF+E V  A   N    ++ +RL  RL       EL +       P+K+LILGSGGLSIGQAGEFDYSG+QA+KAL+EE IQT+L+NPNIATVQT+ G+ADK Y LPIT  YVT+VI+ ERPDGV LTFGGQTALNCG+EL ++GV   Y V VLGT +ETI++TEDR+ F+  + EI E VAPS AA ++++   AAE+LGYPV++RAAFALGGLGSGFA+   EL  L + AFAHTSQVL+DKSL+GWKEIEYEVVRD Y NC+TVCNMEN+DPLGIHTGES+VVAPSQTL++ EY +LR+ A+KV ++LG+VGECN+QYAL+P S +YYIIEVNARLSRSSALASKATGYPLAYVAAKL LG+ L  LRNSVT   TA FEPS+DYCVVKIPRWDL+KF +V  KI S M
Sbjct:    2 AALVLEDGSVLQGRPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILVLTYPLIGNYGIPSDEE-DEFGLSKWFESSEIHVAGLVVGECCPTPSHWSANCTLHEWLQQRGIPGLQGVDTRELTKKLREQGSLLGKLVQKGTEPSALP------FVDPNARPLAPEVSIKTPRVFNAGGAPRICALDCGLKYNQIRCLCQLGAEVTVVPWDHELDSQKYDGLFLSNGPGDPASYPGVVSTLSRVLSEPNPRPVFGICLGHQLLALAIGAKTYKMRYGNRGHNQPCLLVGTGRCFLTSQNHGFAVDADSLPAGWAPLFTNANDCSNEGIVHDSLPFFSVQFHPEHRAGPSDMELLFDVFLETVREAAAGNIGGQTVRERLAQRLC----PPELPIPGSGLPPPRKVLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTLLINPNIATVQTSQGLADKVYFLPITLHYVTQVIRNERPDGVLLTFGGQTALNCGVELTKAGVLARYGVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQAQAAAERLGYPVLVRAAFALGGLGSGFASTKEELSALVAPAFAHTSQVLIDKSLKGWKEIEYEVVRDAYGNCVTVCNMENLDPLGIHTGESIVVAPSQTLNDREYQLLRRTAIKVTQHLGIVGECNVQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPELRNSVTG-GTAAFEPSLDYCVVKIPRWDLSKFLRVSTKIGSCM 759          

HSP 3 Score: 144.436 bits (363), Expect = 7.678e-34
Identity = 112/387 (28.94%), Postives = 185/387 (47.80%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMG------LHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAV--AYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQ--LIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRG-----EP--NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            +++LGSG   IG + EFD+   + IK L+    +T+++N N  TV T   + D ++F  ++L  V  +   E+PDGV+++ GGQ   N  +       L R  + + GT    I+  E+R  F+  +  IG      +     E A      + YP LVR ++ L G     A ++ +L+  +  A A      V+I K ++  KEI+ + V  AY G  +     E+++  GIH+G++ +V P Q +N++  Q + +   ++ Q L + G  N+Q  L  + +   +IE N R+SRS    SKA GY +   A +  +  P       + G     EP  +   VK+P +  ++       +G  M S GEV   G    EAF KA
Sbjct:  396 VLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTLLINPNIATVQTSQGLADKVYFLPITLHYVTQVIRNERPDGVLLTFGGQTALNCGVELTKAGVLARYGVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQAQAAAERLGYPVLVRAAFALGGLGSGFASTKEELSALVAPAFAHTSQ--VLIDKSLKGWKEIEYEVVRDAY-GNCVTVCNMENLDPLGIHTGESIVVAPSQTLNDREYQLLRRTAIKVTQHLGIVGECNVQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPELRNSVTGGTAAFEPSLDYCVVKIPRWDLSKFLRVSTKIGSCMKSVGEVMGIGRSFEEAFQKA 779          

HSP 4 Score: 94.7449 bits (234), Expect = 8.930e-19
Identity = 89/309 (28.80%), Postives = 154/309 (49.84%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQ----LGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQ--VLVDKSLRGWKEIEYEVVRDVYDNCITVCNM-ENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLG 2197
            EFD+     ++ LR+ G +T++VN N  TV T   + D+ Y   I+ + V ++ ++E P+GV L+ GGQ   N  + L         +  VLGTS E I   E+R +FS +L+ I      S   +     +++A Q    +GYP ++R ++ L G     A    +L    S+A A + +  V++ K ++  KEI+ + V    D  ++   + E+V+  G+H+G++ +V P Q ++      ++     V + L V G  N+Q  L     +  +IE N R+SRS    SK  G  L  +A ++ +G
Sbjct:  950 EFDWCAVGCIQQLRKMGYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGVILSMGGQLPNNMAMALHRQ------QCRVLGTSPEAIDSAENRFKFSRLLDTI----GISQPQWRELSDLESARQFCHTVGYPCVVRPSYVLSGAAMNVAYTDGDLERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAV--ACDGIVSAIAISEHVENAGVHSGDATLVTPPQDITPKTLERIKAIVHAVGQELQVTGPFNLQ--LIAKDDQLKVIECNVRVSRSFPFVSKTLGVDLVALATRIIMG 1244          
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Mouse
Match: Cad (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:MGI Symbol;Acc:MGI:1916969])

HSP 1 Score: 1033.86 bits (2672), Expect = 0.000e+0
Identity = 524/903 (58.03%), Postives = 677/903 (74.97%), Query Frame = 3
Query: 2313 KCAIKLAVL*XSVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYVEKFTESGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKIIKCLNELEEPR-TYLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDWDTGNQASSD-SKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQALRKAIYKKKICVASPT---IDCITSQKIYRFPGLVDIHVHTRDPGQVHKEDWSTVTKXXXXXXXXXXFAMPNTAPPITNLESFELAKKRASSLAHCDYGLYVGASNDNWESLAELAPEAIGLKMYLNPTFSTLQMNNFSTWAKHFKHFPENRPICCHAEGETMAAVILLAQLHNRHVHICHVSRKQEIELIRLAKSQGLKVTCEVSPHH 5006
            + + K+     SVGE+M +GR FEEAFQKALRMVDE   GFD  V+  ++  L +PTD+R+ V+A AL  G SV+ +Y+LT+ID WFL++  +I+     LE+ R   L +D+L  AK LGFSD QIA AV STE+AVR+LR ELG+ P V QIDTV+AEWP  TNYLYL+Y G  HD+ F   +++VLGSGVYRIGSSVEFDWCAV CI++L++M  KTIMVN NPETVSTDYDMCD L+F+E+S E V+DI+ +E P+GVI+SMGGQLPNN+AM LHR++  + GTSP  ID+AENRFKFSR+LD+IGI QP+W+EL+D ESA  FC+ V YPC+VRPSYVLSGAAMNVA+++ DL  +L+ A AV+K+HPVVISKFI++AKEIDVDAVA  G +   A+SEHVENAG+HSGDATLVTPPQD+  KTL++I  I+  + QEL+V+GPFN+QLIAKDD L VIECN+RVSRSFPFVSK LG +++A ATR IM E   +E   L      V VKVP FSF+RL GADV+LGVEM STGEVA FGE R EA+LKA L+ G KIP    NI ++IGSYK+K ELL +VR L SLGY+LYASLGTADFY E G+ V AVDW        +   +++  D + E+  +L+INL  R +G RR S  +T GY+ RRLA D+ + L+ ++KCTKLFV+AL       +I  A P    +DC+TSQK+ R PGL+D+HVH R+PG  HKED+++ T AA+AGG+T + AMPNT PPI +  +  LA+K A + A CD+ L++GAS++N  +L  +A  A GLK+YLN TFS L++++ + W +HF+ +P + PI  HAE +++AAV+++AQL  R VHICHV+RK+EI LI+ AK+QGL VTCEV+PHH
Sbjct:  750 RVSTKIGSCMKSVGEVMGIGRSFEEAFQKALRMVDENCVGFDHTVKPVSDMELETPTDKRIFVVAAALWAGYSVERLYELTRIDCWFLHRMKRIVTHAQLLEQHRGQALPQDLLHQAKCLGFSDKQIALAVLSTELAVRKLRQELGICPAVKQIDTVAAEWPAQTNYLYLTYWGNTHDLDFRAPHVLVLGSGVYRIGSSVEFDWCAVGCIQQLRKMGYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGVILSMGGQLPNNMAMALHRQQCRVLGTSPEAIDSAENRFKFSRLLDTIGISQPQWRELSDLESARQFCHTVGYPCVVRPSYVLSGAAMNVAYTDGDLERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAVACDGIVSAIAISEHVENAGVHSGDATLVTPPQDITPKTLERIKAIVHAVGQELQVTGPFNLQLIAKDDQLKVIECNVRVSRSFPFVSKTLGVDLVALATRIIMGE--KVEPVGLMTGSGVVGVKVPQFSFSRLAGADVVLGVEMTSTGEVAGFGESRCEAYLKAMLSTGFKIPE--KNILLTIGSYKNKSELLPTVRLLESLGYSLYASLGTADFYTEHGVKVTAVDWHFEEAVDGECPPQRSILDQLAENHFELVINLSMRGAGGRRLSSFVTKGYRTRRLAADFSVPLIIDIKCTKLFVEAL------GQIGPAPPLKVHVDCMTSQKLVRLPGLIDVHVHLREPGGTHKEDFASGTAAALAGGVTMVCAMPNTRPPIIDAPALALAQKLAEAGARCDFTLFLGASSENAGTLGAVAGSAAGLKLYLNETFSELRLDSVAQWMEHFETWPAHLPIVAHAERQSVAAVLMVAQLTQRPVHICHVARKEEILLIKTAKAQGLPVTCEVAPHH 1642          

HSP 2 Score: 883.634 bits (2282), Expect = 0.000e+0
Identity = 472/770 (61.30%), Postives = 580/770 (75.32%), Query Frame = 2
Query:   41 GALILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLINPLNNPELFIDPNERNLVEEVSINEIRHYNKNGNIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNADEYDALFISNGPGDPVKCTETIETIKNWIT--SEKPFMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVT-AVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKPKKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
             AL+L D +V  G  FGA     GEVVFQTGMVGY E+L+DPSY +Q+LVLTYP+IG+YG+  D+  D++GL K FES++IH  GL+V E     S+W+A  TL +WL++ G+ G+ G+DTR LTKKLRE GS+ G +V    +    P      F+DPN R L  EVSI   R +N  G   +C +DCG+K NQIRC C+ GA VTV+P++  +++ +YD LF+SNGPGDP      + T+   ++  + +P  GICLGHQLLALAIG KT+KM+YGNRGHNQPC  + T RCF+TSQNHGFAV A S+P  W  LF N ND SNEGI+H  LPF SVQFHPEH +GP+DMELLF VF+E V  A   N    ++ +RL  RL       EL +       P+K+LILGSGGLSIGQAGEFDYSG+QA+KAL+EE IQT+L+NPNIATVQT+ G+ADK Y LPIT  YVT+VI+ ERPDGV LTFGGQTALNCG+EL ++GV   Y V VLGT +ETI++TEDR+ F+  + EI E VAPS AA ++++   AAE+LGYPV++RAAFALGGLGSGFA+   EL  L + AFAHTSQVL+DKSL+GWKEIEYEVVRD Y NC+TVCNMEN+DPLGIHTGES+VVAPSQTL++ EY +LR+ A+KV ++LG+VGECN+QYAL+P S +YYIIEVNARLSRSSALASKATGYPLAYVAAKL LG+ L  LRNSVT   TA FEPS+DYCVVKIPRWDL+KF +V  KI S M
Sbjct:    2 AALVLEDGSVLQGRPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILVLTYPLIGNYGIPSDEE-DEFGLSKWFESSEIHVAGLVVGECCPTPSHWSANCTLHEWLQQRGIPGLQGVDTRELTKKLREQGSLLGKLVQKGTEPSALP------FVDPNARPLAPEVSIKTPRVFNAGGAPRICALDCGLKYNQIRCLCQLGAEVTVVPWDHELDSQKYDGLFLSNGPGDPASYPGVVSTLSRVLSEPNPRPVFGICLGHQLLALAIGAKTYKMRYGNRGHNQPCLLVGTGRCFLTSQNHGFAVDADSLPAGWAPLFTNANDCSNEGIVHDSLPFFSVQFHPEHRAGPSDMELLFDVFLETVREAAAGNIGGQTVRERLAQRLC----PPELPIPGSGLPPPRKVLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTLLINPNIATVQTSQGLADKVYFLPITLHYVTQVIRNERPDGVLLTFGGQTALNCGVELTKAGVLARYGVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQAQAAAERLGYPVLVRAAFALGGLGSGFASTKEELSALVAPAFAHTSQVLIDKSLKGWKEIEYEVVRDAYGNCVTVCNMENLDPLGIHTGESIVVAPSQTLNDREYQLLRRTAIKVTQHLGIVGECNVQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPELRNSVTG-GTAAFEPSLDYCVVKIPRWDLSKFLRVSTKIGSCM 759          

HSP 3 Score: 144.436 bits (363), Expect = 7.437e-34
Identity = 112/387 (28.94%), Postives = 185/387 (47.80%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMG------LHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAV--AYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQ--LIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRG-----EP--NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            +++LGSG   IG + EFD+   + IK L+    +T+++N N  TV T   + D ++F  ++L  V  +   E+PDGV+++ GGQ   N  +       L R  + + GT    I+  E+R  F+  +  IG      +     E A      + YP LVR ++ L G     A ++ +L+  +  A A      V+I K ++  KEI+ + V  AY G  +     E+++  GIH+G++ +V P Q +N++  Q + +   ++ Q L + G  N+Q  L  + +   +IE N R+SRS    SKA GY +   A +  +  P       + G     EP  +   VK+P +  ++       +G  M S GEV   G    EAF KA
Sbjct:  396 VLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTLLINPNIATVQTSQGLADKVYFLPITLHYVTQVIRNERPDGVLLTFGGQTALNCGVELTKAGVLARYGVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQAQAAAERLGYPVLVRAAFALGGLGSGFASTKEELSALVAPAFAHTSQ--VLIDKSLKGWKEIEYEVVRDAY-GNCVTVCNMENLDPLGIHTGESIVVAPSQTLNDREYQLLRRTAIKVTQHLGIVGECNVQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPELRNSVTGGTAAFEPSLDYCVVKIPRWDLSKFLRVSTKIGSCMKSVGEVMGIGRSFEEAFQKA 779          

HSP 4 Score: 94.7449 bits (234), Expect = 9.403e-19
Identity = 89/309 (28.80%), Postives = 154/309 (49.84%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQ----LGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQ--VLVDKSLRGWKEIEYEVVRDVYDNCITVCNM-ENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLG 2197
            EFD+     ++ LR+ G +T++VN N  TV T   + D+ Y   I+ + V ++ ++E P+GV L+ GGQ   N  + L         +  VLGTS E I   E+R +FS +L+ I      S   +     +++A Q    +GYP ++R ++ L G     A    +L    S+A A + +  V++ K ++  KEI+ + V    D  ++   + E+V+  G+H+G++ +V P Q ++      ++     V + L V G  N+Q  L     +  +IE N R+SRS    SK  G  L  +A ++ +G
Sbjct:  950 EFDWCAVGCIQQLRKMGYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGVILSMGGQLPNNMAMALHRQ------QCRVLGTSPEAIDSAENRFKFSRLLDTI----GISQPQWRELSDLESARQFCHTVGYPCVVRPSYVLSGAAMNVAYTDGDLERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAV--ACDGIVSAIAISEHVENAGVHSGDATLVTPPQDITPKTLERIKAIVHAVGQELQVTGPFNLQ--LIAKDDQLKVIECNVRVSRSFPFVSKTLGVDLVALATRIIMG 1244          
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Mouse
Match: Cad (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:MGI Symbol;Acc:MGI:1916969])

HSP 1 Score: 881.322 bits (2276), Expect = 0.000e+0
Identity = 472/769 (61.38%), Postives = 580/769 (75.42%), Query Frame = 2
Query:   44 ALILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLINPLNNPELFIDPNERNLVEEVSINEIRHYNKNGNIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNADEYDALFISNGPGDPVKCTETIETIKNWIT--SEKPFMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVT-AVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKPKKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
            AL+L D +V  G  FGA     GEVVFQTGMVGY E+L+DPSY +Q+LVLTYP+IG+YG+  D+  D++GL K FES++IH  GL+V E     S+W+A  TL +WL++ G+ G+ G+DTR LTKKLRE GS+ G +V    +    P      F+DPN R L  EVSI   R +N  G   +C +DCG+K NQIRC C+ GA VTV+P++  +++ +YD LF+SNGPGDP      + T+   ++  + +P  GICLGHQLLALAIG KT+KM+YGNRGHNQPC  + T RCF+TSQNHGFAV A S+P  W  LF N ND SNEGI+H  LPF SVQFHPEH +GP+DMELLF VF+E V  A   N    ++ +RL  RL       EL +       P+K+LILGSGGLSIGQAGEFDYSG+QA+KAL+EE IQT+L+NPNIATVQT+ G+ADK Y LPIT  YVT+VI+ ERPDGV LTFGGQTALNCG+EL ++GV   Y V VLGT +ETI++TEDR+ F+  + EI E VAPS AA ++++   AAE+LGYPV++RAAFALGGLGSGFA+   EL  L + AFAHTSQVL+DKSL+GWKEIEYEVVRD Y NC+TVCNMEN+DPLGIHTGES+VVAPSQTL++ EY +LR+ A+KV ++LG+VGECN+QYAL+P S +YYIIEVNARLSRSSALASKATGYPLAYVAAKL LG+ L  LRNSVT   TA FEPS+DYCVVKIPRWDL+KF +V  KI S M
Sbjct:    3 ALVLEDGSVLQGRPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILVLTYPLIGNYGIPSDEE-DEFGLSKWFESSEIHVAGLVVGECCPTPSHWSANCTLHEWLQQRGIPGLQGVDTRELTKKLREQGSLLGKLVQKGTEPSALP------FVDPNARPLAPEVSIKTPRVFNAGGAPRICALDCGLKYNQIRCLCQLGAEVTVVPWDHELDSQKYDGLFLSNGPGDPASYPGVVSTLSRVLSEPNPRPVFGICLGHQLLALAIGAKTYKMRYGNRGHNQPCLLVGTGRCFLTSQNHGFAVDADSLPAGWAPLFTNANDCSNEGIVHDSLPFFSVQFHPEHRAGPSDMELLFDVFLETVREAAAGNIGGQTVRERLAQRLC----PPELPIPGSGLPPPRKVLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTLLINPNIATVQTSQGLADKVYFLPITLHYVTQVIRNERPDGVLLTFGGQTALNCGVELTKAGVLARYGVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQAQAAAERLGYPVLVRAAFALGGLGSGFASTKEELSALVAPAFAHTSQVLIDKSLKGWKEIEYEVVRDAYGNCVTVCNMENLDPLGIHTGESIVVAPSQTLNDREYQLLRRTAIKVTQHLGIVGECNVQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPELRNSVTG-GTAAFEPSLDYCVVKIPRWDLSKFLRVSTKIGSCM 759          

HSP 2 Score: 247.669 bits (631), Expect = 5.878e-67
Identity = 121/221 (54.75%), Postives = 160/221 (72.40%), Query Frame = 3
Query: 2313 KCAIKLAVL*XSVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYVEKFTESGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKIIKCLNELEEPR-TYLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTI 2972
            + + K+     SVGE+M +GR FEEAFQKALRMVDE   GFD  V+  ++  L +PTD+R+ V+A AL  G SV+ +Y+LT+ID WFL++  +I+     LE+ R   L +D+L  AK LGFSD QIA AV STE+AVR+LR ELG+ P V QIDTV+AEWP  TNYLYL+Y G  HD+ F   +++VLGSGVYRIGSSVEFDWCAV CI++L++++   +
Sbjct:  750 RVSTKIGSCMKSVGEVMGIGRSFEEAFQKALRMVDENCVGFDHTVKPVSDMELETPTDKRIFVVAAALWAGYSVERLYELTRIDCWFLHRMKRIVTHAQLLEQHRGQALPQDLLHQAKCLGFSDKQIALAVLSTELAVRKLRQELGICPAVKQIDTVAAEWPAQTNYLYLTYWGNTHDLDFRAPHVLVLGSGVYRIGSSVEFDWCAVGCIQQLRKVRGPVL 970          

HSP 3 Score: 144.05 bits (362), Expect = 4.685e-34
Identity = 112/387 (28.94%), Postives = 185/387 (47.80%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMG------LHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAV--AYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQ--LIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRG-----EP--NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            +++LGSG   IG + EFD+   + IK L+    +T+++N N  TV T   + D ++F  ++L  V  +   E+PDGV+++ GGQ   N  +       L R  + + GT    I+  E+R  F+  +  IG      +     E A      + YP LVR ++ L G     A ++ +L+  +  A A      V+I K ++  KEI+ + V  AY G  +     E+++  GIH+G++ +V P Q +N++  Q + +   ++ Q L + G  N+Q  L  + +   +IE N R+SRS    SKA GY +   A +  +  P       + G     EP  +   VK+P +  ++       +G  M S GEV   G    EAF KA
Sbjct:  396 VLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTLLINPNIATVQTSQGLADKVYFLPITLHYVTQVIRNERPDGVLLTFGGQTALNCGVELTKAGVLARYGVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQAQAAAERLGYPVLVRAAFALGGLGSGFASTKEELSALVAPAFAHTSQ--VLIDKSLKGWKEIEYEVVRDAY-GNCVTVCNMENLDPLGIHTGESIVVAPSQTLNDREYQLLRRTAIKVTQHLGIVGECNVQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPELRNSVTGGTAAFEPSLDYCVVKIPRWDLSKFLRVSTKIGSCMKSVGEVMGIGRSFEEAFQKA 779          
BLAST of Carbamoyl-phosphate synthase large chain vs. UniProt/SwissProt
Match: sp|Q91437|PYR1_SQUAC (CAD protein OS=Squalus acanthias OX=7797 GN=CAD PE=2 SV=1)

HSP 1 Score: 1061.6 bits (2744), Expect = 0.000e+0
Identity = 529/894 (59.17%), Postives = 681/894 (76.17%), Query Frame = 3
Query: 2346 SVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYVEKFTESGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKIIKCLNELEEPRTYLSKDI----LLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDW---DTGNQASSDSKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQALRKAIYKKKICVASPTIDCITSQKIYRFPGLVDIHVHTRDPGQVHKEDWSTVTKXXXXXXXXXXFAMPNTAPPITNLESFELAKKRASSLAHCDYGLYVGASNDNWESLAELAPEAIGLKMYLNPTFSTLQMNNFSTWAKHFKHFPENRPICCHAEGETMAAVILLAQLHNRHVHICHVSRKQEIELIRLAKSQGLKVTCEVSPHH 5006
            SVGE+M++GR FEEAFQKALRMVDE   GFD  ++  ++  L +PTD+R+ VLA AL+ G  +  +Y+LTKID WFL+K   I++   +L E   Y+  ++    LL  K LGFSD QIA A++STE+AVR+LR E  + P+V QIDTV+AEWP  TNYLYL+Y+G  HD+ F   ++MV+GSGVYRIGSSVEFDWCAV CI++L++M  KT MVN NPETVSTDYDMCD L+F+E+S E V+DI+ +E P+G+I+SMGGQLPNNIAM LHR++  I GTSP  ID AENRFKFSRMLD+IGI QP+WKEL+D+ES+  FC  V YPCL+RPSYVLSG AMNVA+S++DL ++L+ AVAV+K+HPVVISKFI++AKEIDVDAVA  G ++  A+SEHVENAG+HSGDATLVTPPQD+N+KT ++I  I+  I QEL+ +GPFN+QLIAKDD L VIECN+RVSRSFPFVSK LG +MIA AT+ IM E   +E   L      V VKVP FSF+RL GADV+LGVEM STGEVACFGE+R EA+LKA L+ G KIP+   NI +SIGSYK+K ELL +V+ L  LGYNLYASLGTADFY E G+ + AVDW   DT N      + +   DY+ E+  DL+INL  RNSG RR S  +T GY+ RRLA+DY + L+ ++KCTKLFV+ALR       +      ID ++S K+ R PGL+D+HVH R+PG  HKED+++ T AA+AGG+T + AMPNT P IT+  SF L +K A++ A CD+ L++GAS+DN + L  ++  A GLKMYLN TFSTL+M+N S W +HF+ +P++ PI  HAE +T+AA++++AQL+ R VHICHV+RK+EI++IR AK +G++VTCEV+PHH
Sbjct:  765 SVGEVMAIGRNFEEAFQKALRMVDENCVGFDHTLKPASDEELETPTDKRIFVLAAALRAGYEIDRLYELTKIDKWFLHKMKNIVEYSLKLSE--LYMKDEVPRHDLLKVKRLGFSDKQIAMAIQSTELAVRRLRQEWKILPVVKQIDTVAAEWPAQTNYLYLTYNGEGHDLDFTKPHVMVIGSGVYRIGSSVEFDWCAVRCIQQLRKMGYKTRMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGIILSMGGQLPNNIAMDLHRQQCRILGTSPESIDTAENRFKFSRMLDTIGISQPRWKELSDTESSKQFCTKVGYPCLIRPSYVLSGVAMNVAYSDNDLEKFLSSAVAVSKEHPVVISKFIQEAKEIDVDAVACDGVVIAVAISEHVENAGVHSGDATLVTPPQDLNQKTTERIKAIVHAIGQELQATGPFNLQLIAKDDQLKVIECNVRVSRSFPFVSKTLGVDMIALATKVIMGE--EVEPVGLMTGTGVVGVKVPQFSFSRLAGADVVLGVEMTSTGEVACFGENRYEAYLKAMLSTGFKIPK--KNILLSIGSYKNKSELLSTVQSLEQLGYNLYASLGTADFYTEHGVKIKAVDWPFEDTDNGCPLKERHRNIMDYLEENHFDLVINLSMRNSGGRRLSSFVTKGYRTRRLAVDYSVPLIIDIKCTKLFVEALRLVGDTPPV---KTHIDSMSSHKLIRLPGLIDVHVHLREPGGTHKEDFASGTAAALAGGVTMVCAMPNTNPAITDQTSFALVQKLATAGARCDFALFLGASSDNADVLPLISNSAAGLKMYLNDTFSTLKMDNVSLWMEHFEKWPKHLPIVVHAERQTVAAILMVAQLYQRPVHICHVARKEEIQIIRAAKQKGVQVTCEVAPHH 1649          

HSP 2 Score: 886.715 bits (2290), Expect = 0.000e+0
Identity = 477/773 (61.71%), Postives = 591/773 (76.46%), Query Frame = 2
Query:   41 GALILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLINPLNNPEL-FIDPNERNLVEEVSINEIRHYNKNGNIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNADEYDALFISNGPGDPVKCTETIETIKNWITSEKP--FMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVTAVKSNTATVSLDQRLTNRLTYQHT---QHELTLTALLENKPKKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
              L L D + + G LFGA     GEVVFQTGMVGY E+L+DPSY SQ+LVLTYP+IG+YG+  D+  D+ GL K FESAKIHA  L++ E S   S+W++  +L Q L++HG+  + GIDTR LTKK+RE G++ G       KL+I+  +   L + DPN+R+LV+EVSI E + Y+ +GN+ +  +DCG+K NQIR  CK GA VTV+P++   +++E+D LFISNGPGDP  C +TI  +K  I+ EKP    GICLGHQ+L+LAIG KT+KMKYGNRGHNQPC H  T+RCF TSQNHGFAV   S+P +W  LF N ND+SNEGIIH   P  SVQFHPEH +GPTD+  LF +F+E    VK     V+LD+ +  R+   ++     E + T     +P K+LILGSGGLSIGQAGEFDYSG+QA+KAL+EE +Q+VL+NPNIATVQT+ G+ADK Y LPIT +YVT+VI  ERPDG+ LTFGGQTALNCG+EL++ GV + Y V VLGT + +I+MTEDR+ F E + EI E V PS AA+T+++   AAE+LGYPV++RAAFALGGLGSGFA N  EL+ L + AFAHTSQ+LVDKSL+GWKEIEYEVVRD YDNCITVCNMENVDPLGIHTGES+VVAPSQTL++ EY +LR  A+KV+R+LGVVGECNIQYAL P S +Y+IIEVNARLSRSSALASKATGYPLAYVAAKL LG+ L  LRNSVT  TTA +EPS+DYCVVK+PRWDL+KF ++  KI SSM
Sbjct:    2 ATLFLDDGSSFKGRLFGASSTVSGEVVFQTGMVGYPEALTDPSYLSQILVLTYPLIGNYGIPKDEE-DEHGLSKWFESAKIHAAALVIGENSQNPSHWSSVRSLDQRLKEHGIPALEGIDTRSLTKKIREKGTLLG-------KLVIDGTDENSLPYDDPNKRHLVKEVSIKEPKVYHPSGNVKIMAVDCGMKYNQIRSLCKRGAAVTVVPWDYLFDSNEFDGLFISNGPGDPEYCQQTINNVKKAISEEKPKPLFGICLGHQILSLAIGAKTYKMKYGNRGHNQPCIHEGTQRCFYTSQNHGFAVEPCSLPRDWSVLFTNANDQSNEGIIHNSKPLFSVQFHPEHKAGPTDLVDLFDIFLECARDVKLG---VNLDKTVKGRVISHYSFKNGTENSKTPPGRIQPHKVLILGSGGLSIGQAGEFDYSGSQAIKALKEENVQSVLINPNIATVQTSKGLADKVYFLPITPEYVTQVIMNERPDGILLTFGGQTALNCGVELQKRGVLEKYHVRVLGTPVSSIEMTEDRKIFVEKMAEINEYVVPSEAAFTLEQAQGAAERLGYPVLVRAAFALGGLGSGFAQNKEELVTLVTQAFAHTSQILVDKSLKGWKEIEYEVVRDAYDNCITVCNMENVDPLGIHTGESIVVAPSQTLNDKEYNLLRTTAIKVIRHLGVVGECNIQYALSPESEQYFIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPVLRNSVTNSTTANYEPSLDYCVVKVPRWDLSKFLRLSTKIGSSM 763          

HSP 3 Score: 138.658 bits (348), Expect = 3.161e-31
Identity = 108/388 (27.84%), Postives = 182/388 (46.91%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHRE------KIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAV--AYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQ--LIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSL------ECEFLRGEP--NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            +++LGSG   IG + EFD+   + IK L+    +++++N N  TV T   + D ++F  ++ E V  +   E+PDG++++ GGQ   N  + L +        + + GT    I+  E+R  F   +  I       +     E A      + YP LVR ++ L G     A ++ +L   +TQA A      +++ K ++  KEI+ + V  AY   +    + E+V+  GIH+G++ +V P Q +N+K    +     ++ + L V G  N+Q  L  + +   +IE N R+SRS    SKA GY +   A +  +  P  +             EP  +   VKVP +  ++       +G  M S GEV   G +  EAF KA
Sbjct:  399 VLILGSGGLSIGQAGEFDYSGSQAIKALKEENVQSVLINPNIATVQTSKGLADKVYFLPITPEYVTQVIMNERPDGILLTFGGQTALNCGVELQKRGVLEKYHVRVLGTPVSSIEMTEDRKIFVEKMAEINEYVVPSEAAFTLEQAQGAAERLGYPVLVRAAFALGGLGSGFAQNKEELVTLVTQAFAHTSQ--ILVDKSLKGWKEIEYEVVRDAYDNCITVCNM-ENVDPLGIHTGESIVVAPSQTLNDKEYNLLRTTAIKVIRHLGVVGECNIQYALSPESEQYFIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPVLRNSVTNSTTANYEPSLDYCVVKVPRWDLSKFLRLSTKIGSSMKSVGEVMAIGRNFEEAFQKA 783          

HSP 4 Score: 97.0561 bits (240), Expect = 1.338e-18
Identity = 89/311 (28.62%), Postives = 155/311 (49.84%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAE------QLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQ--VLVDKSLRGWKEIEYEVVRDVYDN-CITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLG 2197
            EFD+   + ++ LR+ G +T +VN N  TV T   + D+ Y   I+ + V ++ ++E P+G+ L+ GGQ   N  ++L         +  +LGTS E+I   E+R +FS +L+ I       ++    KE  D         ++GYP +IR ++ L G+    A +  +L    S+A A + +  V++ K ++  KEI+ + V    D   I V   E+V+  G+H+G++ +V P Q L+      ++     + + L   G  N+Q  L     +  +IE N R+SRS    SK  G  +  +A K+ +G
Sbjct:  955 EFDWCAVRCIQQLRKMGYKTRMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGIILSMGGQLPNNIAMDLHRQ------QCRILGTSPESIDTAENRFKFSRMLDTI------GISQPRWKELSDTESSKQFCTKVGYPCLIRPSYVLSGVAMNVAYSDNDLEKFLSSAVAVSKEHPVVISKFIQEAKEIDVDAV--ACDGVVIAVAISEHVENAGVHSGDATLVTPPQDLNQKTTERIKAIVHAIGQELQATGPFNLQ--LIAKDDQLKVIECNVRVSRSFPFVSKTLGVDMIALATKVIMG 1249          
BLAST of Carbamoyl-phosphate synthase large chain vs. UniProt/SwissProt
Match: sp|P08955|PYR1_MESAU (CAD protein OS=Mesocricetus auratus OX=10036 GN=CAD PE=1 SV=4)

HSP 1 Score: 1038.87 bits (2685), Expect = 0.000e+0
Identity = 526/903 (58.25%), Postives = 678/903 (75.08%), Query Frame = 3
Query: 2313 KCAIKLAVL*XSVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYVEKFTESGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKIIKCLNELEEPRTY-LSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDWDTGNQASSD-SKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQALRKAIYKKKICVASPT---IDCITSQKIYRFPGLVDIHVHTRDPGQVHKEDWSTVTKXXXXXXXXXXFAMPNTAPPITNLESFELAKKRASSLAHCDYGLYVGASNDNWESLAELAPEAIGLKMYLNPTFSTLQMNNFSTWAKHFKHFPENRPICCHAEGETMAAVILLAQLHNRHVHICHVSRKQEIELIRLAKSQGLKVTCEVSPHH 5006
            + + K+     SVGE+M +GR FEEAFQKALRMVDE   GFD  V+  ++  L +PTD+R+ V+A AL  G SV+ +Y+LT+ID WFL++  +I+     LE+ R   LS+D+L  AK LGFSD QIA AV STE+AVR+LR ELG+ P V QIDTV+AEWP  TNYLYL+Y G  HD+ F   +++VLGSGVYRIGSSVEFDWCAV CI++L++M  KTIMVN NPETVSTDYDMCD L+F+E+S E V+DI+ +E PDGVI+SMGGQLPNN+AM LHR++  + GTSP  ID+AENRFKFSR+LD+IGI QP+W+EL+D ESA  FC  V YPC+VRPSYVLSGAAMNVA+++ DL  +L+ A AV+K+HPVVISKFI++AKEIDVDAVA  G +   A+SEHVENAG+HSGDATLVTPPQD+  KTL++I  I+  + QEL+V+GPFN+QLIAKDD L VIECN+RVSRSFPFVSK LG +++A ATR IM E   +E   L      V VKVP FSF+RL GADV+LGVEM STGEVA FGE R EA+LKA L+ G KIP+   NI ++IGSYK+K ELL +VR L SLGY+LYASLGTADFY E G+ V AVDW        +   +++  D + E+  +L+INL  R +G RR S  +T GY+ RRLA D+ + L+ ++KCTKLFV+AL       +I  A P    +DC+TSQK+ R PGL+D+HVH R+PG  HKED+++ T AA+AGG+T + AMPNT PPI +  +  LA+K A + A CD+ L++GAS++N  +L  +A  A GLK+YLN TFS L++++ + W +HF+ +P + PI  HAE +++AAV+++AQL  R VHICHV+RK+EI LI+ AK+QGL VTCEV+PHH
Sbjct:  750 RVSTKIGSCMKSVGEVMGIGRSFEEAFQKALRMVDENCVGFDHTVKPVSDVELETPTDKRIFVVAAALWAGYSVERLYELTRIDCWFLHRMKRIVTHAQLLEQHRGQPLSQDLLHQAKCLGFSDKQIALAVLSTELAVRKLRQELGICPAVKQIDTVAAEWPAQTNYLYLTYWGNTHDLDFRTPHVLVLGSGVYRIGSSVEFDWCAVGCIQQLRKMGYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPDGVILSMGGQLPNNMAMALHRQQCRVLGTSPEAIDSAENRFKFSRLLDTIGISQPQWRELSDLESARQFCQTVGYPCVVRPSYVLSGAAMNVAYTDGDLERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAVACDGVVSAIAISEHVENAGVHSGDATLVTPPQDITPKTLERIKAIVHAVGQELQVTGPFNLQLIAKDDQLKVIECNVRVSRSFPFVSKTLGVDLVALATRIIMGE--KVEPIGLMTGSGVVGVKVPQFSFSRLAGADVVLGVEMTSTGEVAGFGESRCEAYLKAMLSTGFKIPK--KNILLTIGSYKNKSELLPTVRLLESLGYSLYASLGTADFYTEHGVKVTAVDWHFEEAVDGECPPQRSILDQLAENHFELVINLSMRGAGGRRLSSFVTKGYRTRRLAADFSVPLIIDIKCTKLFVEAL------GQIGPAPPLKVHVDCMTSQKLVRLPGLIDVHVHLREPGGTHKEDFASGTAAALAGGVTMVCAMPNTRPPIIDAPALALAQKLAEAGARCDFALFLGASSENAGTLGAVAGSAAGLKLYLNETFSELRLDSVAQWMEHFETWPSHLPIVAHAERQSVAAVLMVAQLTQRPVHICHVARKEEILLIKTAKAQGLPVTCEVAPHH 1642          

HSP 2 Score: 886.33 bits (2289), Expect = 0.000e+0
Identity = 477/771 (61.87%), Postives = 582/771 (75.49%), Query Frame = 2
Query:   41 GALILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLINPLNNPELFIDPNERNLVEEVSINEIRHYNKNGNIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNADEYDALFISNGPGDPVKCTETIETIKNWITSE---KPFMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVT-AVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKPKKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
             AL+L D +V  G  FGA     GEVVFQTGMVGY E+L+DPSY +Q+LVLTYP+IG+YG+  D+  D++GL K FES++ H  GL+V E     S+W+A  TL +WL++HG+ G+ G+DTR LTKKLRE GS+ G +V    +    P   P  F+DPN R L  EVSI   R +N  G   +C +DCG+K NQIRC C+ GA VTV+P+N  +++ +YD LF+SNGPGDP      + T+ N + SE   +P  GICLGHQLLALAIG KT+KM+YGNRGHNQPC  + T RCF+TSQNHGFAV A S+P  W  LF N ND SNEGI+H  LPF SVQFHPEH +GP+DMELLF VF+E V  AV  N    ++ +RL  RL        L +       P+K+LILGSGGLSIGQAGEFDYSG+QA+KAL+EE IQT+L+NPNIATVQT+ G+ADK Y LPIT  YVT+VI+ ERPDGV LTFGGQTALNCG+EL ++GV   Y V VLGT +ETI++TEDR+ F+  + EI E VAPS AA ++++   AAE+LGYPV++RAAFALGGLGSGFA+   EL  L + AFAHTSQVL+DKSL+GWKEIEYEVVRD Y NC+TVCNMEN+DPLGIHTGES+VVAPSQTL++ EY +LR+ A+KV ++LG+VGECN+QYAL+P S +YYIIEVNARLSRSSALASKATGYPLAYVAAKL LG+ L  LRNSVT   TA FEPS+DYCVVKIPRWDL+KF +V  KI S M
Sbjct:    2 AALVLEDGSVLQGRPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILVLTYPLIGNYGIPSDEE-DEFGLSKWFESSENHVAGLVVGECCPTPSHWSATCTLHEWLQQHGIPGLQGVDTRELTKKLREQGSLLGKLV----QSGTEPSTLP--FVDPNARPLAPEVSIKTPRVFNAGGAPRICALDCGLKYNQIRCLCQLGAEVTVVPWNHELDSQKYDGLFLSNGPGDPASYPGVVATL-NRVLSEPNPRPVFGICLGHQLLALAIGAKTYKMRYGNRGHNQPCLLVGTGRCFLTSQNHGFAVDADSLPAGWTPLFTNANDCSNEGIVHDSLPFFSVQFHPEHRAGPSDMELLFDVFLETVREAVAGNPGGQTVKERLVQRLC----PPGLLIPGSGLPPPRKVLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTLLINPNIATVQTSQGLADKVYFLPITPHYVTQVIRNERPDGVLLTFGGQTALNCGVELTKAGVLARYGVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQAQAAAERLGYPVLVRAAFALGGLGSGFASTKEELSALVAPAFAHTSQVLIDKSLKGWKEIEYEVVRDAYGNCVTVCNMENLDPLGIHTGESIVVAPSQTLNDREYQLLRRTAIKVTQHLGIVGECNVQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPELRNSVTG-GTAAFEPSLDYCVVKIPRWDLSKFLRVSTKIGSCM 759          

HSP 3 Score: 144.436 bits (363), Expect = 4.920e-33
Identity = 111/387 (28.68%), Postives = 184/387 (47.55%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMG------LHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAV--AYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQ--LIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRG-----EP--NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            +++LGSG   IG + EFD+   + IK L+    +T+++N N  TV T   + D ++F  ++   V  +   E+PDGV+++ GGQ   N  +       L R  + + GT    I+  E+R  F+  +  IG      +     E A      + YP LVR ++ L G     A ++ +L+  +  A A      V+I K ++  KEI+ + V  AY G  +     E+++  GIH+G++ +V P Q +N++  Q + +   ++ Q L + G  N+Q  L  + +   +IE N R+SRS    SKA GY +   A +  +  P       + G     EP  +   VK+P +  ++       +G  M S GEV   G    EAF KA
Sbjct:  396 VLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTLLINPNIATVQTSQGLADKVYFLPITPHYVTQVIRNERPDGVLLTFGGQTALNCGVELTKAGVLARYGVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQAQAAAERLGYPVLVRAAFALGGLGSGFASTKEELSALVAPAFAHTSQ--VLIDKSLKGWKEIEYEVVRDAY-GNCVTVCNMENLDPLGIHTGESIVVAPSQTLNDREYQLLRRTAIKVTQHLGIVGECNVQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPELRNSVTGGTAAFEPSLDYCVVKIPRWDLSKFLRVSTKIGSCMKSVGEVMGIGRSFEEAFQKA 779          

HSP 4 Score: 97.4413 bits (241), Expect = 1.064e-18
Identity = 87/305 (28.52%), Postives = 150/305 (49.18%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQ--VLVDKSLRGWKEIEYEVVRDVYDNCITVCNM-ENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLG 2197
            EFD+     ++ LR+ G +T++VN N  TV T   + D+ Y   I+ + V ++ ++E PDGV L+ GGQ   N  + L         +  VLGTS E I   E+R +FS +L+ I            ++      + +GYP ++R ++ L G     A    +L    S+A A + +  V++ K ++  KEI+ + V    D  ++   + E+V+  G+H+G++ +V P Q ++      ++     V + L V G  N+Q  L     +  +IE N R+SRS    SK  G  L  +A ++ +G
Sbjct:  950 EFDWCAVGCIQQLRKMGYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPDGVILSMGGQLPNNMAMALHRQ------QCRVLGTSPEAIDSAENRFKFSRLLDTIGISQPQWRELSDLESARQFCQTVGYPCVVRPSYVLSGAAMNVAYTDGDLERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAV--ACDGVVSAIAISEHVENAGVHSGDATLVTPPQDITPKTLERIKAIVHAVGQELQVTGPFNLQ--LIAKDDQLKVIECNVRVSRSFPFVSKTLGVDLVALATRIIMG 1244          
BLAST of Carbamoyl-phosphate synthase large chain vs. UniProt/SwissProt
Match: sp|P27708|PYR1_HUMAN (CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3)

HSP 1 Score: 1038.1 bits (2683), Expect = 0.000e+0
Identity = 526/903 (58.25%), Postives = 674/903 (74.64%), Query Frame = 3
Query: 2313 KCAIKLAVL*XSVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYVEKFTESGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKIIKCLNELEEPRTY-LSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDWDTGNQASSD-SKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQALRKAIYKKKICVASPT---IDCITSQKIYRFPGLVDIHVHTRDPGQVHKEDWSTVTKXXXXXXXXXXFAMPNTAPPITNLESFELAKKRASSLAHCDYGLYVGASNDNWESLAELAPEAIGLKMYLNPTFSTLQMNNFSTWAKHFKHFPENRPICCHAEGETMAAVILLAQLHNRHVHICHVSRKQEIELIRLAKSQGLKVTCEVSPHH 5006
            + + K+     SVGE+M +GR FEEAFQKALRMVDE   GFD  V+  ++  L +PTD+R+ V+A AL  G SV  +Y+LT+ID WFL++  +II     LE+ R   L  D+L  AK LGFSD QIA AV STE+AVR+LR ELG+ P V QIDTV+AEWP  TNYLYL+Y G  HD+TF   +++VLGSGVYRIGSSVEFDWCAV CI++L++M  KTIMVN NPETVSTDYDMCD L+F+E+S E V+DI+ +E P+GVI+SMGGQLPNN+AM LHR++  + GTSP  ID+AENRFKFSR+LD+IGI QP+W+EL+D ESA  FC  V YPC+VRPSYVLSGAAMNVA+++ DL  +L+ A AV+K+HPVVISKFI++AKEIDVDAVA  G +   A+SEHVENAG+HSGDATLVTPPQD+  KTL++I  I+  + QEL+V+GPFN+QLIAKDD L VIECN+RVSRSFPFVSK LG +++A ATR IM E   +E   L      V VKVP FSF+RL GADV+LGVEM STGEVA FGE R EA+LKA L+ G KIP+   NI ++IGSYK+K ELL +VR L SLGY+LYASLGTADFY E G+ V AVDW        +   +++  + + E   +L+INL  R +G RR S  +T GY+ RRLA D+ + L+ ++KCTKLFV+AL       +I  A P    +DC+TSQK+ R PGL+D+HVH R+PG  HKED+++ T AA+AGGIT + AMPNT PPI +  +  LA+K A + A CD+ L++GAS++N  +L  +A  A GLK+YLN TFS L++++   W +HF+ +P + PI  HAE +T+AAV+++AQL  R VHICHV+RK+EI LI+ AK++GL VTCEV+PHH
Sbjct:  750 RVSTKIGSCMKSVGEVMGIGRSFEEAFQKALRMVDENCVGFDHTVKPVSDMELETPTDKRIFVVAAALWAGYSVDRLYELTRIDRWFLHRMKRIIAHAQLLEQHRGQPLPPDLLQQAKCLGFSDKQIALAVLSTELAVRKLRQELGICPAVKQIDTVAAEWPAQTNYLYLTYWGTTHDLTFRTPHVLVLGSGVYRIGSSVEFDWCAVGCIQQLRKMGYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGVILSMGGQLPNNMAMALHRQQCRVLGTSPEAIDSAENRFKFSRLLDTIGISQPQWRELSDLESARQFCQTVGYPCVVRPSYVLSGAAMNVAYTDGDLERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAVASDGVVAAIAISEHVENAGVHSGDATLVTPPQDITAKTLERIKAIVHAVGQELQVTGPFNLQLIAKDDQLKVIECNVRVSRSFPFVSKTLGVDLVALATRVIMGE--EVEPVGLMTGSGVVGVKVPQFSFSRLAGADVVLGVEMTSTGEVAGFGESRCEAYLKAMLSTGFKIPK--KNILLTIGSYKNKSELLPTVRLLESLGYSLYASLGTADFYTEHGVKVTAVDWHFEEAVDGECPPQRSILEQLAEKNFELVINLSMRGAGGRRLSSFVTKGYRTRRLAADFSVPLIIDIKCTKLFVEAL------GQIGPAPPLKVHVDCMTSQKLVRLPGLIDVHVHLREPGGTHKEDFASGTAAALAGGITMVCAMPNTRPPIIDAPALALAQKLAEAGARCDFALFLGASSENAGTLGTVAGSAAGLKLYLNETFSELRLDSVVQWMEHFETWPSHLPIVAHAEQQTVAAVLMVAQLTQRSVHICHVARKEEILLIKAAKARGLPVTCEVAPHH 1642          

HSP 2 Score: 883.634 bits (2282), Expect = 0.000e+0
Identity = 473/771 (61.35%), Postives = 581/771 (75.36%), Query Frame = 2
Query:   41 GALILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLINPLNNPEL-FIDPNERNLVEEVSINEIRHYNKNGNIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNADEYDALFISNGPGDPVKCTETIETIKNWIT--SEKPFMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVT-AVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKPKKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
             AL+L D +V  G  FGA     GEVVFQTGMVGY E+L+DPSY +Q+LVLTYP+IG+YG+  D+M D++GL K FES+ IH   L+V E     S+W+A  TL +WL++HG+ G+ G+DTR LTKKLRE GS+ G       KL+ N      L F+DPN R LV EVSI   R +N  G   +  +DCG+K NQIRC C+ GA VTV+P++  +++ EY+ LF+SNGPGDP      + T+   ++  + +P  GICLGHQLLALAIG KT+KM+YGNRGHNQPC  + + RCF+TSQNHGFAV   S+P +W  LF N ND SNEGI+H  LPF SVQFHPEH +GP+DMELLF +F+E V  A   N    ++ +RLT RL        +         P+K+LILGSGGLSIGQAGEFDYSG+QA+KAL+EE IQT+L+NPNIATVQT+ G+ADK Y LPIT  YVT+VI+ ERPDGV LTFGGQTALNCG+EL ++GV   Y V VLGT +ETI++TEDR+ F+  + EI E VAPS AA ++++   AAE+LGYPV++RAAFALGGLGSGFA+N  EL  L + AFAHTSQVLVDKSL+GWKEIEYEVVRD Y NC+TVCNMEN+DPLGIHTGES+VVAPSQTL++ EY +LR+ A+KV ++LG+VGECN+QYAL+P S +YYIIEVNARLSRSSALASKATGYPLAYVAAKL LG+ L  LRNSVT   TA FEPS+DYCVVKIPRWDL+KF +V  KI S M
Sbjct:    2 AALVLEDGSVLRGQPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILVLTYPLIGNYGIPPDEM-DEFGLCKWFESSGIHVAALVVGECCPTPSHWSATRTLHEWLQQHGIPGLQGVDTRELTKKLREQGSLLG-------KLVQNGTEPSSLPFLDPNARPLVPEVSIKTPRVFNTGGAPRILALDCGLKYNQIRCLCQRGAEVTVVPWDHALDSQEYEGLFLSNGPGDPASYPSVVSTLSRVLSEPNPRPVFGICLGHQLLALAIGAKTYKMRYGNRGHNQPCLLVGSGRCFLTSQNHGFAVETDSLPADWAPLFTNANDGSNEGIVHNSLPFFSVQFHPEHQAGPSDMELLFDIFLETVKEATAGNPGGQTVRERLTERLC----PPGIPTPGSGLPPPRKVLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTLLINPNIATVQTSQGLADKVYFLPITPHYVTQVIRNERPDGVLLTFGGQTALNCGVELTKAGVLARYGVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQAQAAAERLGYPVLVRAAFALGGLGSGFASNREELSALVAPAFAHTSQVLVDKSLKGWKEIEYEVVRDAYGNCVTVCNMENLDPLGIHTGESIVVAPSQTLNDREYQLLRQTAIKVTQHLGIVGECNVQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPELRNSVTG-GTAAFEPSVDYCVVKIPRWDLSKFLRVSTKIGSCM 759          

HSP 3 Score: 144.821 bits (364), Expect = 3.600e-33
Identity = 111/387 (28.68%), Postives = 183/387 (47.29%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMG------LHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAV--AYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQ--LIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRG-----EP--NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            +++LGSG   IG + EFD+   + IK L+    +T+++N N  TV T   + D ++F  ++   V  +   E+PDGV+++ GGQ   N  +       L R  + + GT    I+  E+R  F+  +  IG      +     E A      + YP LVR ++ L G     A +  +L+  +  A A      V++ K ++  KEI+ + V  AY G  +     E+++  GIH+G++ +V P Q +N++  Q + Q   ++ Q L + G  N+Q  L  + +   +IE N R+SRS    SKA GY +   A +  +  P       + G     EP  +   VK+P +  ++       +G  M S GEV   G    EAF KA
Sbjct:  396 VLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTLLINPNIATVQTSQGLADKVYFLPITPHYVTQVIRNERPDGVLLTFGGQTALNCGVELTKAGVLARYGVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQAQAAAERLGYPVLVRAAFALGGLGSGFASNREELSALVAPAFAHTSQ--VLVDKSLKGWKEIEYEVVRDAY-GNCVTVCNMENLDPLGIHTGESIVVAPSQTLNDREYQLLRQTAIKVTQHLGIVGECNVQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPELRNSVTGGTAAFEPSVDYCVVKIPRWDLSKFLRVSTKIGSCMKSVGEVMGIGRSFEEAFQKA 779          

HSP 4 Score: 94.7449 bits (234), Expect = 7.385e-18
Identity = 86/305 (28.20%), Postives = 149/305 (48.85%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQ--VLVDKSLRGWKEIEYEVVRDVYDNCITVCNM-ENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLG 2197
            EFD+     ++ LR+ G +T++VN N  TV T   + D+ Y   I+ + V ++ ++E P+GV L+ GGQ   N  + L         +  VLGTS E I   E+R +FS +L+ I            ++      + +GYP ++R ++ L G     A    +L    S+A A + +  V++ K ++  KEI+ + V    D  +    + E+V+  G+H+G++ +V P Q ++      ++     V + L V G  N+Q  L     +  +IE N R+SRS    SK  G  L  +A ++ +G
Sbjct:  950 EFDWCAVGCIQQLRKMGYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGVILSMGGQLPNNMAMALHRQ------QCRVLGTSPEAIDSAENRFKFSRLLDTIGISQPQWRELSDLESARQFCQTVGYPCVVRPSYVLSGAAMNVAYTDGDLERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAV--ASDGVVAAIAISEHVENAGVHSGDATLVTPPQDITAKTLERIKAIVHAVGQELQVTGPFNLQ--LIAKDDQLKVIECNVRVSRSFPFVSKTLGVDLVALATRVIMG 1244          
BLAST of Carbamoyl-phosphate synthase large chain vs. UniProt/SwissProt
Match: sp|B2RQC6|PYR1_MOUSE (CAD protein OS=Mus musculus OX=10090 GN=Cad PE=1 SV=1)

HSP 1 Score: 1034.63 bits (2674), Expect = 0.000e+0
Identity = 524/903 (58.03%), Postives = 677/903 (74.97%), Query Frame = 3
Query: 2313 KCAIKLAVL*XSVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYVEKFTESGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKIIKCLNELEEPR-TYLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDWDTGNQASSD-SKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQALRKAIYKKKICVASPT---IDCITSQKIYRFPGLVDIHVHTRDPGQVHKEDWSTVTKXXXXXXXXXXFAMPNTAPPITNLESFELAKKRASSLAHCDYGLYVGASNDNWESLAELAPEAIGLKMYLNPTFSTLQMNNFSTWAKHFKHFPENRPICCHAEGETMAAVILLAQLHNRHVHICHVSRKQEIELIRLAKSQGLKVTCEVSPHH 5006
            + + K+     SVGE+M +GR FEEAFQKALRMVDE   GFD  V+  ++  L +PTD+R+ V+A AL  G SV+ +Y+LT+ID WFL++  +I+     LE+ R   L +D+L  AK LGFSD QIA AV STE+AVR+LR ELG+ P V QIDTV+AEWP  TNYLYL+Y G  HD+ F   +++VLGSGVYRIGSSVEFDWCAV CI++L++M  KTIMVN NPETVSTDYDMCD L+F+E+S E V+DI+ +E P+GVI+SMGGQLPNN+AM LHR++  + GTSP  ID+AENRFKFSR+LD+IGI QP+W+EL+D ESA  FC+ V YPC+VRPSYVLSGAAMNVA+++ DL  +L+ A AV+K+HPVVISKFI++AKEIDVDAVA  G +   A+SEHVENAG+HSGDATLVTPPQD+  KTL++I  I+  + QEL+V+GPFN+QLIAKDD L VIECN+RVSRSFPFVSK LG +++A ATR IM E   +E   L      V VKVP FSF+RL GADV+LGVEM STGEVA FGE R EA+LKA L+ G KIP    NI ++IGSYK+K ELL +VR L SLGY+LYASLGTADFY E G+ V AVDW        +   +++  D + E+  +L+INL  R +G RR S  +T GY+ RRLA D+ + L+ ++KCTKLFV+AL       +I  A P    +DC+TSQK+ R PGL+D+HVH R+PG  HKED+++ T AA+AGG+T + AMPNT PPI +  +  LA+K A + A CD+ L++GAS++N  +L  +A  A GLK+YLN TFS L++++ + W +HF+ +P + PI  HAE +++AAV+++AQL  R VHICHV+RK+EI LI+ AK+QGL VTCEV+PHH
Sbjct:  750 RVSTKIGSCMKSVGEVMGIGRSFEEAFQKALRMVDENCVGFDHTVKPVSDMELETPTDKRIFVVAAALWAGYSVERLYELTRIDCWFLHRMKRIVTHAQLLEQHRGQALPQDLLHQAKCLGFSDKQIALAVLSTELAVRKLRQELGICPAVKQIDTVAAEWPAQTNYLYLTYWGNTHDLDFRAPHVLVLGSGVYRIGSSVEFDWCAVGCIQQLRKMGYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGVILSMGGQLPNNMAMALHRQQCRVLGTSPEAIDSAENRFKFSRLLDTIGISQPQWRELSDLESARQFCHTVGYPCVVRPSYVLSGAAMNVAYTDGDLERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAVACDGIVSAIAISEHVENAGVHSGDATLVTPPQDITPKTLERIKAIVHAVGQELQVTGPFNLQLIAKDDQLKVIECNVRVSRSFPFVSKTLGVDLVALATRIIMGE--KVEPVGLMTGSGVVGVKVPQFSFSRLAGADVVLGVEMTSTGEVAGFGESRCEAYLKAMLSTGFKIPE--KNILLTIGSYKNKSELLPTVRLLESLGYSLYASLGTADFYTEHGVKVTAVDWHFEEAVDGECPPQRSILDQLAENHFELVINLSMRGAGGRRLSSFVTKGYRTRRLAADFSVPLIIDIKCTKLFVEAL------GQIGPAPPLKVHVDCMTSQKLVRLPGLIDVHVHLREPGGTHKEDFASGTAAALAGGVTMVCAMPNTRPPIIDAPALALAQKLAEAGARCDFTLFLGASSENAGTLGAVAGSAAGLKLYLNETFSELRLDSVAQWMEHFETWPAHLPIVAHAERQSVAAVLMVAQLTQRPVHICHVARKEEILLIKTAKAQGLPVTCEVAPHH 1642          

HSP 2 Score: 884.789 bits (2285), Expect = 0.000e+0
Identity = 473/770 (61.43%), Postives = 581/770 (75.45%), Query Frame = 2
Query:   41 GALILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLINPLNNPELFIDPNERNLVEEVSINEIRHYNKNGNIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNADEYDALFISNGPGDPVKCTETIETIKNWIT--SEKPFMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVT-AVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKPKKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
             AL+L D +V  G  FGA     GEVVFQTGMVGY E+L+DPSY +Q+LVLTYP+IG+YG+  D+  D++GL K FES++IH  GL+V E     S+W+A  TL +WL++ G+ G+ G+DTR LTKKLRE GS+ G +V    +    P   P  F+DPN R L  EVSI   R +N  G   +C +DCG+K NQIRC C+ GA VTV+P++  +++ +YD LF+SNGPGDP      + T+   ++  + +P  GICLGHQLLALAIG KT+KM+YGNRGHNQPC  + T RCF+TSQNHGFAV A S+P  W  LF N ND SNEGI+H  LPF SVQFHPEH +GP+DMELLF VF+E V  A   N    ++ +RL  RL       EL +       P+K+LILGSGGLSIGQAGEFDYSG+QA+KAL+EE IQT+L+NPNIATVQT+ G+ADK Y LPIT  YVT+VI+ ERPDGV LTFGGQTALNCG+EL ++GV   Y V VLGT +ETI++TEDR+ F+  + EI E VAPS AA ++++   AAE+LGYPV++RAAFALGGLGSGFA+   EL  L + AFAHTSQVL+DKSL+GWKEIEYEVVRD Y NC+TVCNMEN+DPLGIHTGES+VVAPSQTL++ EY +LR+ A+KV ++LG+VGECN+QYAL+P S +YYIIEVNARLSRSSALASKATGYPLAYVAAKL LG+ L  LRNSVT   TA FEPS+DYCVVKIPRWDL+KF +V  KI S M
Sbjct:    2 AALVLEDGSVLQGRPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILVLTYPLIGNYGIPSDEE-DEFGLSKWFESSEIHVAGLVVGECCPTPSHWSANCTLHEWLQQRGIPGLQGVDTRELTKKLREQGSLLGKLV----QKGTEPSALP--FVDPNARPLAPEVSIKTPRVFNAGGAPRICALDCGLKYNQIRCLCQLGAEVTVVPWDHELDSQKYDGLFLSNGPGDPASYPGVVSTLSRVLSEPNPRPVFGICLGHQLLALAIGAKTYKMRYGNRGHNQPCLLVGTGRCFLTSQNHGFAVDADSLPAGWAPLFTNANDCSNEGIVHDSLPFFSVQFHPEHRAGPSDMELLFDVFLETVREAAAGNIGGQTVRERLAQRLC----PPELPIPGSGLPPPRKVLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTLLINPNIATVQTSQGLADKVYFLPITLHYVTQVIRNERPDGVLLTFGGQTALNCGVELTKAGVLARYGVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQAQAAAERLGYPVLVRAAFALGGLGSGFASTKEELSALVAPAFAHTSQVLIDKSLKGWKEIEYEVVRDAYGNCVTVCNMENLDPLGIHTGESIVVAPSQTLNDREYQLLRRTAIKVTQHLGIVGECNVQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPELRNSVTG-GTAAFEPSLDYCVVKIPRWDLSKFLRVSTKIGSCM 759          

HSP 3 Score: 144.436 bits (363), Expect = 5.263e-33
Identity = 112/387 (28.94%), Postives = 185/387 (47.80%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMG------LHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAV--AYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQ--LIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRG-----EP--NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            +++LGSG   IG + EFD+   + IK L+    +T+++N N  TV T   + D ++F  ++L  V  +   E+PDGV+++ GGQ   N  +       L R  + + GT    I+  E+R  F+  +  IG      +     E A      + YP LVR ++ L G     A ++ +L+  +  A A      V+I K ++  KEI+ + V  AY G  +     E+++  GIH+G++ +V P Q +N++  Q + +   ++ Q L + G  N+Q  L  + +   +IE N R+SRS    SKA GY +   A +  +  P       + G     EP  +   VK+P +  ++       +G  M S GEV   G    EAF KA
Sbjct:  396 VLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTLLINPNIATVQTSQGLADKVYFLPITLHYVTQVIRNERPDGVLLTFGGQTALNCGVELTKAGVLARYGVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQAQAAAERLGYPVLVRAAFALGGLGSGFASTKEELSALVAPAFAHTSQ--VLIDKSLKGWKEIEYEVVRDAY-GNCVTVCNMENLDPLGIHTGESIVVAPSQTLNDREYQLLRRTAIKVTQHLGIVGECNVQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPELRNSVTGGTAAFEPSLDYCVVKIPRWDLSKFLRVSTKIGSCMKSVGEVMGIGRSFEEAFQKA 779          

HSP 4 Score: 94.7449 bits (234), Expect = 6.293e-18
Identity = 89/309 (28.80%), Postives = 154/309 (49.84%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQ----LGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQ--VLVDKSLRGWKEIEYEVVRDVYDNCITVCNM-ENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLG 2197
            EFD+     ++ LR+ G +T++VN N  TV T   + D+ Y   I+ + V ++ ++E P+GV L+ GGQ   N  + L         +  VLGTS E I   E+R +FS +L+ I      S   +     +++A Q    +GYP ++R ++ L G     A    +L    S+A A + +  V++ K ++  KEI+ + V    D  ++   + E+V+  G+H+G++ +V P Q ++      ++     V + L V G  N+Q  L     +  +IE N R+SRS    SK  G  L  +A ++ +G
Sbjct:  950 EFDWCAVGCIQQLRKMGYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGVILSMGGQLPNNMAMALHRQ------QCRVLGTSPEAIDSAENRFKFSRLLDTI----GISQPQWRELSDLESARQFCHTVGYPCVVRPSYVLSGAAMNVAYTDGDLERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAV--ACDGIVSAIAISEHVENAGVHSGDATLVTPPQDITPKTLERIKAIVHAVGQELQVTGPFNLQ--LIAKDDQLKVIECNVRVSRSFPFVSKTLGVDLVALATRIIMG 1244          
BLAST of Carbamoyl-phosphate synthase large chain vs. UniProt/SwissProt
Match: sp|P05990|PYR1_DROME (CAD protein OS=Drosophila melanogaster OX=7227 GN=r PE=1 SV=3)

HSP 1 Score: 1031.55 bits (2666), Expect = 0.000e+0
Identity = 516/897 (57.53%), Postives = 665/897 (74.14%), Query Frame = 3
Query: 2346 SVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYV-----EKFTESGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKIIKCLNELEEPRTYLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMS---EPFSLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDWDTGNQASSD--SKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQALRKAIYKKKICVASPTIDCITSQKIYRFPGLVDIHVHTRDPGQVHKEDWSTVTKXXXXXXXXXXFAMPNTAPPITNLESFELAKKRASSLAHCDYGLYVGASNDNWESLAELAPEAIGLKMYLNPTFSTLQMNNFSTWAKHFKHFPENRPICCHAEGETMAAVILLAQLHNRHVHICHVSRKQEIELIRLAKSQGLKVTCEVSPHH 5006
            SVGE+M++GR FEEAFQKALRMVD  + GFDP V     E+  E  LS PTDRR  V+A AL+ G+S++E++ LT IDYWFL K  +II   + L    +     +LL AK  GFSD QIA+ +KSTE+AVR  R E G+RP V QIDTV+ EWP  TNYLY +Y+G +HD+ F GG+ +V+GSGVYRIGSSVEFDWCAV C++EL+++++ TIM+N NPETVSTDYDMCD L+FEE+S E V+DI+ +E  +G+I+SMGGQLPNNIAM LHR++  + GTSP  ID AENRFKFSRMLD  GI QP+WKELT+ +SAI FC +V YPCLVRPSYVLSGAAMNVA+S  DL  YL  A  V+++HPVVISKF+ +AKEIDVDAVA  G++L  AVSEHVENAG+HSGDATLVTPPQD+N +TL+ I +I  ++A  L V+GPFNMQLIAK++ L VIECN+RVSRSFPFVSK L ++ +A ATRAI+    EP     + L G   KV VKVP FSF+RL GADV LGVEM STGEVACFG++R EA+LKA ++ G +IP+    + +SIGS+KHK ELL S+R L  +GY LYAS+GT DFY E G++V +V W        D   + +  ++++   + DL+INLP    G RR S  +T+GY+ RRLA+DY I L+T+VKCTKL V+++R    K  +   +   DC+TS++I + PG +D+HVH R+PG  HKED+++ T AA+AGG+T + AMPNT P I + E+F   ++ A + A CDY LYVGAS+DNW  + ELA  A GLKMYLN TF TL++++ ++W +H  H+P+  PI CHAE ++ AAVI+LA L +R VHICHV+RK+EI+LIR AK +G+KVTCEV PHH
Sbjct:  772 SVGEVMAIGRNFEEAFQKALRMVDSDVLGFDPDVVPLNKEQLAEQ-LSEPTDRRPFVIAAALQLGMSLRELHQLTNIDYWFLEKLERIILLQSLLTRNGSRTDAALLLKAKRFGFSDKQIAKYIKSTELAVRHQRQEFGIRPHVKQIDTVAGEWPASTNYLYHTYNGSEHDVDFPGGHTIVVGSGVYRIGSSVEFDWCAVGCLRELRKLQRPTIMINYNPETVSTDYDMCDRLYFEEISFEVVMDIYEMENSEGIILSMGGQLPNNIAMDLHRQQAKVLGTSPESIDCAENRFKFSRMLDRKGILQPRWKELTNLQSAIEFCEEVGYPCLVRPSYVLSGAAMNVAYSNQDLETYLNAASEVSREHPVVISKFLTEAKEIDVDAVASDGRILCMAVSEHVENAGVHSGDATLVTPPQDLNAETLEAIKRITCDLASVLDVTGPFNMQLIAKNNELKVIECNVRVSRSFPFVSKTLDHDFVATATRAIVGLDVEPL----DVLHGV-GKVGVKVPQFSFSRLAGADVQLGVEMASTGEVACFGDNRYEAYLKAMMSTGFQIPK--NAVLLSIGSFKHKMELLPSIRDLAKMGYKLYASMGTGDFYAEHGVNVESVQWTFDKTTPDDINGELRHLAEFLANKQFDLVINLPMSGGGARRVSSFMTHGYRTRRLAVDYSIPLVTDVKCTKLLVESMRMNGGKPPMKTHT---DCMTSRRIVKLPGFIDVHVHLREPGATHKEDFASGTAAALAGGVTLVCAMPNTNPSIVDRETFTQFQELAKAGARCDYALYVGASDDNWAQVNELASHACGLKMYLNDTFGTLKLSDMTSWQRHLSHWPKRSPIVCHAERQSTAAVIMLAHLLDRSVHICHVARKEEIQLIRSAKEKGVKVTCEVCPHH 1657          

HSP 2 Score: 845.499 bits (2183), Expect = 0.000e+0
Identity = 471/778 (60.54%), Postives = 573/778 (73.65%), Query Frame = 2
Query:   47 LILSDETVYIGNLFGAI------KQG-KGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGV-SDDKMLDQWGLPKSFESAK--IHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLINPLNNPELFIDPNERNLVEEVSINEIRHY-NKNG-NIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNADEYDALFISNGPGDPVKCTETIETIKNWIT-SEKPFMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVTAVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKPKKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
            L L D TV  G  FG +      K G  GEVVFQTGMVGYTE+L+D SY  Q+LVLTYP+IG+YGV + D+  D+ GLP  FE  K  + AT L+V E + E  +W    TL  WL++H V GI  IDTR LTKKLRE GS+ G IV  K  +   P ++   F+DPN RNL +E S+ E + Y N NG    + I+DCG+K NQ+RC  + GA VT++P++A +  +++DALF+SNGPG+P  C + ++ ++  I   +KP  GICLGHQLLA AIGC T+KMKYGNRGHN PC H  T RC MTSQNHG+AV    +PD W ELF N ND +NEGI+H   P+ SVQFHPEH +GP D E LF VF+E +   K  T    ++QRL      + T   +    ++   P+K+LILGSGGLSIGQAGEFDYSG+QA+KA+RE  IQTVL+NPNIATVQT+ G+ADK Y LP+T  YV +VIK ERP+GV LTFGGQTALNCG++LE +GVF  Y V +LGT I++I  TEDR+ F+E + EI E+VAPS A Y+V + +DAA +LGYPVM RAAF+LGGLGSGFANN  EL  LA  A AH+SQ++VDKSL+GWKE+EYEVVRD Y+NCITVCNMEN DPLGIHTGES+VVAPSQTLS+ EY MLR  ALKV+R+ GVVGECNIQYAL P+S +YYIIEVNARLSRSSALASKATGYPLAYVAAKL LG+ L  ++NSVT  TTACFEPS+DYCVVKIPRWDL KF +V   I SSM
Sbjct:    8 LALEDGTVLPGYSFGYVPSENESKVGFGGEVVFQTGMVGYTEALTDRSYSGQILVLTYPLIGNYGVPAPDE--DEHGLPLHFEWMKGVVQATALVVGEVAEEAFHWRKWKTLPDWLKQHKVPGIQDIDTRALTKKLREQGSMLGKIVYEKPPVEGLPKSS---FVDPNVRNLAKECSVKERQVYGNPNGKGPRIAILDCGLKLNQLRCLLQRGASVTLLPWSARLEDEQFDALFLSNGPGNPESCDQIVQQVRKVIEEGQKPVFGICLGHQLLAKAIGCSTYKMKYGNRGHNLPCLHRATGRCLMTSQNHGYAVDLEQLPDGWSELFVNANDGTNEGIVHASKPYFSVQFHPEHHAGPQDTEFLFDVFMESIQQ-KDLTIPQLIEQRL------RPTTPAIDSAPVM---PRKVLILGSGGLSIGQAGEFDYSGSQAIKAMRESNIQTVLINPNIATVQTSKGMADKCYFLPLTPHYVEQVIKSERPNGVLLTFGGQTALNCGVQLERAGVFSKYNVRILGTPIQSIIETEDRKLFAERVNEIGEQVAPSEAVYSVAQALDAASRLGYPVMARAAFSLGGLGSGFANNEEELQSLAQQALAHSSQLIVDKSLKGWKEVEYEVVRDAYNNCITVCNMENFDPLGIHTGESIVVAPSQTLSDREYQMLRSTALKVIRHFGVVGECNIQYALCPHSEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGLPLPDIKNSVTGNTTACFEPSLDYCVVKIPRWDLAKFVRVSKHIGSSM 770          

HSP 3 Score: 139.043 bits (349), Expect = 2.531e-31
Identity = 106/388 (27.32%), Postives = 182/388 (46.91%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHRE------KIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAV--AYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQ--LIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRG------EP--NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            +++LGSG   IG + EFD+   + IK ++    +T+++N N  TV T   M D  +F  L+   V  +   E+P+GV+++ GGQ   N  + L R        + I GT    I   E+R  F+  ++ IG      + +     A++  + + YP + R ++ L G     A +E +L     QA+A +    +++ K ++  KE++ + V  AY    +     E+ +  GIH+G++ +V P Q ++++  Q +     ++ +   V G  N+Q  L    +   +IE N R+SRS    SKA GY +   A +  +  P       + G      EP  +   VK+P +  A+       +G  M S GEV   G +  EAF KA
Sbjct:  406 VLILGSGGLSIGQAGEFDYSGSQAIKAMRESNIQTVLINPNIATVQTSKGMADKCYFLPLTPHYVEQVIKSERPNGVLLTFGGQTALNCGVQLERAGVFSKYNVRILGTPIQSIIETEDRKLFAERVNEIGEQVAPSEAVYSVAQALDAASRLGYPVMARAAFSLGGLGSGFANNEEELQSLAQQALAHSSQ--LIVDKSLKGWKEVEYEVVRDAY-NNCITVCNMENFDPLGIHTGESIVVAPSQTLSDREYQMLRSTALKVIRHFGVVGECNIQYALCPHSEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGLPLPDIKNSVTGNTTACFEPSLDYCVVKIPRWDLAKFVRVSKHIGSSMKSVGEVMAIGRNFEEAFQKA 790          

HSP 4 Score: 98.9821 bits (245), Expect = 3.271e-19
Identity = 78/278 (28.06%), Postives = 137/278 (49.28%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYT-VKECIDAAEQLGYPVMIRXX--XXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYE-VVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVN 2113
            EFD+     L+ LR+    T+++N N  TV T   + D+ Y   I+ + V ++ +ME  +G+ L+ GGQ   N  ++L         +  VLGTS E+I   E+R +FS +L+  K  + P     T ++  I+  E++GYP ++R +   +   +   ++N   E    A++  +    V++ K L   KEI+ + V  D    C+ V   E+V+  G+H+G++ +V P Q L+      +++    +   L V G  N+Q     N  K  +IE N
Sbjct:  964 EFDWCAVGCLRELRKLQRPTIMINYNPETVSTDYDMCDRLYFEEISFEVVMDIYEMENSEGIILSMGGQLPNNIAMDLHRQ------QAKVLGTSPESIDCAENRFKFSRMLDR-KGILQPRWKELTNLQSAIEFCEEVGYPCLVRPSYVLSGAAMNVAYSNQDLETYLNAASEVSREHPVVISKFLTEAKEIDVDAVASDGRILCMAVS--EHVENAGVHSGDATLVTPPQDLNAETLEAIKRITCDLASVLDVTGPFNMQLIAKNNELK--VIECN 1230          
BLAST of Carbamoyl-phosphate synthase large chain vs. TrEMBL
Match: A0A2C9K7M7 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106065454 PE=3 SV=1)

HSP 1 Score: 1101.27 bits (2847), Expect = 0.000e+0
Identity = 551/893 (61.70%), Postives = 696/893 (77.94%), Query Frame = 3
Query: 2346 SVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYVEKFTESGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKIIKCLNELE--EPRTY-LSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDW---DTGNQASSDSKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQALRKAIYKKKICVASPTIDCITSQKIYRFPGLVDIHVHTRDPGQVHKEDWSTVTKXXXXXXXXXXFAMPNTAPPITNLESFELAKKRASSLAHCDYGLYVGASNDNWESLAELAPEAIGLKMYLNPTFSTLQMNNFSTWAKHFKHFPENRPICCHAEGETMAAVILLAQLHNRHVHICHVSRKQEIELIRLAKSQGLKVTCEVSPHH 5006
            S+GE+M++G  FEEAFQKALRMVDE ++GFDP + K  E+ L  PTD+R+ VLA ALK+ +++  +Y+LTKID WFLYKF  II+   ELE  + +TY L K++LL+AK LGFSD QIA+ V STE+ VR+ R +LGV P V QIDTV+AEWP  TNYLYL+Y+  +HDI FE  ++MVLGSGVYRIGSSVEFDWCAV CI+ L++M  KTIMVN NPETVSTDYDMCD L+F+E+S E V+DI+ +E P G+I+SMGGQLPNNIAM LHR++  I GTSP  IDNAENRFKFSRMLD++ I QP WKEL+  E+A+ FC++V YPCL+RPSYVLSGAAMNVA ++ DL  +LTQAVAV+KDHPVVISKFI++AKEIDVDAVA  G+++  AVSEHVENAG+HSGDATLVTPPQD+N +TL KI  I   I + L+V+GPFN+QLIAKD++L VIECN+RVSRSFPFVSKAL Y+ IA ATR IM E   +E   + G   KVAVKVP+FSF+RL GADVLLGVEM STGEVACFGE+R +A+LKA ++ G +IP+   NI ISIGSYKHK EL+ ++R L  LGY L+AS+GTADFY E G +V +VDW   DTG  +  + +++T +DY+ E   DL+INLP RNSG  RAS  IT GYK RR+A+DY + L+T+VKCTKLFV+AL +   ++   V    IDC+TSQKI R PGL+D+HVH R+PG  HKEDWS+ T AA+AGGITTI AMPNT PP+ + E + L  K A   A CDYGL+ GASN N+++L +L  + + LKMYLN T++TL++++ + W KHF+H+P++ P+C HAE  T AAVIL+++L  R +HICHV+RK EI +I+ AK +GL VTCEV+PHH
Sbjct:  767 SIGEVMAIGIKFEEAFQKALRMVDESVRGFDPTMLKACENELQHPTDKRIFVLAAALKENMTIDHLYNLTKIDRWFLYKFKNIIEKYRELELYKGKTYSLPKELLLSAKKLGFSDQQIAQVVSSTELVVRKCRYDLGVTPWVRQIDTVAAEWPASTNYLYLTYNSSEHDIPFESKHVMVLGSGVYRIGSSVEFDWCAVNCIRTLRQMDYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYQLENPLGIILSMGGQLPNNIAMDLHRQQAVILGTSPDSIDNAENRFKFSRMLDNLKINQPLWKELSTFEAAVAFCDEVGYPCLIRPSYVLSGAAMNVAMNKHDLETFLTQAVAVSKDHPVVISKFIQEAKEIDVDAVASDGEVICIAVSEHVENAGVHSGDATLVTPPQDINSETLAKIKGICCAIGRALEVTGPFNIQLIAKDNHLKVIECNVRVSRSFPFVSKALNYDFIATATRIIMGE--YIEPVNITGGCGKVAVKVPVFSFSRLHGADVLLGVEMASTGEVACFGENRYDAYLKATISTGFQIPK--KNILISIGSYKHKTELIPTMRTLEKLGYQLFASMGTADFYNEHGFNVRSVDWPYEDTGEDSCKNGEQRTIADYLSEHMFDLVINLPLRNSGSYRASSFITQGYKTRRMAVDYSVPLITDVKCTKLFVEALHQLNAQEP--VMKTNIDCLTSQKIIRLPGLIDVHVHVREPGATHKEDWSSCTAAALAGGITTILAMPNTNPPLVDQEGYNLTSKLARQGARCDYGLFAGASNTNFQTLTQLCNKVVALKMYLNETYTTLKLDDMTIWMKHFEHWPKSFPLCVHAEEMTTAAVILMSELFQRSIHICHVARKSEILVIKAAKERGLPVTCEVAPHH 1653          

HSP 2 Score: 913.679 bits (2360), Expect = 0.000e+0
Identity = 488/767 (63.62%), Postives = 599/767 (78.10%), Query Frame = 2
Query:   47 LILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLINPLNNPELFIDPNERNLVEEVSINEIRHYNKNGNIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNADEYDALFISNGPGDPVKCTETIETIKNWITSE--KPFMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVTAVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKPKKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
            L L D TV+ G  FGA K   GEVVFQTGMVGY ESL+DPSYH Q+LVLTYP+IG+YGV DD  +D+ GLP  FES KIHA  LI  + + +YS+W A+ +LS W+++  V GI GIDTR LTKK+RE G + G       K+++N   +   FI+P++ NLV+EVS   +  YN +G++ +  IDCG+K NQIRC C+ GA VTV+P++ ++N  ++DA+F+SNGPGDP+ C+ TI T+++ +     KP  GICLGHQLL+LAIG KT KMKYGNRGHNQPC + Q+ RCF+TSQNHGFAV  +++P  W  LF N NDKSNEGIIH+ LP  SVQFHPE+ +GP D+E +F VF++H  + K     VS+ +RL    T+  T+  L++T L   +PKK+LILGSGGLSIGQAGEFDYSG+QA+KAL+EE I TVL+NPNIATVQT+ G+ADK Y LPIT  YVT+VIK ERPDGV L FGGQTALNCG+ L +SGVF+ Y V VLGT + +I  TEDR+ F++ + EI E VAPS AA++V++ + AAE+LGYPV+IRAA+ALGGLGSGFANN  ELL L +AAFAHT+QVLVDKSL+GWKE+EYEVVRD YDNCITVCNMENVDPLGIHTGES+VVAPSQTL++ EY MLR  A+KV+R+LG+VGECNIQYAL+P S +YYIIEVNARLSRSSALASKATGYPLAYVAAKL LG  L  L+NSVT  TTACFEPS+DYCVVKIPRWDL KF +V  KI SSM
Sbjct:   11 LKLEDGTVFPGISFGAAKSVPGEVVFQTGMVGYPESLTDPSYHKQILVLTYPLIGNYGVGDDS-VDEHGLPIWFESYKIHAAALICADLTEQYSHWGAKKSLSTWMKEQNVPGIYGIDTRALTKKIREKGIMLG-------KVIVNNDEDDIPFINPDKVNLVQEVSSKSVVTYNTSGDVKIVAIDCGMKYNQIRCMCRRGASVTVVPWDYSLNTKDFDAVFVSNGPGDPMMCSTTINTLRSLVADPHCKPLFGICLGHQLLSLAIGAKTFKMKYGNRGHNQPCIYDQSLRCFITSQNHGFAVDTNTLPKGWLPLFTNANDKSNEGIIHESLPVFSVQFHPENKAGPQDLEDMFTVFLDHARSCKKGVDGVSIRERL---YTFIKTEG-LSMTQLEIAQPKKVLILGSGGLSIGQAGEFDYSGSQAIKALKEENISTVLINPNIATVQTSQGMADKVYFLPITPQYVTQVIKSERPDGVLLAFGGQTALNCGVTLTKSGVFEKYGVKVLGTQVASIVWTEDRKIFADKMLEINEFVAPSEAAHSVEQAVQAAERLGYPVLIRAAYALGGLGSGFANNKEELLVLVTAAFAHTTQVLVDKSLQGWKEVEYEVVRDAYDNCITVCNMENVDPLGIHTGESIVVAPSQTLTDAEYNMLRTTAIKVIRHLGIVGECNIQYALNPLSQQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGRPLPLLKNSVTGSTTACFEPSLDYCVVKIPRWDLKKFNRVSTKIGSSM 765          

HSP 3 Score: 135.191 bits (339), Expect = 9.070e-28
Identity = 111/389 (28.53%), Postives = 182/389 (46.79%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHR----EK--IPIFGTSPICIDNAENRFKFS-RMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAV--AYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQ--LIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRG------EP--NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            +++LGSG   IG + EFD+   + IK L+     T+++N N  TV T   M D ++F  ++ + V  +   E+PDGV+++ GGQ   N  + L +    EK  + + GT    I   E+R  F+ +ML+      P  +     E A+     + YP L+R +Y L G     A ++ +L   +T A A      V++ K ++  KE++ + V  AY   +    + E+V+  GIH+G++ +V P Q + +     +     ++ + L + G  N+Q  L        +IE N R+SRS    SKA GY +   A +  +  P  L    + G      EP  +   VK+P +   +       +G  M S GEV   G    EAF KA
Sbjct:  401 VLILGSGGLSIGQAGEFDYSGSQAIKALKEENISTVLINPNIATVQTSQGMADKVYFLPITPQYVTQVIKSERPDGVLLAFGGQTALNCGVTLTKSGVFEKYGVKVLGTQVASIVWTEDRKIFADKMLEINEFVAPS-EAAHSVEQAVQAAERLGYPVLIRAAYALGGLGSGFANNKEELLVLVTAAFAHTTQ--VLVDKSLQGWKEVEYEVVRDAYDNCITVCNM-ENVDPLGIHTGESIVVAPSQTLTDAEYNMLRTTAIKVIRHLGIVGECNIQYALNPLSQQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGRPLPLLKNSVTGSTTACFEPSLDYCVVKIPRWDLKKFNRVSTKIGSSMKSIGEVMAIGIKFEEAFQKA 785          

HSP 4 Score: 103.99 bits (258), Expect = 3.287e-18
Identity = 89/305 (29.18%), Postives = 152/305 (49.84%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQ--VLVDKSLRGWKEIEYE-VVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLG 2197
            EFD+     ++ LR+   +T++VN N  TV T   + D+ Y   I+ + V ++ ++E P G+ L+ GGQ   N  ++L         +  +LGTS ++I   E+R +FS +L+ +K          T +  +   +++GYP +IR ++ L G     A N  +L    + A A +    V++ K ++  KEI+ + V  D    CI V   E+V+  G+H+G++ +V P Q +++     ++     + R L V G  NIQ     N  K  +IE N R+SRS    SKA  Y     A ++ +G
Sbjct:  958 EFDWCAVNCIRTLRQMDYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYQLENPLGIILSMGGQLPNNIAMDLHRQ------QAVILGTSPDSIDNAENRFKFSRMLDNLKINQPLWKELSTFEAAVAFCDEVGYPCLIRPSYVLSGAAMNVAMNKHDLETFLTQAVAVSKDHPVVISKFIQEAKEIDVDAVASDGEVICIAVS--EHVENAGVHSGDATLVTPPQDINSETLAKIKGICCAIGRALEVTGPFNIQLIAKDNHLK--VIECNVRVSRSFPFVSKALNYDFIATATRIIMG 1252          
BLAST of Carbamoyl-phosphate synthase large chain vs. TrEMBL
Match: A0A433TUL0 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_007006 PE=3 SV=1)

HSP 1 Score: 1097.03 bits (2836), Expect = 0.000e+0
Identity = 545/891 (61.17%), Postives = 688/891 (77.22%), Query Frame = 3
Query: 2346 SVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYVEKFTESGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKIIKCLNELEEPR-TYLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDW---DTGNQASSDSKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQALRKAIYKKKICVASPTIDCITSQKIYRFPGLVDIHVHTRDPGQVHKEDWSTVTKXXXXXXXXXXFAMPNTAPPITNLESFELAKKRASSLAHCDYGLYVGASNDNWESLAELAPEAIGLKMYLNPTFSTLQMNNFSTWAKHFKHFPENRPICCHAEGETMAAVILLAQLHNRHVHICHVSRKQEIELIRLAKSQGLKVTCEVSPHH 5006
            SVGE+M++GR FEEAFQKALRM+DE  KGFD       E  L  PTD+R+ V+A AL +G+SV  +Y+LTKID WFL+KF  I     +L+  +   L +++LL+AK LGFSD QIA+AV STE+ VR+ R++ GV P V QIDTV+AEWP  TNYLYL+YSG +HD+ F+G +IMVLGSGVYRIGSSVEFDWCA  CIK L+ M  KTIMVNCNPETVSTDYDMCD L+F+E+S E V+DI+++E PDG+I+SMGGQLPNNIAM LHR++  I GTSP CID+AENRFKFSR+LD++ I QP+WKEL+  ESA+ FC++V +PCL+RPSYVLSGAAMNVA +  +L  +L QA AV+KDHPVVISKFI +AKEIDVDAVA  G+++  AVSEHVENAG+HSGDATLVTPPQD+N +TL +I  I   I + L+V+GPFN+QLIAKD++L VIECN+RVSRSFPFVSKAL Y+ +A AT+ IM E   LE   +     KVAVKVP+FSF+RL GADVLLGVEM STGEVACFGEDR EA+LKAQL+ G KIPR   NI ISIGSYKHK EL+ +++ L  LGY L+AS+GTADFY E G  + AVDW   DTG+  + + +++T +DY+ E   DL+INLP RN+G  RAS  +T GYK RR+A+DY + L+T+VKC KLFV+AL +   +  +      IDC++SQ++ R PGL+DIHVH R+PG  HKEDWS+ T AA+AGG+TTI AMPNT P   +LE++++  K A + A CDYG+Y GASN N +++  ++ + + LKMYLN TF+TL+M++ S W KHF+H+P+N PIC HAEG T AAVILLA+L  R +HICHV+RK EI +IR AK +GL +TCEV PHH
Sbjct:  767 SVGEVMAIGRKFEEAFQKALRMMDESAKGFDHTTHGVCEKELQFPTDKRIFVVAAALHKGMSVDRLYELTKIDKWFLHKFKNITSMYTQLQTLKGKNLPRELLLSAKQLGFSDQQIAQAVSSTELVVRKARLDHGVMPWVKQIDTVAAEWPASTNYLYLTYSGTEHDLPFQGKHIMVLGSGVYRIGSSVEFDWCACNCIKTLREMGHKTIMVNCNPETVSTDYDMCDRLYFDEISFEVVMDIYNMESPDGIILSMGGQLPNNIAMDLHRQQAVILGTSPDCIDSAENRFKFSRLLDNLNINQPRWKELSTYESAMEFCDEVGFPCLIRPSYVLSGAAMNVASNRHELDLFLNQAAAVSKDHPVVISKFILEAKEIDVDAVANEGEVICMAVSEHVENAGVHSGDATLVTPPQDLNAQTLARIKAICCAIGRALEVTGPFNLQLIAKDNHLKVIECNVRVSRSFPFVSKALNYDFVATATKIIMGE--KLEPVDVVAGCGKVAVKVPVFSFSRLAGADVLLGVEMASTGEVACFGEDRFEAYLKAQLSTGFKIPR--KNILISIGSYKHKNELMPTLKTLQKLGYQLFASMGTADFYNEHGFQIQAVDWPYEDTGDDTTRNGEQRTIADYLAEHMFDLVINLPLRNTGSYRASSFVTQGYKTRRMAVDYSVPLITDVKCAKLFVEALNRLKSQPPM---KTNIDCLSSQRLIRLPGLIDIHVHVREPGAPHKEDWSSCTAAALAGGVTTILAMPNTNPATVDLEAYQVTAKCAKAGARCDYGIYAGASNFNPQTVPSISRKVVALKMYLNDTFTTLKMDDMSVWMKHFEHWPKNVPICAHAEGVTTAAVILLAELFQRPLHICHVARKCEILVIRAAKERGLPITCEVCPHH 1650          

HSP 2 Score: 907.131 bits (2343), Expect = 0.000e+0
Identity = 484/769 (62.94%), Postives = 593/769 (77.11%), Query Frame = 2
Query:   47 LILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITG-VIVPIKDKLLINPLNNPELFIDPNERNLVEEVSINEIRHYNKNGNIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNADEYDALFISNGPGDPVKCTETIETIKNWITSE--KPFMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVTAVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENK-PKKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
            L L D +VY G  FG  +   GEVVFQTGMVGY ESL+DPSYH Q+LVLTYP+IG+YGV  ++ LD++GLP  FES KIHA  L+V + S +YS+W A+ +LS WLE++ + GI GIDTR LTKK+RE G++ G V V IKD       +    F+DP++  L  EVS    + YN +G++ +  +DCG+K NQIRC C+ GA VTV+P++  +N  EYD LFISNGPGDP  CT+T+E I++ I     KP  GIC GHQLL+LAIG KT+KMKYGNRGHNQPC +  + RCF+TSQNHGFAV  +++P EW  LF N NDK+NEGI+H  LPF + QFHPEH +GP D+E+LF VF++ + + K    + S+ +R+     Y   + E   T  L+ K PKK+LILGSGGLSIGQAGEFDYSG+QA+KAL+EE + +VL+NPNIATVQT+ G+AD  Y LPIT +YVT+VI+ ERPDG+ LTFGGQTALNCG+ L ++GV   Y V VLGT + +I+ TEDR+ F++ + EI E VAPS+AAY+ ++   AAE LGYPV+IRAAFALGGLGSGFA N  ELL L +AAFAHTSQVLVDKSL+GWKE+EYEVVRD YDNCITVCNMENVDPLGIHTGES+VVAPSQTL+N EY MLR  A+KV+R+LGVVGECNIQYAL+P S +YYIIEVNARLSRSSALASKATGYPLAYVAAKL LG  L  L+NSVT  TTACFEPS+DYCVVKIPRWDL+KF++V  KI SSM
Sbjct:    9 LQLEDGSVYHGLPFGKHQSVSGEVVFQTGMVGYPESLTDPSYHRQILVLTYPLIGNYGVGGNE-LDKFGLPHWFESDKIHAAALVVGDLSEQYSHWGAKRSLSDWLEENNIPGIYGIDTRALTKKIREKGTMLGKVSVIIKDN------SGAMEFVDPDKFILAAEVSSKAPKSYNPDGDVKIVAVDCGMKYNQIRCLCERGASVTVVPWDHPLNPAEYDGLFISNGPGDPTLCTKTVENIRSVINDSRVKPIFGICFGHQLLSLAIGAKTYKMKYGNRGHNQPCMYQNSLRCFITSQNHGFAVDPNTLPKEWEPLFTNANDKTNEGIVHTSLPFFTTQFHPEHRAGPQDLEMLFDVFLDQIRSSKQGKLSPSIKERI-----YMKLRREGIPTTRLDAKLPKKVLILGSGGLSIGQAGEFDYSGSQAIKALKEENVCSVLINPNIATVQTSRGMADSVYFLPITPEYVTQVIQSERPDGILLTFGGQTALNCGVTLTKTGVLDKYNVKVLGTQVASIEWTEDRKVFADKMAEINESVAPSVAAYSPEQAEQAAETLGYPVLIRAAFALGGLGSGFAENREELLPLVNAAFAHTSQVLVDKSLKGWKEVEYEVVRDAYDNCITVCNMENVDPLGIHTGESIVVAPSQTLTNAEYNMLRTTAIKVIRHLGVVGECNIQYALNPLSQQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGRPLPLLKNSVTGSTTACFEPSLDYCVVKIPRWDLSKFSRVSTKIGSSM 765          

HSP 3 Score: 131.724 bits (330), Expect = 1.024e-26
Identity = 105/388 (27.06%), Postives = 173/388 (44.59%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHRE------KIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAV--AYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQ--LIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRG------EP--NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            +++LGSG   IG + EFD+   + IK L+     ++++N N  TV T   M D ++F  ++ E V  +   E+PDG++++ GGQ   N  + L +        + + GT    I+  E+R  F+  +  I             E A      + YP L+R ++ L G     A +  +L   +  A A      V++ K ++  KE++ + V  AY    +     E+V+  GIH+G++ +V P Q +       +     ++ + L V G  N+Q  L        +IE N R+SRS    SKA GY +   A +  +  P  L    + G      EP  +   VK+P +  ++       +G  M S GEV   G    EAF KA
Sbjct:  401 VLILGSGGLSIGQAGEFDYSGSQAIKALKEENVCSVLINPNIATVQTSRGMADSVYFLPITPEYVTQVIQSERPDGILLTFGGQTALNCGVTLTKTGVLDKYNVKVLGTQVASIEWTEDRKVFADKMAEINESVAPSVAAYSPEQAEQAAETLGYPVLIRAAFALGGLGSGFAENREELLPLVNAAFAHTSQ--VLVDKSLKGWKEVEYEVVRDAY-DNCITVCNMENVDPLGIHTGESIVVAPSQTLTNAEYNMLRTTAIKVIRHLGVVGECNIQYALNPLSQQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGRPLPLLKNSVTGSTTACFEPSLDYCVVKIPRWDLSKFSRVSTKIGSSMKSVGEVMAIGRKFEEAFQKA 785          

HSP 4 Score: 114.005 bits (284), Expect = 3.079e-21
Identity = 108/345 (31.30%), Postives = 172/345 (49.86%), Query Frame = 2
Query: 1181 LTYQHTQHELTLTALLENKPKKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDL---ASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSL 2206
            LTY  T+H+L          K I++LGSG   IG + EFD+     +K LRE G +T++VN N  TV T   + D+ Y   I+ + V ++  ME PDG+ L+ GGQ   N  ++L         +  +LGTS + I   E+R +FS +L+ +           T +  ++  +++G+P +IR ++ L G     A+N  E LDL    +AA +    V++ K +   KEI+ + V +     I +   E+V+  G+H+G++ +V P Q L+      ++     + R L V G  N+Q     N  K  +IE N R+SRS    SKA  Y     A K+ +G  L
Sbjct:  925 LTYSGTEHDLPFQG------KHIMVLGSGVYRIGSSVEFDWCACNCIKTLREMGHKTIMVNCNPETVSTDYDMCDRLYFDEISFEVVMDIYNMESPDGIILSMGGQLPNNIAMDLHRQ------QAVILGTSPDCIDSAENRFKFSRLLDNLNINQPRWKELSTYESAMEFCDEVGFPCLIRPSYVLSGAAMNVASNRHE-LDLFLNQAAAVSKDHPVVISKFILEAKEIDVDAVAN-EGEVICMAVSEHVENAGVHSGDATLVTPPQDLNAQTLARIKAICCAIGRALEVTGPFNLQLIAKDNHLK--VIECNVRVSRSFPFVSKALNYDFVATATKIIMGEKL 1253          
BLAST of Carbamoyl-phosphate synthase large chain vs. TrEMBL
Match: A0A2T7NRL6 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_17066 PE=3 SV=1)

HSP 1 Score: 1093.95 bits (2828), Expect = 0.000e+0
Identity = 549/893 (61.48%), Postives = 679/893 (76.04%), Query Frame = 3
Query: 2346 SVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYVEKFTESGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKIIKCLNELEEPR---TYLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDW---DTGNQASSDSKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQALRKAIYKKKICVASPTIDCITSQKIYRFPGLVDIHVHTRDPGQVHKEDWSTVTKXXXXXXXXXXFAMPNTAPPITNLESFELAKKRASSLAHCDYGLYVGASNDNWESLAELAPEAIGLKMYLNPTFSTLQMNNFSTWAKHFKHFPENRPICCHAEGETMAAVILLAQLHNRHVHICHVSRKQEIELIRLAKSQGLKVTCEVSPHH 5006
            SVGE+M++G  FEEAFQKALRM+DE + GF P  E+ +E  LS PTD+R+ VL  AL  G S+  +Y+LT ID WFL+KF KI    + +E  R     L  DI+L AK +GFSD QIA+AV  TE+AVR  R   GV P V QIDTV+AEWP  TNYLYL+Y+   HD+ F GGY++V+GSGVYRIGSSVEFDWCAV CI++L++M  KTIM+N NPETVSTDYDMCD L+F+E+S E V+DI+ +E P+GVI+SMGGQLPNNIAM LHR+++ I GTS   IDNAENRFKFSRMLD++GI QP+WKEL+ +ESAI FC +V +PCLVRPSYVLSGAAMNVA S  DL  YLTQA AV+K+HPVV SKFI +AKEIDVDAVA  GK++  AVSEHVENAG+HSGDATLVTPPQD+NE+TL KI  I   I   L V+GPFN+QLIAKD+ L VIECN+RVSRSFPFVSKAL ++ IA ATR IM E  ++E   +     +VAVKVP+FSF+RL GADVLLGVEM STGEVACFGEDR EA+LKAQ++ G +IPR   NI +SIGS+K K EL+ +VR L  +GYNL+ASLGTADFY E G  V AVDW   DTG + S++ +++T +DY+ E  +DL+INLP RN G  RAS  +T GYK RR+AIDY + L T+VKCTK+FV+ALR+    K I      IDCI+S++I R PGL+D+HVH R+PG  HKEDW++ TKAA+AGG+T I AMPNT PP  +  +  L +K A   A+CDYGLY+GASN N+ +   LA +A+ LKMYLN TF+TL++++   W KHF+H+P N PIC HAEG T AA++ +A L  R VHICHV+RK EI ++R AK +GL VTCEV+PHH
Sbjct:  766 SVGEVMAIGCKFEEAFQKALRMMDESVMGFYPNTEEASEKELSDPTDKRIFVLGAALAAGYSIDRLYELTNIDRWFLHKFKKITDHYHLMENYRGKSKELPTDIMLQAKQMGFSDKQIAKAVARTELAVRMARNLQGVVPWVRQIDTVAAEWPASTNYLYLTYNAAQHDLLFPGGYVIVVGSGVYRIGSSVEFDWCAVNCIRQLRKMGYKTIMINYNPETVSTDYDMCDRLYFDEISFEVVMDIYSVENPEGVILSMGGQLPNNIAMDLHRQQVKILGTSAESIDNAENRFKFSRMLDTVGISQPQWKELSTTESAIAFCKEVGFPCLVRPSYVLSGAAMNVAHSVVDLENYLTQASAVSKEHPVVTSKFILEAKEIDVDAVASDGKVVCMAVSEHVENAGVHSGDATLVTPPQDLNEETLAKIKAICLAIGGALGVTGPFNIQLIAKDNQLKVIECNVRVSRSFPFVSKALDHDFIATATRVIMGE--TVEPVNVLYGCGRVAVKVPVFSFSRLQGADVLLGVEMASTGEVACFGEDRYEAYLKAQISTGFQIPR--KNILLSIGSFKSKMELIPTVRSLIEMGYNLFASLGTADFYNEHGFKVTAVDWPYEDTG-EDSANGEQRTIADYLSEHMVDLVINLPLRNGGSYRASSFVTQGYKTRRMAIDYCVPLFTDVKCTKMFVEALRRV---KGIPPLKTHIDCISSKRIIRLPGLIDVHVHVREPGATHKEDWASATKAALAGGVTMILAMPNTTPPTVDSSALALTQKLARQSAYCDYGLYIGASNQNFTTAPNLASQAVALKMYLNETFTTLRLDDICVWIKHFEHWPRNIPICAHAEGATTAAILFIADLFQRPVHICHVARKAEILVVRAAKEKGLPVTCEVTPHH 1650          

HSP 2 Score: 910.212 bits (2351), Expect = 0.000e+0
Identity = 480/773 (62.10%), Postives = 596/773 (77.10%), Query Frame = 2
Query:   32 RMKGA-LILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLINPLNNPELFIDPNERNLVEEVSINEIRHYNKNGNIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNADEYDALFISNGPGDPVKCTETIETIKNWITSE--KPFMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVTAVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKPKKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
            R+K A L L D + Y  NLFGA     GEVVFQTGMVGY ESL+DPSY  Q+L+LTYP+IG+YG++ D+ LD++GL + FES  IHA  L+V + +  YS+W+A  +LSQWL +H + G+ G+DTR LTKK+RE GS+ G I+   D    +P  N     DPN  NLVEEVS+     YN +G + +  +DCG+K +QIRC C+ GA VTV+P+N  +   E+D +F+SNGPGDP  C  TI +++N +  E  KP  GICLGHQLL+LAIG +T+KMKYGNRGHNQPC +  T RC++T+QNHGFAV   S+P  W  LF N ND +NEGIIH+  PF SVQFHPE+M+GP D+E LF VF++ V + K    + ++ +RL   +  +    ++ L  L    PKK+L+LGSGGLSIGQAGEFDYSG+QA+KAL+EEG+QTVL+NPNIATVQT+ G+ADK Y LPIT DYVT+VIK E+PDG+ LTFGGQTALNCGI+L  +GV +  +V VLGT + +I+ TEDR+ F++ + EI E VAPS AAY+V++ + AAE LGYPV++RAAFALGGLGSGFA+N  EL+ L ++AFAHTSQVLVDKSL+GWKE+EYEVVRD YDNCITVCNMENVDPLGIHTGES+VVAPSQTL+N EY +LR  ALKV+R+LG+VGECNIQYAL P S +YYIIEVNARLSRSSALASKATGYPLAYVAAKL LG+ L  LRNSVT  TTACFEPS+DYCVVK+PRWDL KF++V NKI SSM
Sbjct:    3 RVKSATLYLEDGSCYEANLFGAAVSTSGEVVFQTGMVGYPESLTDPSYKRQILILTYPLIGNYGIASDE-LDKFGLKRWFESNTIHAAALVVADVTDNYSHWSASKSLSQWLAEHNIPGLYGVDTRALTKKIREKGSLLGKIIVHGD----DP--NSIAMEDPNVLNLVEEVSLKSPVTYNPSGEVQIVAVDCGMKFHQIRCLCERGAAVTVVPWNHPLTGLEFDGIFLSNGPGDPTMCQATINSVQNLLNREDYKPIFGICLGHQLLSLAIGARTYKMKYGNRGHNQPCLYEDTIRCYITTQNHGFAVDTQSLPKGWLPLFTNANDLTNEGIIHETKPFFSVQFHPENMAGPQDLEFLFDVFLDTVKSNKKGCVSPTVKERLRQAVHLK----DVPLYPLKTPHPKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGVQTVLINPNIATVQTSQGLADKVYFLPITPDYVTQVIKCEKPDGILLTFGGQTALNCGIQLTRTGVLERNEVKVLGTQVSSIEWTEDRKVFADKMAEINEAVAPSEAAYSVEQAVQAAETLGYPVLVRAAFALGGLGSGFASNREELIALVTSAFAHTSQVLVDKSLKGWKEVEYEVVRDAYDNCITVCNMENVDPLGIHTGESIVVAPSQTLTNMEYNLLRTTALKVIRHLGIVGECNIQYALSPFSQQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPQLRNSVTGSTTACFEPSLDYCVVKVPRWDLRKFSRVSNKIGSSM 764          

HSP 3 Score: 134.806 bits (338), Expect = 1.427e-27
Identity = 107/388 (27.58%), Postives = 177/388 (45.62%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMG------LHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAV--AYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQ--LIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRG------EP--NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            ++VLGSG   IG + EFD+   + IK L+    +T+++N N  TV T   + D ++F  ++ + V  +   E+PDG++++ GGQ   N  +       L R ++ + GT    I+  E+R  F+  +  I       +     E A+     + YP LVR ++ L G     A +  +L   +T A A      V++ K ++  KE++ + V  AY   +    + E+V+  GIH+G++ +V P Q +       +     ++ + L + G  N+Q  L        +IE N R+SRS    SKA GY +   A +  +  P       + G      EP  +   VKVP +   +       +G  M S GEV   G    EAF KA
Sbjct:  400 VLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGVQTVLINPNIATVQTSQGLADKVYFLPITPDYVTQVIKCEKPDGILLTFGGQTALNCGIQLTRTGVLERNEVKVLGTQVSSIEWTEDRKVFADKMAEINEAVAPSEAAYSVEQAVQAAETLGYPVLVRAAFALGGLGSGFASNREELIALVTSAFAHTSQ--VLVDKSLKGWKEVEYEVVRDAYDNCITVCNM-ENVDPLGIHTGESIVVAPSQTLTNMEYNLLRTTALKVIRHLGIVGECNIQYALSPFSQQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPQLRNSVTGSTTACFEPSLDYCVVKVPRWDLRKFSRVSNKIGSSMKSVGEVMAIGCKFEEAFQKA 784          

HSP 4 Score: 106.301 bits (264), Expect = 6.675e-19
Identity = 80/277 (28.88%), Postives = 140/277 (50.54%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQ--VLVDKSLRGWKEIEYE-VVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVN 2113
            EFD+     ++ LR+ G +T+++N N  TV T   + D+ Y   I+ + V ++  +E P+GV L+ GGQ   N  ++L         +V +LGTS E+I   E+R +FS +L+ +           T +  I   +++G+P ++R ++ L G     A++  +L +  + A A + +  V+  K +   KEI+ + V  D    C+ V   E+V+  G+H+G++ +V P Q L+      ++   L +   LGV G  NIQ     N  K  +IE N
Sbjct:  957 EFDWCAVNCIRQLRKMGYKTIMINYNPETVSTDYDMCDRLYFDEISFEVVMDIYSVENPEGVILSMGGQLPNNIAMDLHRQ------QVKILGTSAESIDNAENRFKFSRMLDTVGISQPQWKELSTTESAIAFCKEVGFPCLVRPSYVLSGAAMNVAHSVVDLENYLTQASAVSKEHPVVTSKFILEAKEIDVDAVASDGKVVCMAVS--EHVENAGVHSGDATLVTPPQDLNEETLAKIKAICLAIGGALGVTGPFNIQLIAKDNQLK--VIECN 1223          
BLAST of Carbamoyl-phosphate synthase large chain vs. TrEMBL
Match: A0A0L8FL84 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22015397mg PE=3 SV=1)

HSP 1 Score: 1088.17 bits (2813), Expect = 0.000e+0
Identity = 544/894 (60.85%), Postives = 686/894 (76.73%), Query Frame = 3
Query: 2346 SVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYVEKFTESGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKIIKCLNELEEPRTY---LSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDWDTGNQASSDS----KKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQALRKAIYKKKICVASPTIDCITSQKIYRFPGLVDIHVHTRDPGQVHKEDWSTVTKXXXXXXXXXXFAMPNTAPPITNLESFELAKKRASSLAHCDYGLYVGASNDNWESLAELAPEAIGLKMYLNPTFSTLQMNNFSTWAKHFKHFPENRPICCHAEGETMAAVILLAQLHNRHVHICHVSRKQEIELIRLAKSQGLKVTCEVSPHH 5006
            SVGE M++GR FEEA QKALRMVDE + GFDPY ++ +E  L +PTD+R+ V+A+ALK+G S++++Y LTKID WFL +F  I+     LE+ +T    L K +LL AK LGF D QIA+ V STE+ +R  R + GV+P V QIDTV+AEWP  TNYLYL+Y+ I+HD+ F  G+IMVLGSGVYRIGSSVEFDWCAV CI EL+ M  KTIMVNCNPETVSTDYDMCD L+F+E+S E+V+DI+ +E P+G+I+SMGGQLPNNIAM LHR++  I GTSP  IDNAENRFKFSRMLD++GI QP W+EL D E A  FC+ V +PCLVRPSYVLSGAAMNVA +  DL  YLTQA AV+K+HPVVISKFI +AKEIDVDAVA  G+++  A+SEHVENAG+HSGDATL+TPPQD+NEKTL +I  I   + + L+V+GPFN+QLIAKD+ L VIECN+RVSRSFPFVSKAL ++ IA ATRAIM E   LE   +     KVA+KVP+FSF+RL GADVLLGVEM STGEVA FGEDR EA+LKAQL+ G KIP    NI ISIGS+KHK ELL SV+ L  +GYNL+AS+GTADFY E G+ + AVDW   N + + +    +++T +DY+ ++  DL+INLP RN G  RAS  +T GYK RR+AIDY + L+T+VKCTKL V+ALR+      + +     DC+TS+++ R PGL+D+HVH R+PG + KEDW T TKAA+AGGIT I AMPNT P + +  SF L +K A + AHCDYG+ VGAS DN ++L ++  +A  LKMYLN T++TL++++ + W KHF+++P N P+C HAEG T AAVILLA+L+ R VHICHV+RK+EI +I+ AK  G+ VTCEV+PHH
Sbjct:  764 SVGEAMAIGRKFEEALQKALRMVDEGVNGFDPYHKEPSEEELQNPTDKRIFVVASALKKGYSIEKLYQLTKIDRWFLNRFKVIVDQYTLLEQFQTRPCDLPKQVLLQAKQLGFCDLQIAKCVSSTELVIRHTREQFGVKPWVKQIDTVAAEWPAETNYLYLTYNSIEHDLPFAEGHIMVLGSGVYRIGSSVEFDWCAVNCISELRAMSHKTIMVNCNPETVSTDYDMCDRLYFDEISFETVMDIYDLENPEGIILSMGGQLPNNIAMSLHRQQARILGTSPEFIDNAENRFKFSRMLDNMGISQPMWRELDDLEEAKKFCDTVGFPCLVRPSYVLSGAAMNVAHTHKDLESYLTQASAVSKEHPVVISKFILEAKEIDVDAVACDGEVVCMAISEHVENAGVHSGDATLMTPPQDINEKTLARIKLICCTVGRALEVTGPFNLQLIAKDNQLKVIECNVRVSRSFPFVSKALDHDFIAMATRAIMGE--KLEPVNVLAGCRKVALKVPVFSFSRLRGADVLLGVEMASTGEVAGFGEDRYEAYLKAQLSSGFKIPH--RNILISIGSFKHKNELLPSVKTLEEIGYNLFASMGTADFYTEHGVKIKAVDWPYENISENGNGNGVEQRTIADYLAKNMFDLVINLPMRNGGTYRASSFVTQGYKTRRMAIDYSVPLITDVKCTKLLVEALRRLREAPPLKI---QYDCMTSRRVVRLPGLIDVHVHVREPGAIQKEDWQTATKAALAGGITMILAMPNTQPAVVDQASFALVQKIAKNAAHCDYGINVGASKDNAQTLVQIGAKAGALKMYLNETYTTLKLDSMADWQKHFENWPANLPLCVHAEGTTTAAVILLAELYQRPVHICHVARKEEIMIIKAAKDVGIPVTCEVAPHH 1650          

HSP 2 Score: 916.761 bits (2368), Expect = 0.000e+0
Identity = 487/773 (63.00%), Postives = 587/773 (75.94%), Query Frame = 2
Query:   38 KGALILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITG-VIVPIKDKLLINPLNNPELFIDPNERNLVEEVSINEIRHYNKNGNIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNADEYDALFISNGPGDPVKCTETIETIKNWITSE--KPFMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVTAVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKP--KKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
            K  L L D + + G LFG      GEVVFQTGMVGY ESL+DPSY SQ+L+LTYP+IG+YG+   K  D+ GLP  FESAKIHA+ LI+   S +YS+W A  +LS WL +  +  I GIDTR LTK++R+ G++ G VI+   D  ++        F DPN  +LVE+VSI E   YN+ GN+ +  IDCG+K NQ+RC  + G  V V+P+N  V  DEYD LFISNGPGDP+ CT+TI  +K  I     KP  GICLGHQLL+LAIG KT+KMKYGNRGHNQPCTHL T RCF+T+QNHGFAV A ++PD W  LF NEND++NEG+IH   PF SVQFHPEH +GP D+E LF VF+E V AVK+  A  S+ + +  +L Y           +    P  +K+L+LGSGGLSIGQAGEFDYSG+QA+KAL EEGIQ +L+NPNIATVQT+  +ADK Y LPIT DYVT+VIK ERPDGV LTFGGQTALNCG EL + GVF+ Y V VLGT + +I+ TEDR+ F++ + EI E+V PS AAYTV+  I+AA+++GYPVM+RAA+ALGGL SGFA N  EL  LA+ AF HTSQVL+DKSL+GWKE+EYEVVRD Y+NCITVCNMENVDPLGIHTGES+VVAPSQTL+N EY MLR  A+KVVR+LG+VGECNIQYA++P SH++YIIEVNARLSRSSALASKATGYPLAYVAAKL LG  L  LRNSVT  TTACFEPS+DYCVVKIPRWDL+KF++V  KI SSM
Sbjct:    9 KATLFLEDGSRFSGQLFGHPVSVAGEVVFQTGMVGYPESLTDPSYKSQILILTYPLIGNYGIPSQKK-DKNGLPLWFESAKIHASALIIGALSDDYSHWNAVRSLSDWLAEESIPAICGIDTRALTKRIRDKGTMLGKVILEGTDPSIL-------AFSDPNREHLVEQVSIKEPVVYNQEGNLKIVAIDCGMKYNQVRCLTQRGVSVKVVPWNYPVKPDEYDGLFISNGPGDPMLCTDTINNLKQLIDDPRCKPIFGICLGHQLLSLAIGAKTYKMKYGNRGHNQPCTHLDTSRCFITTQNHGFAVDAKTLPDGWSPLFINENDQTNEGVIHHTKPFFSVQFHPEHTAGPEDLEFLFDVFVEQVRAVKAGHAKFSIRESIRQKLNY-----------VCNPMPPCRKVLLLGSGGLSIGQAGEFDYSGSQAIKALTEEGIQIILINPNIATVQTSKWLADKVYFLPITADYVTDVIKNERPDGVLLTFGGQTALNCGFELTKLGVFEKYGVKVLGTQVHSIERTEDRKIFADNMAEINEQVPPSEAAYTVEAAIEAADRIGYPVMLRAAYALGGLCSGFATNGDELQALANTAFKHTSQVLIDKSLKGWKEVEYEVVRDAYNNCITVCNMENVDPLGIHTGESIVVAPSQTLTNKEYNMLRTTAIKVVRHLGIVGECNIQYAVNPESHEFYIIEVNARLSRSSALASKATGYPLAYVAAKLALGKPLPELRNSVTNSTTACFEPSLDYCVVKIPRWDLSKFSRVSTKIGSSM 762          

HSP 3 Score: 130.568 bits (327), Expect = 2.478e-26
Identity = 107/391 (27.37%), Postives = 178/391 (45.52%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHR----EK--IPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAV--AYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDN--LLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPF---------SLECEFLRGEP--NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            +++LGSG   IG + EFD+   + IK L     + I++N N  TV T   + D ++F  ++ + V D+   E+PDGV+++ GGQ   N    L +    EK  + + GT    I+  E+R  F+  +  I    P  +     E+AI   + + YP ++R +Y L G     A +  +L        A      V+I K ++  KE++ + V  AY   +    + E+V+  GIH+G++ +V P Q +  K    +     ++ + L + G  N+Q     ++    +IE N R+SRS    SKA GY +   A +  + +P          S    F   EP  +   VK+P +  ++       +G  M S GE    G    EA  KA
Sbjct:  398 VLLLGSGGLSIGQAGEFDYSGSQAIKALTEEGIQIILINPNIATVQTSKWLADKVYFLPITADYVTDVIKNERPDGVLLTFGGQTALNCGFELTKLGVFEKYGVKVLGTQVHSIERTEDRKIFADNMAEINEQVPPSEAAYTVEAAIEAADRIGYPVMLRAAYALGGLCSGFATNGDELQALAN--TAFKHTSQVLIDKSLKGWKEVEYEVVRDAYNNCITVCNM-ENVDPLGIHTGESIVVAPSQTLTNKEYNMLRTTAIKVVRHLGIVGECNIQYAVNPESHEFYIIEVNARLSRSSALASKATGYPLAYVAAKLALGKPLPELRNSVTNSTTACF---EPSLDYCVVKIPRWDLSKFSRVSTKIGSSMKSVGEAMAIGRKFEEALQKA 782          

HSP 4 Score: 87.8113 bits (216), Expect = 2.714e-13
Identity = 73/277 (26.35%), Postives = 131/277 (47.29%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQ--VLVDKSLRGWKEIEYEVVR-DVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVN 2113
            EFD+     +  LR    +T++VN N  TV T   + D+ Y   I+ + V ++  +E P+G+ L+ GGQ   N  + L         +  +LGTS E I   E+R +FS +L+ +            ++E     + +G+P ++R ++ L G     A+   +L    + A A + +  V++ K +   KEI+ + V  D    C+ +   E+V+  G+H+G++ ++ P Q ++      ++     V R L V G  N+Q     N  K  +IE N
Sbjct:  955 EFDWCAVNCISELRAMSHKTIMVNCNPETVSTDYDMCDRLYFDEISFETVMDIYDLENPEGIILSMGGQLPNNIAMSLHRQ------QARILGTSPEFIDNAENRFKFSRMLDNMGISQPMWRELDDLEEAKKFCDTVGFPCLVRPSYVLSGAAMNVAHTHKDLESYLTQASAVSKEHPVVISKFILEAKEIDVDAVACDGEVVCMAIS--EHVENAGVHSGDATLMTPPQDINEKTLARIKLICCTVGRALEVTGPFNLQLIAKDNQLK--VIECN 1221          
BLAST of Carbamoyl-phosphate synthase large chain vs. TrEMBL
Match: A0A0L8FLC1 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22015397mg PE=3 SV=1)

HSP 1 Score: 1087.79 bits (2812), Expect = 0.000e+0
Identity = 544/894 (60.85%), Postives = 686/894 (76.73%), Query Frame = 3
Query: 2346 SVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYVEKFTESGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKIIKCLNELEEPRTY---LSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDWDTGNQASSDS----KKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQALRKAIYKKKICVASPTIDCITSQKIYRFPGLVDIHVHTRDPGQVHKEDWSTVTKXXXXXXXXXXFAMPNTAPPITNLESFELAKKRASSLAHCDYGLYVGASNDNWESLAELAPEAIGLKMYLNPTFSTLQMNNFSTWAKHFKHFPENRPICCHAEGETMAAVILLAQLHNRHVHICHVSRKQEIELIRLAKSQGLKVTCEVSPHH 5006
            SVGE M++GR FEEA QKALRMVDE + GFDPY ++ +E  L +PTD+R+ V+A+ALK+G S++++Y LTKID WFL +F  I+     LE+ +T    L K +LL AK LGF D QIA+ V STE+ +R  R + GV+P V QIDTV+AEWP  TNYLYL+Y+ I+HD+ F  G+IMVLGSGVYRIGSSVEFDWCAV CI EL+ M  KTIMVNCNPETVSTDYDMCD L+F+E+S E+V+DI+ +E P+G+I+SMGGQLPNNIAM LHR++  I GTSP  IDNAENRFKFSRMLD++GI QP W+EL D E A  FC+ V +PCLVRPSYVLSGAAMNVA +  DL  YLTQA AV+K+HPVVISKFI +AKEIDVDAVA  G+++  A+SEHVENAG+HSGDATL+TPPQD+NEKTL +I  I   + + L+V+GPFN+QLIAKD+ L VIECN+RVSRSFPFVSKAL ++ IA ATRAIM E   LE   +     KVA+KVP+FSF+RL GADVLLGVEM STGEVA FGEDR EA+LKAQL+ G KIP    NI ISIGS+KHK ELL SV+ L  +GYNL+AS+GTADFY E G+ + AVDW   N + + +    +++T +DY+ ++  DL+INLP RN G  RAS  +T GYK RR+AIDY + L+T+VKCTKL V+ALR+      + +     DC+TS+++ R PGL+D+HVH R+PG + KEDW T TKAA+AGGIT I AMPNT P + +  SF L +K A + AHCDYG+ VGAS DN ++L ++  +A  LKMYLN T++TL++++ + W KHF+++P N P+C HAEG T AAVILLA+L+ R VHICHV+RK+EI +I+ AK  G+ VTCEV+PHH
Sbjct:  764 SVGEAMAIGRKFEEALQKALRMVDEGVNGFDPYHKEPSEEELQNPTDKRIFVVASALKKGYSIEKLYQLTKIDRWFLNRFKVIVDQYTLLEQFQTRPCDLPKQVLLQAKQLGFCDLQIAKCVSSTELVIRHTREQFGVKPWVKQIDTVAAEWPAETNYLYLTYNSIEHDLPFAEGHIMVLGSGVYRIGSSVEFDWCAVNCISELRAMSHKTIMVNCNPETVSTDYDMCDRLYFDEISFETVMDIYDLENPEGIILSMGGQLPNNIAMSLHRQQARILGTSPEFIDNAENRFKFSRMLDNMGISQPMWRELDDLEEAKKFCDTVGFPCLVRPSYVLSGAAMNVAHTHKDLESYLTQASAVSKEHPVVISKFILEAKEIDVDAVACDGEVVCMAISEHVENAGVHSGDATLMTPPQDINEKTLARIKLICCTVGRALEVTGPFNLQLIAKDNQLKVIECNVRVSRSFPFVSKALDHDFIAMATRAIMGE--KLEPVNVLAGCRKVALKVPVFSFSRLRGADVLLGVEMASTGEVAGFGEDRYEAYLKAQLSSGFKIPH--RNILISIGSFKHKNELLPSVKTLEEIGYNLFASMGTADFYTEHGVKIKAVDWPYENISENGNGNGVEQRTIADYLAKNMFDLVINLPMRNGGTYRASSFVTQGYKTRRMAIDYSVPLITDVKCTKLLVEALRRLREAPPLKI---QYDCMTSRRVVRLPGLIDVHVHVREPGAIQKEDWQTATKAALAGGITMILAMPNTQPAVVDQASFALVQKIAKNAAHCDYGINVGASKDNAQTLVQIGAKAGALKMYLNETYTTLKLDSMADWQKHFENWPANLPLCVHAEGTTTAAVILLAELYQRPVHICHVARKEEIMIIKAAKDVGIPVTCEVAPHH 1650          

HSP 2 Score: 916.376 bits (2367), Expect = 0.000e+0
Identity = 487/773 (63.00%), Postives = 587/773 (75.94%), Query Frame = 2
Query:   38 KGALILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITG-VIVPIKDKLLINPLNNPELFIDPNERNLVEEVSINEIRHYNKNGNIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNADEYDALFISNGPGDPVKCTETIETIKNWITSE--KPFMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVTAVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKP--KKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
            K  L L D + + G LFG      GEVVFQTGMVGY ESL+DPSY SQ+L+LTYP+IG+YG+   K  D+ GLP  FESAKIHA+ LI+   S +YS+W A  +LS WL +  +  I GIDTR LTK++R+ G++ G VI+   D  ++        F DPN  +LVE+VSI E   YN+ GN+ +  IDCG+K NQ+RC  + G  V V+P+N  V  DEYD LFISNGPGDP+ CT+TI  +K  I     KP  GICLGHQLL+LAIG KT+KMKYGNRGHNQPCTHL T RCF+T+QNHGFAV A ++PD W  LF NEND++NEG+IH   PF SVQFHPEH +GP D+E LF VF+E V AVK+  A  S+ + +  +L Y           +    P  +K+L+LGSGGLSIGQAGEFDYSG+QA+KAL EEGIQ +L+NPNIATVQT+  +ADK Y LPIT DYVT+VIK ERPDGV LTFGGQTALNCG EL + GVF+ Y V VLGT + +I+ TEDR+ F++ + EI E+V PS AAYTV+  I+AA+++GYPVM+RAA+ALGGL SGFA N  EL  LA+ AF HTSQVL+DKSL+GWKE+EYEVVRD Y+NCITVCNMENVDPLGIHTGES+VVAPSQTL+N EY MLR  A+KVVR+LG+VGECNIQYA++P SH++YIIEVNARLSRSSALASKATGYPLAYVAAKL LG  L  LRNSVT  TTACFEPS+DYCVVKIPRWDL+KF++V  KI SSM
Sbjct:    9 KATLFLEDGSRFSGQLFGHPVSVAGEVVFQTGMVGYPESLTDPSYKSQILILTYPLIGNYGIPSQKK-DKNGLPLWFESAKIHASALIIGALSDDYSHWNAVRSLSDWLAEESIPAICGIDTRALTKRIRDKGTMLGKVILEGTDPSIL-------AFSDPNREHLVEQVSIKEPVVYNQEGNLKIVAIDCGMKYNQVRCLTQRGVSVKVVPWNYPVKPDEYDGLFISNGPGDPMLCTDTINNLKQLIDDPRCKPIFGICLGHQLLSLAIGAKTYKMKYGNRGHNQPCTHLDTSRCFITTQNHGFAVDAKTLPDGWSPLFINENDQTNEGVIHHTKPFFSVQFHPEHTAGPEDLEFLFDVFVEQVRAVKAGHAKFSIRESIRQKLNY-----------VCNPMPPCRKVLLLGSGGLSIGQAGEFDYSGSQAIKALTEEGIQIILINPNIATVQTSKWLADKVYFLPITADYVTDVIKNERPDGVLLTFGGQTALNCGFELTKLGVFEKYGVKVLGTQVHSIERTEDRKIFADNMAEINEQVPPSEAAYTVEAAIEAADRIGYPVMLRAAYALGGLCSGFATNGDELQALANTAFKHTSQVLIDKSLKGWKEVEYEVVRDAYNNCITVCNMENVDPLGIHTGESIVVAPSQTLTNKEYNMLRTTAIKVVRHLGIVGECNIQYAVNPESHEFYIIEVNARLSRSSALASKATGYPLAYVAAKLALGKPLPELRNSVTNSTTACFEPSLDYCVVKIPRWDLSKFSRVSTKIGSSM 762          

HSP 3 Score: 130.568 bits (327), Expect = 2.691e-26
Identity = 107/391 (27.37%), Postives = 178/391 (45.52%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHR----EK--IPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAV--AYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDN--LLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPF---------SLECEFLRGEP--NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            +++LGSG   IG + EFD+   + IK L     + I++N N  TV T   + D ++F  ++ + V D+   E+PDGV+++ GGQ   N    L +    EK  + + GT    I+  E+R  F+  +  I    P  +     E+AI   + + YP ++R +Y L G     A +  +L        A      V+I K ++  KE++ + V  AY   +    + E+V+  GIH+G++ +V P Q +  K    +     ++ + L + G  N+Q     ++    +IE N R+SRS    SKA GY +   A +  + +P          S    F   EP  +   VK+P +  ++       +G  M S GE    G    EA  KA
Sbjct:  398 VLLLGSGGLSIGQAGEFDYSGSQAIKALTEEGIQIILINPNIATVQTSKWLADKVYFLPITADYVTDVIKNERPDGVLLTFGGQTALNCGFELTKLGVFEKYGVKVLGTQVHSIERTEDRKIFADNMAEINEQVPPSEAAYTVEAAIEAADRIGYPVMLRAAYALGGLCSGFATNGDELQALAN--TAFKHTSQVLIDKSLKGWKEVEYEVVRDAYNNCITVCNM-ENVDPLGIHTGESIVVAPSQTLTNKEYNMLRTTAIKVVRHLGIVGECNIQYAVNPESHEFYIIEVNARLSRSSALASKATGYPLAYVAAKLALGKPLPELRNSVTNSTTACF---EPSLDYCVVKIPRWDLSKFSRVSTKIGSSMKSVGEAMAIGRKFEEALQKA 782          

HSP 4 Score: 87.4261 bits (215), Expect = 3.077e-13
Identity = 73/277 (26.35%), Postives = 131/277 (47.29%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQ--VLVDKSLRGWKEIEYEVVR-DVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVN 2113
            EFD+     +  LR    +T++VN N  TV T   + D+ Y   I+ + V ++  +E P+G+ L+ GGQ   N  + L         +  +LGTS E I   E+R +FS +L+ +            ++E     + +G+P ++R ++ L G     A+   +L    + A A + +  V++ K +   KEI+ + V  D    C+ +   E+V+  G+H+G++ ++ P Q ++      ++     V R L V G  N+Q     N  K  +IE N
Sbjct:  955 EFDWCAVNCISELRAMSHKTIMVNCNPETVSTDYDMCDRLYFDEISFETVMDIYDLENPEGIILSMGGQLPNNIAMSLHRQ------QARILGTSPEFIDNAENRFKFSRMLDNMGISQPMWRELDDLEEAKKFCDTVGFPCLVRPSYVLSGAAMNVAHTHKDLESYLTQASAVSKEHPVVISKFILEAKEIDVDAVACDGEVVCMAIS--EHVENAGVHSGDATLMTPPQDINEKTLARIKLICCTVGRALEVTGPFNLQLIAKDNQLK--VIECN 1221          
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Cavefish
Match: cad (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:ZFIN;Acc:ZDB-GENE-021030-4])

HSP 1 Score: 1053.12 bits (2722), Expect = 0.000e+0
Identity = 533/895 (59.55%), Postives = 682/895 (76.20%), Query Frame = 3
Query: 2346 SVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYVEKFTESGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKII---KCLNELEEPRTYLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDWDTGNQASSDSKKK--TFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQALRKAIYKKKICVASPT---IDCITSQKIYRFPGLVDIHVHTRDPGQVHKEDWSTVTKXXXXXXXXXXFAMPNTAPPITNLESFELAKKRASSLAHCDYGLYVGASNDNWESLAELAPEAIGLKMYLNPTFSTLQMNNFSTWAKHFKHFPENRPICCHAEGETMAAVILLAQLHNRHVHICHVSRKQEIELIRLAKSQGLKVTCEVSPHH 5006
            SVGE+M++GR FEEAFQKALRMVDE   GFD  ++  +E  L  PTD+R+ VLA AL  G SV  +Y+LTKID WFL+K   I+   K L    +  + +  +++  AK LGFSD QIA AV+STE+AVR+LR    + P+V QIDTV+AEWP +TNYLYL+Y G + D++FE  ++MV+GSGVYRIGSSVEFDWCAV CI EL++M  KTIMVN NPETVSTDYDMC+ L+F+E+S E V+DI+ +E P+G+I+SMGGQLPNNIAM LHR++  I GTSP  ID+AENRFKFSRMLD+IGI QP+WKEL+D+ESA++FC  V YPCLVRPSYVLSGAAMNVA+++SDL +YL+ AVAV+K+HPVVISKFI++AKEIDVDAVA  G ++  A+SEHVENAG+HSGDATLVTP QD+N KT+++I  I+  I QEL+V+GPFN+QLIAKDD L VIECN+RVSRSFPFVSK LG +++A AT+ IM E   +E   L      V VKVP FSF+RL GADV+LGVEM STGEVACFGE+R EA+LKA L+ G KIP+   N+ +SIGSYK+K ELL +V+ L SLGYNLYASLGTADFY E G+ V AVDW    ++ S +K K     DY+ E+  D++INL  RNSG RR S  +T GY+ RR+A+DY + L+ ++KCTKLFVQALR      +I  A P    +D +TSQK+ R PGL+D+HVH R+PG  +KED+S+ T AA+AGGIT +  MPNT P + +  S    +K A +    DY LYVGA++DN   L  +A EA+GLKMYLN T+STL+M N S W +HF+ +P++ PI  HAE +T+AA++++AQL+ R VHICHV++K+EI +IR AK +G++VTCEV+PHH
Sbjct:  763 SVGEVMAIGRSFEEAFQKALRMVDENCVGFDHTIKPVSEQELQIPTDKRIFVLAAALHAGYSVDHLYELTKIDRWFLHKMQNIVNHEKLLQTYNQDESLMPPEVMRKAKQLGFSDKQIALAVQSTELAVRKLRRNWNILPVVKQIDTVAAEWPAHTNYLYLTYHGTEWDLSFEESHVMVIGSGVYRIGSSVEFDWCAVGCIMELRKMGYKTIMVNYNPETVSTDYDMCNRLYFDEISFEVVMDIYEMENPEGIILSMGGQLPNNIAMSLHRQQCRILGTSPEFIDSAENRFKFSRMLDTIGISQPRWKELSDTESAMHFCETVGYPCLVRPSYVLSGAAMNVAYTDSDLEKYLSSAVAVSKEHPVVISKFIQEAKEIDVDAVACDGVVIAIAISEHVENAGVHSGDATLVTPAQDINHKTMERIKSIVHAIGQELQVTGPFNLQLIAKDDQLKVIECNVRVSRSFPFVSKTLGVDLVALATQVIMGE--EVEPVGLMKGKGVVGVKVPQFSFSRLAGADVVLGVEMTSTGEVACFGENRYEAYLKAMLSTGFKIPK--KNVLLSIGSYKNKTELLPTVQALESLGYNLYASLGTADFYTEHGVKVMAVDWPFEEESDSPNKDKQRNIMDYLEENHFDMVINLSMRNSGGRRLSSFVTKGYRTRRMAVDYSVPLIIDIKCTKLFVQALR------QIGQAPPLKTHVDSMTSQKLIRLPGLIDVHVHLREPGATYKEDFSSGTAAALAGGITMVCVMPNTNPAVIDQSSLASVQKLARAGCRSDYALYVGAASDNAAVLPLIANEAVGLKMYLNDTYSTLKMENVSLWMEHFEKWPKHLPIVAHAENQTVAAILMVAQLYQRPVHICHVAKKEEILIIRAAKQKGIQVTCEVAPHH 1647          

HSP 2 Score: 909.442 bits (2349), Expect = 0.000e+0
Identity = 479/774 (61.89%), Postives = 597/774 (77.13%), Query Frame = 2
Query:   41 GALILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLI--NPLNNPELFIDPNERNLVEEVSINEIRHYNKNGNIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNADEYDALFISNGPGDPVKCTETIETIKNWITSE--KPFMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVTAVKSNTATVS---LDQRLTNRLTYQHTQHELTLTALLENKPKKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
             +L+L D T + G LFGA     GEVVFQTGMVGY E+L+DPSY SQ+L LTYP+IG+YGV  D+   ++G+ K FES++IHAT LIV E S   S+W++  +L QWL++ G+ G+ G+DTR LTKK+RE G++ G       KL++   P  N  LF +P+ RNLV+EVS+ + R YN +GN+ +  +DCG+K NQIRC C+ GA+VT++P++  ++  ++D LFISNGPGDP  C +TIE ++  +  E  KP  GICLGHQLL+L IG +T+KMKYGNRGHNQPC H  T RCF+TSQNHGFAV   ++P +W  LF N ND ++EGIIH   P  SVQFHPEHM+GP D+  LF VF++ V   K  TA  S   + +RLT  L +  +            +P+K+LILGSGGLSIGQAGEFDYSG+QA+KAL+EE IQT+L+NPNIATVQT+ G+ADK Y LPIT +YVT+VIK ERPDGV LTFGGQTALNCG+EL + GV + Y V VLGT + +I+MTEDR+ F E +EEI E VAPS AA +V++ + AAE+LGYPV+IR+AFALGGLGSGFAN+  EL+ L + +FAHTSQVLVDKSL+GWKEIEYEVVRD +DNCITVCNMEN+DPLGIHTGES+VVAPSQTL++YEY MLR  A+KV+R+LG+VGECNIQYAL+P S +YYIIEVNARLSRSSALASKATGYPLAYVAAKLGLG+ L  L+NSVT  TTA FEPS+DYCVVK+PRWDL+KF +V  KI SSM
Sbjct:    2 ASLVLEDGTTFKGRLFGASASVSGEVVFQTGMVGYPEALTDPSYKSQILTLTYPLIGNYGVPSDED-GEFGISKWFESSRIHATALIVGELSQNPSHWSSVKSLDQWLKEQGIPGLEGVDTRCLTKKIREKGTMLG-------KLVVEGTPAENI-LFDNPDSRNLVKEVSVKKPRVYNPDGNLRILAVDCGIKYNQIRCLCQRGAQVTLVPWDYPLDVCDFDGLFISNGPGDPQHCKKTIENLRKIVCVENPKPVFGICLGHQLLSLVIGAETYKMKYGNRGHNQPCVHKGTGRCFITSQNHGFAVDPKTLPKDWDVLFTNSNDHTSEGIIHHHKPLFSVQFHPEHMAGPADLVSLFDVFLDAVRDFKMGTANKSGKVVKERLTRHLAFHKSPKSEEFV-----RPRKVLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTILINPNIATVQTSKGLADKVYFLPITPEYVTQVIKNERPDGVLLTFGGQTALNCGVELTKQGVLEKYNVRVLGTQVSSIEMTEDRKIFVEKMEEINEHVAPSEAAMSVEQAVAAAERLGYPVLIRSAFALGGLGSGFANSKEELITLVTQSFAHTSQVLVDKSLKGWKEIEYEVVRDAFDNCITVCNMENIDPLGIHTGESIVVAPSQTLNDYEYNMLRNTAIKVIRHLGIVGECNIQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLGLGIPLPDLKNSVTNSTTANFEPSLDYCVVKVPRWDLSKFLRVSTKIGSSM 761          

HSP 3 Score: 139.428 bits (350), Expect = 1.959e-32
Identity = 108/390 (27.69%), Postives = 181/390 (46.41%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHRE------KIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYG-GKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQ--LIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPF---------SLECEFLRGEP--NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            +++LGSG   IG + EFD+   + IK L+    +TI++N N  TV T   + D ++F  ++ E V  +   E+PDGV+++ GGQ   N  + L ++       + + GT    I+  E+R  F   ++ I       +     E A+     + YP L+R ++ L G     A S+ +L   +TQ+ A      V++ K ++  KEI+ + V       +     E+++  GIH+G++ +V P Q +N+     +     ++ + L + G  N+Q  L  + +   +IE N R+SRS    SKA GY +   A +  +  P          S    F   EP  +   VKVP +  ++       +G  M S GEV   G    EAF KA
Sbjct:  397 VLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTILINPNIATVQTSKGLADKVYFLPITPEYVTQVIKNERPDGVLLTFGGQTALNCGVELTKQGVLEKYNVRVLGTQVSSIEMTEDRKIFVEKMEEINEHVAPSEAAMSVEQAVAAAERLGYPVLIRSAFALGGLGSGFANSKEELITLVTQSFAHTSQ--VLVDKSLKGWKEIEYEVVRDAFDNCITVCNMENIDPLGIHTGESIVVAPSQTLNDYEYNMLRNTAIKVIRHLGIVGECNIQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLGLGIPLPDLKNSVTNSTTANF---EPSLDYCVVKVPRWDLSKFLRVSTKIGSSMKSVGEVMAIGRSFEEAFQKA 781          

HSP 4 Score: 95.9005 bits (237), Expect = 3.093e-19
Identity = 85/305 (27.87%), Postives = 151/305 (49.51%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQ--VLVDKSLRGWKEIEYEVVRDVYDN-CITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLG 2197
            EFD+     +  LR+ G +T++VN N  TV T   + ++ Y   I+ + V ++ +ME P+G+ L+ GGQ   N  + L         +  +LGTS E I   E+R +FS +L+ I             +  +   E +GYP ++R ++ L G     A   ++L    S+A A + +  V++ K ++  KEI+ + V    D   I +   E+V+  G+H+G++ +V P+Q +++     ++     + + L V G  N+Q  L     +  +IE N R+SRS    SK  G  L  +A ++ +G
Sbjct:  954 EFDWCAVGCIMELRKMGYKTIMVNYNPETVSTDYDMCNRLYFDEISFEVVMDIYEMENPEGIILSMGGQLPNNIAMSLHRQ------QCRILGTSPEFIDSAENRFKFSRMLDTIGISQPRWKELSDTESAMHFCETVGYPCLVRPSYVLSGAAMNVAYTDSDLEKYLSSAVAVSKEHPVVISKFIQEAKEIDVDAV--ACDGVVIAIAISEHVENAGVHSGDATLVTPAQDINHKTMERIKSIVHAIGQELQVTGPFNLQ--LIAKDDQLKVIECNVRVSRSFPFVSKTLGVDLVALATQVIMG 1248          
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Cavefish
Match: cad (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:ZFIN;Acc:ZDB-GENE-021030-4])

HSP 1 Score: 1052.74 bits (2721), Expect = 0.000e+0
Identity = 533/895 (59.55%), Postives = 682/895 (76.20%), Query Frame = 3
Query: 2346 SVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYVEKFTESGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKII---KCLNELEEPRTYLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDWDTGNQASSDSKKK--TFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQALRKAIYKKKICVASPT---IDCITSQKIYRFPGLVDIHVHTRDPGQVHKEDWSTVTKXXXXXXXXXXFAMPNTAPPITNLESFELAKKRASSLAHCDYGLYVGASNDNWESLAELAPEAIGLKMYLNPTFSTLQMNNFSTWAKHFKHFPENRPICCHAEGETMAAVILLAQLHNRHVHICHVSRKQEIELIRLAKSQGLKVTCEVSPHH 5006
            SVGE+M++GR FEEAFQKALRMVDE   GFD  ++  +E  L  PTD+R+ VLA AL  G SV  +Y+LTKID WFL+K   I+   K L    +  + +  +++  AK LGFSD QIA AV+STE+AVR+LR    + P+V QIDTV+AEWP +TNYLYL+Y G + D++FE  ++MV+GSGVYRIGSSVEFDWCAV CI EL++M  KTIMVN NPETVSTDYDMC+ L+F+E+S E V+DI+ +E P+G+I+SMGGQLPNNIAM LHR++  I GTSP  ID+AENRFKFSRMLD+IGI QP+WKEL+D+ESA++FC  V YPCLVRPSYVLSGAAMNVA+++SDL +YL+ AVAV+K+HPVVISKFI++AKEIDVDAVA  G ++  A+SEHVENAG+HSGDATLVTP QD+N KT+++I  I+  I QEL+V+GPFN+QLIAKDD L VIECN+RVSRSFPFVSK LG +++A AT+ IM E   +E   L      V VKVP FSF+RL GADV+LGVEM STGEVACFGE+R EA+LKA L+ G KIP+   N+ +SIGSYK+K ELL +V+ L SLGYNLYASLGTADFY E G+ V AVDW    ++ S +K K     DY+ E+  D++INL  RNSG RR S  +T GY+ RR+A+DY + L+ ++KCTKLFVQALR      +I  A P    +D +TSQK+ R PGL+D+HVH R+PG  +KED+S+ T AA+AGGIT +  MPNT P + +  S    +K A +    DY LYVGA++DN   L  +A EA+GLKMYLN T+STL+M N S W +HF+ +P++ PI  HAE +T+AA++++AQL+ R VHICHV++K+EI +IR AK +G++VTCEV+PHH
Sbjct:  764 SVGEVMAIGRSFEEAFQKALRMVDENCVGFDHTIKPVSEQELQIPTDKRIFVLAAALHAGYSVDHLYELTKIDRWFLHKMQNIVNHEKLLQTYNQDESLMPPEVMRKAKQLGFSDKQIALAVQSTELAVRKLRRNWNILPVVKQIDTVAAEWPAHTNYLYLTYHGTEWDLSFEESHVMVIGSGVYRIGSSVEFDWCAVGCIMELRKMGYKTIMVNYNPETVSTDYDMCNRLYFDEISFEVVMDIYEMENPEGIILSMGGQLPNNIAMSLHRQQCRILGTSPEFIDSAENRFKFSRMLDTIGISQPRWKELSDTESAMHFCETVGYPCLVRPSYVLSGAAMNVAYTDSDLEKYLSSAVAVSKEHPVVISKFIQEAKEIDVDAVACDGVVIAIAISEHVENAGVHSGDATLVTPAQDINHKTMERIKSIVHAIGQELQVTGPFNLQLIAKDDQLKVIECNVRVSRSFPFVSKTLGVDLVALATQVIMGE--EVEPVGLMKGKGVVGVKVPQFSFSRLAGADVVLGVEMTSTGEVACFGENRYEAYLKAMLSTGFKIPK--KNVLLSIGSYKNKTELLPTVQALESLGYNLYASLGTADFYTEHGVKVMAVDWPFEEESDSPNKDKQRNIMDYLEENHFDMVINLSMRNSGGRRLSSFVTKGYRTRRMAVDYSVPLIIDIKCTKLFVQALR------QIGQAPPLKTHVDSMTSQKLIRLPGLIDVHVHLREPGATYKEDFSSGTAAALAGGITMVCVMPNTNPAVIDQSSLASVQKLARAGCRSDYALYVGAASDNAAVLPLIANEAVGLKMYLNDTYSTLKMENVSLWMEHFEKWPKHLPIVAHAENQTVAAILMVAQLYQRPVHICHVAKKEEILIIRAAKQKGIQVTCEVAPHH 1648          

HSP 2 Score: 914.835 bits (2363), Expect = 0.000e+0
Identity = 479/771 (62.13%), Postives = 597/771 (77.43%), Query Frame = 2
Query:   41 GALILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLI--NPLNNPELFIDPNERNLVEEVSINEIRHYNKNGNIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNADEYDALFISNGPGDPVKCTETIETIKNWITSE--KPFMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVTAVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKPKKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
             +L+L D T + G LFGA     GEVVFQTGMVGY E+L+DPSY SQ+L LTYP+IG+YGV  D+   ++G+ K FES++IHAT LIV E S   S+W++  +L QWL++ G+ G+ G+DTR LTKK+RE G++ G       KL++   P  N  LF +P+ RNLV+EVS+ + R YN +GN+ +  +DCG+K NQIRC C+ GA+VT++P++  ++  ++D LFISNGPGDP  C +TIE ++  +  E  KP  GICLGHQLL+L IG +T+KMKYGNRGHNQPC H  T RCF+TSQNHGFAV   ++P +W  LF N ND ++EGIIH   P  SVQFHPEHM+GP D+  LF VF++ V   K  TA  S+ +RLT  L +  +            +P+K+LILGSGGLSIGQAGEFDYSG+QA+KAL+EE IQT+L+NPNIATVQT+ G+ADK Y LPIT +YVT+VIK ERPDGV LTFGGQTALNCG+EL + GV + Y V VLGT + +I+MTEDR+ F E +EEI E VAPS AA +V++ + AAE+LGYPV+IR+AFALGGLGSGFAN+  EL+ L + +FAHTSQVLVDKSL+GWKEIEYEVVRD +DNCITVCNMEN+DPLGIHTGES+VVAPSQTL++YEY MLR  A+KV+R+LG+VGECNIQYAL+P S +YYIIEVNARLSRSSALASKATGYPLAYVAAKLGLG+ L  L+NSVT  TTA FEPS+DYCVVK+PRWDL+KF +V  KI SSM
Sbjct:    6 ASLVLEDGTTFKGRLFGASASVSGEVVFQTGMVGYPEALTDPSYKSQILTLTYPLIGNYGVPSDED-GEFGISKWFESSRIHATALIVGELSQNPSHWSSVKSLDQWLKEQGIPGLEGVDTRCLTKKIREKGTMLG-------KLVVEGTPAENI-LFDNPDSRNLVKEVSVKKPRVYNPDGNLRILAVDCGIKYNQIRCLCQRGAQVTLVPWDYPLDVCDFDGLFISNGPGDPQHCKKTIENLRKIVCVENPKPVFGICLGHQLLSLVIGAETYKMKYGNRGHNQPCVHKGTGRCFITSQNHGFAVDPKTLPKDWDVLFTNSNDHTSEGIIHHHKPLFSVQFHPEHMAGPADLVSLFDVFLDAVRDFKMGTANKSVKERLTRHLAFHKSPKSEEFV-----RPRKVLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTILINPNIATVQTSKGLADKVYFLPITPEYVTQVIKNERPDGVLLTFGGQTALNCGVELTKQGVLEKYNVRVLGTQVSSIEMTEDRKIFVEKMEEINEHVAPSEAAMSVEQAVAAAERLGYPVLIRSAFALGGLGSGFANSKEELITLVTQSFAHTSQVLVDKSLKGWKEIEYEVVRDAFDNCITVCNMENIDPLGIHTGESIVVAPSQTLNDYEYNMLRNTAIKVIRHLGIVGECNIQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLGLGIPLPDLKNSVTNSTTANFEPSLDYCVVKVPRWDLSKFLRVSTKIGSSM 762          

HSP 3 Score: 139.428 bits (350), Expect = 2.236e-32
Identity = 108/390 (27.69%), Postives = 181/390 (46.41%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHRE------KIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYG-GKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQ--LIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPF---------SLECEFLRGEP--NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            +++LGSG   IG + EFD+   + IK L+    +TI++N N  TV T   + D ++F  ++ E V  +   E+PDGV+++ GGQ   N  + L ++       + + GT    I+  E+R  F   ++ I       +     E A+     + YP L+R ++ L G     A S+ +L   +TQ+ A      V++ K ++  KEI+ + V       +     E+++  GIH+G++ +V P Q +N+     +     ++ + L + G  N+Q  L  + +   +IE N R+SRS    SKA GY +   A +  +  P          S    F   EP  +   VKVP +  ++       +G  M S GEV   G    EAF KA
Sbjct:  398 VLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTILINPNIATVQTSKGLADKVYFLPITPEYVTQVIKNERPDGVLLTFGGQTALNCGVELTKQGVLEKYNVRVLGTQVSSIEMTEDRKIFVEKMEEINEHVAPSEAAMSVEQAVAAAERLGYPVLIRSAFALGGLGSGFANSKEELITLVTQSFAHTSQ--VLVDKSLKGWKEIEYEVVRDAFDNCITVCNMENIDPLGIHTGESIVVAPSQTLNDYEYNMLRNTAIKVIRHLGIVGECNIQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLGLGIPLPDLKNSVTNSTTANF---EPSLDYCVVKVPRWDLSKFLRVSTKIGSSMKSVGEVMAIGRSFEEAFQKA 782          

HSP 4 Score: 95.9005 bits (237), Expect = 3.104e-19
Identity = 85/305 (27.87%), Postives = 151/305 (49.51%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQ--VLVDKSLRGWKEIEYEVVRDVYDN-CITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLG 2197
            EFD+     +  LR+ G +T++VN N  TV T   + ++ Y   I+ + V ++ +ME P+G+ L+ GGQ   N  + L         +  +LGTS E I   E+R +FS +L+ I             +  +   E +GYP ++R ++ L G     A   ++L    S+A A + +  V++ K ++  KEI+ + V    D   I +   E+V+  G+H+G++ +V P+Q +++     ++     + + L V G  N+Q  L     +  +IE N R+SRS    SK  G  L  +A ++ +G
Sbjct:  955 EFDWCAVGCIMELRKMGYKTIMVNYNPETVSTDYDMCNRLYFDEISFEVVMDIYEMENPEGIILSMGGQLPNNIAMSLHRQ------QCRILGTSPEFIDSAENRFKFSRMLDTIGISQPRWKELSDTESAMHFCETVGYPCLVRPSYVLSGAAMNVAYTDSDLEKYLSSAVAVSKEHPVVISKFIQEAKEIDVDAV--ACDGVVIAIAISEHVENAGVHSGDATLVTPAQDINHKTMERIKSIVHAIGQELQVTGPFNLQ--LIAKDDQLKVIECNVRVSRSFPFVSKTLGVDLVALATQVIMG 1249          
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Cavefish
Match: cps1 (carbamoyl-phosphate synthase 1 [Source:NCBI gene;Acc:103026142])

HSP 1 Score: 754.977 bits (1948), Expect = 0.000e+0
Identity = 409/778 (52.57%), Postives = 546/778 (70.18%), Query Frame = 2
Query:   47 LILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLINPLNNPELFIDPNERNLVEEVSINEIRHYNKNGNIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNADEYDALFISNGPGDPVKCTETIETIKNWITSEKP--FMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVTAVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKP--------KKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTT-MGV--ADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
            L+L D TV  G  FG  +   GE+VF TG+VGY E+L+DPSY  Q+L LTYPI+G+YGV + + LD+ GL K+ ES +I  +GL+V +YS E+S+W +  +L QWL++  V  + G+DTR LTK +R+ G++ G I     +    P++     I+PNERNLV EVS  E + + K   I V  +DCG+K+N IR   K GA V ++P+N  + + EYD LFISNGPGDP      I+ ++  + S++P    GIC+G+Q+ ALA G +++K+  GNRG NQP  ++ T + F+T+QNHG+ + + S+P  W  LF N ND +NEGI+H   P  + QFHPE   GPTD E LF  F+  +   K                       + ++ +++  KP         K+L+LGSGGLSIGQAGEFDYSG+QA+KA++EE ++TVL+NPNIA+VQT  +G   AD  Y LP+T  +VTEVIK ERPDG+ L+ GGQTALNCG+EL  SGV + Y V VLGT +E+I  TEDRQ F++ L EI E++APS+A  +V + + AAE++GYPVM+R+A+ALGGLGSG   +  +L + A  A A +SQ+LV+KSL GWKE+EYEVVRDV DNC+TVCNMEN DPLGIHTG+S+VVAPSQTLSN EY+MLR+ A+KVVR+LG+VGECNIQYAL P+S +Y IIEVNARLSRSSALASKATGYPLA+VAAKL LG+ L  ++N+V+  TTACFEPS+DY V KIPRWDL++F  +  +I S+M
Sbjct:   32 LVLEDGTVMKGYSFGHRQSSAGELVFNTGLVGYPEALTDPSYRGQILTLTYPIVGNYGVPNTQELDELGLRKNVESDRIQVSGLLVQDYSHEFSHWNSVKSLGQWLQEEKVPALYGVDTRMLTKIIRDKGTVLGKI-----EFEGQPVD----IINPNERNLVAEVSTKETQVFGKGNPIKVVAVDCGIKHNIIRLLVKRGAEVHLVPWNHDLMSLEYDGLFISNGPGDPSLAETLIQNVRKVLESDRPQPVFGICMGNQITALAAGAQSYKLPMGNRGQNQPVLNVMTGQAFITAQNHGYGIDSESLPPGWSPLFVNANDGTNEGIMHNNKPIFTAQFHPEAKGGPTDTEFLFDSFLSLIKKGK-----------------------DASIVSVMPKKPVLPQRAQVSKVLVLGSGGLSIGQAGEFDYSGSQAVKAMKEENLKTVLMNPNIASVQTNEVGTKQADSVYFLPVTPQFVTEVIKTERPDGILLSMGGQTALNCGVELFRSGVLQKYGVKVLGTPVESIMATEDRQLFADKLMEINEKIAPSIAVESVADALKAAEEIGYPVMLRSAYALGGLGSGLCADQQKLEETAHKALAMSSQILVEKSLLGWKEVEYEVVRDVADNCVTVCNMENFDPLGIHTGDSIVVAPSQTLSNEEYHMLRETAIKVVRHLGIVGECNIQYALHPSSLEYCIIEVNARLSRSSALASKATGYPLAFVAAKLALGIPLPEIKNAVSEKTTACFEPSLDYIVTKIPRWDLDRFQGMSREIGSAM 777          

HSP 2 Score: 598.586 bits (1542), Expect = 0.000e+0
Identity = 322/700 (46.00%), Postives = 453/700 (64.71%), Query Frame = 3
Query: 2346 SVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYV---EKFTES-----GLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKIIKCLNELEE-PRTYLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPF------SLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDW--DTGNQASSDSKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQALR 4394
            SVGE+M+VGR FEE+ QKALRM    + GF P +     ++E       L+ P+  R+  LA AL  GV+V +I+ LT ID WFL+K  +I +    L +   + +  D+LL AK  GFSD Q+ +A+ S+E   R LR    ++P V QIDT++AE+P  TNYLY +Y G +HD+ F    +MVLG G Y IGSSVEFDWCAV  I+ L++M K+T++VN NPETVSTD+D CD L+FEEL+LE +LDI   E   G IVS+GGQ+PNN+A+ LH+  + I GTSP+ ID AE R  FS +LD +G+ Q  W+ L+  E A  F N V YPCL+RPSYVLSG+AMNVA+ E ++  +L +A  V+++HPVVI+KFI  A+E++VDAVA  GK+L  A++EHVE+AG+HSGDATL+ P Q +++  L+K+     +IA+  ++SGPFN Q + K ++++VIECNLR SRSFPFVSK +G + I  ATR ++ EP       +LE   +    + V +K PMFS+ RL  AD +L  EM STGEVACFG +   AFLKA L+ G K+P+ G  I I I  +  + + L +  QL   G+ LYA+  T+ +   + +S   V W    G + +  S  +  SD      +DL++NLP  N+   + + +I      RR+A+DYG+ L+TN +  KLFV+A++
Sbjct:  779 SVGEVMAVGRTFEESIQKALRMCHPSVDGFVPRLPLKRAWSEQCDLRQELAVPSSTRIFSLAKALHDGVTVDQIHQLTAIDKWFLHKLRRITELEKHLSQYDSSTVPGDVLLKAKQEGFSDRQVGQALGSSEGEARALRHSRNIQPWVKQIDTLAAEYPAVTNYLYCTYHGQEHDLDFRDQGVMVLGCGPYHIGSSVEFDWCAVSSIRTLRQMGKRTVVVNHNPETVSTDFDECDRLYFEELTLERILDITQQESCTGCIVSVGGQIPNNLAVPLHQNGVRILGTSPLQIDRAEERSVFSTILDDLGVSQAPWRALSSLEDAFAFANKVGYPCLLRPSYVLSGSAMNVAYGEEEMKRFLEEAAQVSQEHPVVITKFIRGAREVEVDAVAKAGKVLVHAITEHVEDAGVHSGDATLMLPTQTISQGALEKVKTATRKIAKAFEISGPFNTQFLVKGNDVMVIECNLRASRSFPFVSKTIGVDFINVATRVMVGEPVNESQLPTLENPII--PVDYVGIKAPMFSWPRLRDADPVLRCEMASTGEVACFGPNIYSAFLKAMLSTGFKLPQKG--ILIGI-QHSFRPDFLSTAHQLQEEGFKLYATEATSAWLNANDVSTTPVAWPRHEGKETTLPSISRLLSD----GHIDLVVNLPNNNTKFLKDNFLI------RRMAVDYGVPLITNFQVVKLFVEAIK 1463          

HSP 3 Score: 124.405 bits (311), Expect = 6.872e-28
Identity = 100/390 (25.64%), Postives = 177/390 (45.38%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTD---YDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHRE------KIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVA-YGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNL--LVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFS------LECEFLRGEP--NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            ++VLGSG   IG + EFD+   + +K ++    KT+++N N  +V T+       D ++F  ++ + V ++   E+PDG+++SMGGQ   N  + L R        + + GT    I   E+R  F+  L  I         +     A+    ++ YP ++R +Y L G    +   +  L E   +A+A++    +++ K +   KE++ + V       +     E+ +  GIH+GD+ +V P Q ++ +    + +   ++ + L + G  N+Q      +L   +IE N R+SRS    SKA GY +   A +  +  P         E      EP  + +  K+P +   R  G    +G  M S GEV   G    E+  KA
Sbjct:  410 VLVLGSGGLSIGQAGEFDYSGSQAVKAMKEENLKTVLMNPNIASVQTNEVGTKQADSVYFLPVTPQFVTEVIKTERPDGILLSMGGQTALNCGVELFRSGVLQKYGVKVLGTPVESIMATEDRQLFADKLMEINEKIAPSIAVESVADALKAAEEIGYPVMLRSAYALGGLGSGLCADQQKLEETAHKALAMSSQ--ILVEKSLLGWKEVEYEVVRDVADNCVTVCNMENFDPLGIHTGDSIVVAPSQTLSNEEYHMLRETAIKVVRHLGIVGECNIQYALHPSSLEYCIIEVNARLSRSSALASKATGYPLAFVAAKLALGIPLPEIKNAVSEKTTACFEPSLDYIVTKIPRWDLDRFQGMSREIGSAMKSVGEVMAVGRTFEESIQKA 797          

HSP 4 Score: 111.309 bits (277), Expect = 5.646e-24
Identity = 99/371 (26.68%), Postives = 170/371 (45.82%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQ---VLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLG-----MSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKV-----CNKISSSMXKCW*NNV 2365
            EFD+    +++ LR+ G +TV+VN N  TV T     D+ Y   +T + + ++ + E   G  ++ GGQ   N  + L ++GV       +LGTS   I   E+R  FS IL+++    AP  A  ++++    A ++GYP ++R ++ L G     A    E+      A A  SQ   V++ K +RG +E+E + V       +     E+V+  G+H+G++ ++ P+QT+S      ++    K+ +   + G  N Q+ +  N     +IE N R SRS    SK  G     VA ++ +G       L +L N +  V         DY  +K P +   +         C   S+    C+  N+
Sbjct:  976 EFDWCAVSSIRTLRQMGKRTVVVNHNPETVSTDFDECDRLYFEELTLERILDITQQESCTGCIVSVGGQIPNNLAVPLHQNGV------RILGTSPLQIDRAEERSVFSTILDDLGVSQAPWRALSSLEDAFAFANKVGYPCLLRPSYVLSGSAMNVAYGEEEMKRFLEEA-AQVSQEHPVVITKFIRGAREVEVDAVAKAGKVLVHAIT-EHVEDAGVHSGDATLMLPTQTISQGALEKVKTATRKIAKAFEISGPFNTQFLVKGND--VMVIECNLRASRSFPFVSKTIGVDFINVATRVMVGEPVNESQLPTLENPIIPV---------DYVGIKAPMFSWPRLRDADPVLRCEMASTGEVACFGPNI 1327          
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Cavefish
Match: cps1 (carbamoyl-phosphate synthase 1 [Source:NCBI gene;Acc:103026142])

HSP 1 Score: 753.821 bits (1945), Expect = 0.000e+0
Identity = 409/778 (52.57%), Postives = 546/778 (70.18%), Query Frame = 2
Query:   47 LILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLINPLNNPELFIDPNERNLVEEVSINEIRHYNKNGNIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNADEYDALFISNGPGDPVKCTETIETIKNWITSEKP--FMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVTAVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKP--------KKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTT-MGV--ADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
            L+L D TV  G  FG  +   GE+VF TG+VGY E+L+DPSY  Q+L LTYPI+G+YGV + + LD+ GL K+ ES +I  +GL+V +YS E+S+W +  +L QWL++  V  + G+DTR LTK +R+ G++ G I     +    P++     I+PNERNLV EVS  E + + K   I V  +DCG+K+N IR   K GA V ++P+N  + + EYD LFISNGPGDP      I+ ++  + S++P    GIC+G+Q+ ALA G +++K+  GNRG NQP  ++ T + F+T+QNHG+ + + S+P  W  LF N ND +NEGI+H   P  + QFHPE   GPTD E LF  F+  +   K                       + ++ +++  KP         K+L+LGSGGLSIGQAGEFDYSG+QA+KA++EE ++TVL+NPNIA+VQT  +G   AD  Y LP+T  +VTEVIK ERPDG+ L+ GGQTALNCG+EL  SGV + Y V VLGT +E+I  TEDRQ F++ L EI E++APS+A  +V + + AAE++GYPVM+R+A+ALGGLGSG   +  +L + A  A A +SQ+LV+KSL GWKE+EYEVVRDV DNC+TVCNMEN DPLGIHTG+S+VVAPSQTLSN EY+MLR+ A+KVVR+LG+VGECNIQYAL P+S +Y IIEVNARLSRSSALASKATGYPLA+VAAKL LG+ L  ++N+V+  TTACFEPS+DY V KIPRWDL++F  +  +I S+M
Sbjct:   32 LVLEDGTVMKGYSFGHRQSSAGELVFNTGLVGYPEALTDPSYRGQILTLTYPIVGNYGVPNTQELDELGLRKNVESDRIQVSGLLVQDYSHEFSHWNSVKSLGQWLQEEKVPALYGVDTRMLTKIIRDKGTVLGKI-----EFEGQPVD----IINPNERNLVAEVSTKETQVFGKGNPIKVVAVDCGIKHNIIRLLVKRGAEVHLVPWNHDLMSLEYDGLFISNGPGDPSLAETLIQNVRKVLESDRPQPVFGICMGNQITALAAGAQSYKLPMGNRGQNQPVLNVMTGQAFITAQNHGYGIDSESLPPGWSPLFVNANDGTNEGIMHNNKPIFTAQFHPEAKGGPTDTEFLFDSFLSLIKKGK-----------------------DASIVSVMPKKPVLPQRAQVSKVLVLGSGGLSIGQAGEFDYSGSQAVKAMKEENLKTVLMNPNIASVQTNEVGTKQADSVYFLPVTPQFVTEVIKTERPDGILLSMGGQTALNCGVELFRSGVLQKYGVKVLGTPVESIMATEDRQLFADKLMEINEKIAPSIAVESVADALKAAEEIGYPVMLRSAYALGGLGSGLCADQQKLEETAHKALAMSSQILVEKSLLGWKEVEYEVVRDVADNCVTVCNMENFDPLGIHTGDSIVVAPSQTLSNEEYHMLRETAIKVVRHLGIVGECNIQYALHPSSLEYCIIEVNARLSRSSALASKATGYPLAFVAAKLALGIPLPEIKNAVSEKTTACFEPSLDYIVTKIPRWDLDRFQGMSREIGSAM 777          

HSP 2 Score: 588.186 bits (1515), Expect = 0.000e+0
Identity = 318/697 (45.62%), Postives = 447/697 (64.13%), Query Frame = 3
Query: 2346 SVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYV---EKFTES-----GLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKIIKCLNELEE-PRTYLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPF------SLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDW--DTGNQASSDSKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQ 4385
            SVGE+M+VGR FEE+ QKALRM    + GF P +     ++E       L+ P+  R+  LA AL  GV+V +I+ LT ID WFL+K  +I +    L +   + +  D+LL AK  GFSD Q+ +A+ S+E   R LR    ++P V QIDT++AE+P  TNYLY +Y G +HD+ F    +MVLG G Y IGSSVEFDWCAV  I+ L++M K+T++VN NPETVSTD+D CD L+FEEL+LE +LDI   E   G IVS+GGQ+PNN+A+ LH+  + I GTSP+ ID AE R  FS +LD +G+ Q  W+ L+  E A  F N V YPCL+RPSYVLSG+AMNVA+ E ++  +L +A  V+++HPVVI+KFI  A+E++VDAVA  GK+L  A++EHVE+AG+HSGDATL+ P Q +++  L+K+     +IA+  ++SGPFN Q + K ++++VIECNLR SRSFPFVSK +G + I  ATR ++ EP       +LE   +    + V +K PMFS+ RL  AD +L  EM STGEVACFG +   AFLKA L+ G K+P+ G  I I I  +  + + L +  QL   G+ LYA+  T+ +   + +S   V W    G + +  S  +  SD      +DL++NLP  N+   + + +I      RR+A+DYG+ L+TN + +    Q
Sbjct:  779 SVGEVMAVGRTFEESIQKALRMCHPSVDGFVPRLPLKRAWSEQCDLRQELAVPSSTRIFSLAKALHDGVTVDQIHQLTAIDKWFLHKLRRITELEKHLSQYDSSTVPGDVLLKAKQEGFSDRQVGQALGSSEGEARALRHSRNIQPWVKQIDTLAAEYPAVTNYLYCTYHGQEHDLDFRDQGVMVLGCGPYHIGSSVEFDWCAVSSIRTLRQMGKRTVVVNHNPETVSTDFDECDRLYFEELTLERILDITQQESCTGCIVSVGGQIPNNLAVPLHQNGVRILGTSPLQIDRAEERSVFSTILDDLGVSQAPWRALSSLEDAFAFANKVGYPCLLRPSYVLSGSAMNVAYGEEEMKRFLEEAAQVSQEHPVVITKFIRGAREVEVDAVAKAGKVLVHAITEHVEDAGVHSGDATLMLPTQTISQGALEKVKTATRKIAKAFEISGPFNTQFLVKGNDVMVIECNLRASRSFPFVSKTIGVDFINVATRVMVGEPVNESQLPTLENPII--PVDYVGIKAPMFSWPRLRDADPVLRCEMASTGEVACFGPNIYSAFLKAMLSTGFKLPQKG--ILIGI-QHSFRPDFLSTAHQLQEEGFKLYATEATSAWLNANDVSTTPVAWPRHEGKETTLPSISRLLSD----GHIDLVVNLPNNNTKFLKDNFLI------RRMAVDYGVPLITNFQVSTFSKQ 1460          

HSP 3 Score: 124.405 bits (311), Expect = 6.705e-28
Identity = 100/390 (25.64%), Postives = 177/390 (45.38%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTD---YDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHRE------KIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVA-YGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNL--LVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFS------LECEFLRGEP--NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            ++VLGSG   IG + EFD+   + +K ++    KT+++N N  +V T+       D ++F  ++ + V ++   E+PDG+++SMGGQ   N  + L R        + + GT    I   E+R  F+  L  I         +     A+    ++ YP ++R +Y L G    +   +  L E   +A+A++    +++ K +   KE++ + V       +     E+ +  GIH+GD+ +V P Q ++ +    + +   ++ + L + G  N+Q      +L   +IE N R+SRS    SKA GY +   A +  +  P         E      EP  + +  K+P +   R  G    +G  M S GEV   G    E+  KA
Sbjct:  410 VLVLGSGGLSIGQAGEFDYSGSQAVKAMKEENLKTVLMNPNIASVQTNEVGTKQADSVYFLPVTPQFVTEVIKTERPDGILLSMGGQTALNCGVELFRSGVLQKYGVKVLGTPVESIMATEDRQLFADKLMEINEKIAPSIAVESVADALKAAEEIGYPVMLRSAYALGGLGSGLCADQQKLEETAHKALAMSSQ--ILVEKSLLGWKEVEYEVVRDVADNCVTVCNMENFDPLGIHTGDSIVVAPSQTLSNEEYHMLRETAIKVVRHLGIVGECNIQYALHPSSLEYCIIEVNARLSRSSALASKATGYPLAFVAAKLALGIPLPEIKNAVSEKTTACFEPSLDYIVTKIPRWDLDRFQGMSREIGSAMKSVGEVMAVGRTFEESIQKA 797          

HSP 4 Score: 111.309 bits (277), Expect = 5.603e-24
Identity = 99/371 (26.68%), Postives = 170/371 (45.82%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQ---VLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLG-----MSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKV-----CNKISSSMXKCW*NNV 2365
            EFD+    +++ LR+ G +TV+VN N  TV T     D+ Y   +T + + ++ + E   G  ++ GGQ   N  + L ++GV       +LGTS   I   E+R  FS IL+++    AP  A  ++++    A ++GYP ++R ++ L G     A    E+      A A  SQ   V++ K +RG +E+E + V       +     E+V+  G+H+G++ ++ P+QT+S      ++    K+ +   + G  N Q+ +  N     +IE N R SRS    SK  G     VA ++ +G       L +L N +  V         DY  +K P +   +         C   S+    C+  N+
Sbjct:  976 EFDWCAVSSIRTLRQMGKRTVVVNHNPETVSTDFDECDRLYFEELTLERILDITQQESCTGCIVSVGGQIPNNLAVPLHQNGV------RILGTSPLQIDRAEERSVFSTILDDLGVSQAPWRALSSLEDAFAFANKVGYPCLLRPSYVLSGSAMNVAYGEEEMKRFLEEA-AQVSQEHPVVITKFIRGAREVEVDAVAKAGKVLVHAIT-EHVEDAGVHSGDATLMLPTQTISQGALEKVKTATRKIAKAFEISGPFNTQFLVKGND--VMVIECNLRASRSFPFVSKTIGVDFINVATRVMVGEPVNESQLPTLENPIIPV---------DYVGIKAPMFSWPRLRDADPVLRCEMASTGEVACFGPNI 1327          
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Cavefish
Match: cps1 (carbamoyl-phosphate synthase 1 [Source:NCBI gene;Acc:103026142])

HSP 1 Score: 753.821 bits (1945), Expect = 0.000e+0
Identity = 409/778 (52.57%), Postives = 546/778 (70.18%), Query Frame = 2
Query:   47 LILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLINPLNNPELFIDPNERNLVEEVSINEIRHYNKNGNIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNADEYDALFISNGPGDPVKCTETIETIKNWITSEKP--FMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVTAVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKP--------KKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTT-MGV--ADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
            L+L D TV  G  FG  +   GE+VF TG+VGY E+L+DPSY  Q+L LTYPI+G+YGV + + LD+ GL K+ ES +I  +GL+V +YS E+S+W +  +L QWL++  V  + G+DTR LTK +R+ G++ G I     +    P++     I+PNERNLV EVS  E + + K   I V  +DCG+K+N IR   K GA V ++P+N  + + EYD LFISNGPGDP      I+ ++  + S++P    GIC+G+Q+ ALA G +++K+  GNRG NQP  ++ T + F+T+QNHG+ + + S+P  W  LF N ND +NEGI+H   P  + QFHPE   GPTD E LF  F+  +   K                       + ++ +++  KP         K+L+LGSGGLSIGQAGEFDYSG+QA+KA++EE ++TVL+NPNIA+VQT  +G   AD  Y LP+T  +VTEVIK ERPDG+ L+ GGQTALNCG+EL  SGV + Y V VLGT +E+I  TEDRQ F++ L EI E++APS+A  +V + + AAE++GYPVM+R+A+ALGGLGSG   +  +L + A  A A +SQ+LV+KSL GWKE+EYEVVRDV DNC+TVCNMEN DPLGIHTG+S+VVAPSQTLSN EY+MLR+ A+KVVR+LG+VGECNIQYAL P+S +Y IIEVNARLSRSSALASKATGYPLA+VAAKL LG+ L  ++N+V+  TTACFEPS+DY V KIPRWDL++F  +  +I S+M
Sbjct:   32 LVLEDGTVMKGYSFGHRQSSAGELVFNTGLVGYPEALTDPSYRGQILTLTYPIVGNYGVPNTQELDELGLRKNVESDRIQVSGLLVQDYSHEFSHWNSVKSLGQWLQEEKVPALYGVDTRMLTKIIRDKGTVLGKI-----EFEGQPVD----IINPNERNLVAEVSTKETQVFGKGNPIKVVAVDCGIKHNIIRLLVKRGAEVHLVPWNHDLMSLEYDGLFISNGPGDPSLAETLIQNVRKVLESDRPQPVFGICMGNQITALAAGAQSYKLPMGNRGQNQPVLNVMTGQAFITAQNHGYGIDSESLPPGWSPLFVNANDGTNEGIMHNNKPIFTAQFHPEAKGGPTDTEFLFDSFLSLIKKGK-----------------------DASIVSVMPKKPVLPQRAQVSKVLVLGSGGLSIGQAGEFDYSGSQAVKAMKEENLKTVLMNPNIASVQTNEVGTKQADSVYFLPVTPQFVTEVIKTERPDGILLSMGGQTALNCGVELFRSGVLQKYGVKVLGTPVESIMATEDRQLFADKLMEINEKIAPSIAVESVADALKAAEEIGYPVMLRSAYALGGLGSGLCADQQKLEETAHKALAMSSQILVEKSLLGWKEVEYEVVRDVADNCVTVCNMENFDPLGIHTGDSIVVAPSQTLSNEEYHMLRETAIKVVRHLGIVGECNIQYALHPSSLEYCIIEVNARLSRSSALASKATGYPLAFVAAKLALGIPLPEIKNAVSEKTTACFEPSLDYIVTKIPRWDLDRFQGMSREIGSAM 777          

HSP 2 Score: 588.186 bits (1515), Expect = 0.000e+0
Identity = 318/697 (45.62%), Postives = 447/697 (64.13%), Query Frame = 3
Query: 2346 SVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYV---EKFTES-----GLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKIIKCLNELEE-PRTYLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPF------SLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDW--DTGNQASSDSKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQ 4385
            SVGE+M+VGR FEE+ QKALRM    + GF P +     ++E       L+ P+  R+  LA AL  GV+V +I+ LT ID WFL+K  +I +    L +   + +  D+LL AK  GFSD Q+ +A+ S+E   R LR    ++P V QIDT++AE+P  TNYLY +Y G +HD+ F    +MVLG G Y IGSSVEFDWCAV  I+ L++M K+T++VN NPETVSTD+D CD L+FEEL+LE +LDI   E   G IVS+GGQ+PNN+A+ LH+  + I GTSP+ ID AE R  FS +LD +G+ Q  W+ L+  E A  F N V YPCL+RPSYVLSG+AMNVA+ E ++  +L +A  V+++HPVVI+KFI  A+E++VDAVA  GK+L  A++EHVE+AG+HSGDATL+ P Q +++  L+K+     +IA+  ++SGPFN Q + K ++++VIECNLR SRSFPFVSK +G + I  ATR ++ EP       +LE   +    + V +K PMFS+ RL  AD +L  EM STGEVACFG +   AFLKA L+ G K+P+ G  I I I  +  + + L +  QL   G+ LYA+  T+ +   + +S   V W    G + +  S  +  SD      +DL++NLP  N+   + + +I      RR+A+DYG+ L+TN + +    Q
Sbjct:  779 SVGEVMAVGRTFEESIQKALRMCHPSVDGFVPRLPLKRAWSEQCDLRQELAVPSSTRIFSLAKALHDGVTVDQIHQLTAIDKWFLHKLRRITELEKHLSQYDSSTVPGDVLLKAKQEGFSDRQVGQALGSSEGEARALRHSRNIQPWVKQIDTLAAEYPAVTNYLYCTYHGQEHDLDFRDQGVMVLGCGPYHIGSSVEFDWCAVSSIRTLRQMGKRTVVVNHNPETVSTDFDECDRLYFEELTLERILDITQQESCTGCIVSVGGQIPNNLAVPLHQNGVRILGTSPLQIDRAEERSVFSTILDDLGVSQAPWRALSSLEDAFAFANKVGYPCLLRPSYVLSGSAMNVAYGEEEMKRFLEEAAQVSQEHPVVITKFIRGAREVEVDAVAKAGKVLVHAITEHVEDAGVHSGDATLMLPTQTISQGALEKVKTATRKIAKAFEISGPFNTQFLVKGNDVMVIECNLRASRSFPFVSKTIGVDFINVATRVMVGEPVNESQLPTLENPII--PVDYVGIKAPMFSWPRLRDADPVLRCEMASTGEVACFGPNIYSAFLKAMLSTGFKLPQKG--ILIGI-QHSFRPDFLSTAHQLQEEGFKLYATEATSAWLNANDVSTTPVAWPRHEGKETTLPSISRLLSD----GHIDLVVNLPNNNTKFLKDNFLI------RRMAVDYGVPLITNFQVSTFSKQ 1460          

HSP 3 Score: 124.405 bits (311), Expect = 6.705e-28
Identity = 100/390 (25.64%), Postives = 177/390 (45.38%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTD---YDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHRE------KIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVA-YGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNL--LVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFS------LECEFLRGEP--NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            ++VLGSG   IG + EFD+   + +K ++    KT+++N N  +V T+       D ++F  ++ + V ++   E+PDG+++SMGGQ   N  + L R        + + GT    I   E+R  F+  L  I         +     A+    ++ YP ++R +Y L G    +   +  L E   +A+A++    +++ K +   KE++ + V       +     E+ +  GIH+GD+ +V P Q ++ +    + +   ++ + L + G  N+Q      +L   +IE N R+SRS    SKA GY +   A +  +  P         E      EP  + +  K+P +   R  G    +G  M S GEV   G    E+  KA
Sbjct:  410 VLVLGSGGLSIGQAGEFDYSGSQAVKAMKEENLKTVLMNPNIASVQTNEVGTKQADSVYFLPVTPQFVTEVIKTERPDGILLSMGGQTALNCGVELFRSGVLQKYGVKVLGTPVESIMATEDRQLFADKLMEINEKIAPSIAVESVADALKAAEEIGYPVMLRSAYALGGLGSGLCADQQKLEETAHKALAMSSQ--ILVEKSLLGWKEVEYEVVRDVADNCVTVCNMENFDPLGIHTGDSIVVAPSQTLSNEEYHMLRETAIKVVRHLGIVGECNIQYALHPSSLEYCIIEVNARLSRSSALASKATGYPLAFVAAKLALGIPLPEIKNAVSEKTTACFEPSLDYIVTKIPRWDLDRFQGMSREIGSAMKSVGEVMAVGRTFEESIQKA 797          

HSP 4 Score: 111.309 bits (277), Expect = 5.603e-24
Identity = 99/371 (26.68%), Postives = 170/371 (45.82%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQ---VLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLG-----MSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKV-----CNKISSSMXKCW*NNV 2365
            EFD+    +++ LR+ G +TV+VN N  TV T     D+ Y   +T + + ++ + E   G  ++ GGQ   N  + L ++GV       +LGTS   I   E+R  FS IL+++    AP  A  ++++    A ++GYP ++R ++ L G     A    E+      A A  SQ   V++ K +RG +E+E + V       +     E+V+  G+H+G++ ++ P+QT+S      ++    K+ +   + G  N Q+ +  N     +IE N R SRS    SK  G     VA ++ +G       L +L N +  V         DY  +K P +   +         C   S+    C+  N+
Sbjct:  976 EFDWCAVSSIRTLRQMGKRTVVVNHNPETVSTDFDECDRLYFEELTLERILDITQQESCTGCIVSVGGQIPNNLAVPLHQNGV------RILGTSPLQIDRAEERSVFSTILDDLGVSQAPWRALSSLEDAFAFANKVGYPCLLRPSYVLSGSAMNVAYGEEEMKRFLEEA-AQVSQEHPVVITKFIRGAREVEVDAVAKAGKVLVHAIT-EHVEDAGVHSGDATLMLPTQTISQGALEKVKTATRKIAKAFEISGPFNTQFLVKGND--VMVIECNLRASRSFPFVSKTIGVDFINVATRVMVGEPVNESQLPTLENPIIPV---------DYVGIKAPMFSWPRLRDADPVLRCEMASTGEVACFGPNI 1327          
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004226.1 (pep scaffold:Pmarinus_7.0:GL477658:179183:185371:1 gene:ENSPMAG00000003860.1 transcript:ENSPMAT00000004226.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 209.534 bits (532), Expect = 2.955e-59
Identity = 101/190 (53.16%), Postives = 143/190 (75.26%), Query Frame = 3
Query: 4437 IDCITSQKIYRFPGLVDIHVHTRDPGQVHKEDWSTVTKXXXXXXXXXXFAMPNTAPPITNLESFELAKKRASSLAHCDYGLYVGASNDNWESLAELAPEAIGLKMYLNPTFSTLQMNNFSTWAKHFKHFPENRPICCHAEGETMAAVILLAQLHNRHVHICHVSRKQEIELIRLAKSQGLKVTCEVSPHH 5006
            +D +T+Q+I R PGL+D+HVH R+PG  HKED+ + T AA+AGG+T + AMPNT P +T+L+S  + +K A + A CDY L+ GAS +N  S+ +L+    GLKMYLN T+S L+++N + W +HF+ +P +R I  HAE +T+AAV+++AQLH R VH+CHV+RK+EI LIR AK  GL+VTCEV+PHH
Sbjct:   16 VDSMTAQRIVRLPGLMDVHVHLREPGGEHKEDFCSGTAAALAGGVTLVCAMPNTNPAVTDLDSLAVVQKAARAGARCDYALFAGASVENAASVRDLSGATAGLKMYLNETYSALRLDNMAHWMQHFESWPRDRVIAVHAERQTVAAVLMVAQLHKRSVHVCHVARKEEILLIRAAKESGLEVTCEVAPHH 205          
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004232.1 (pep scaffold:Pmarinus_7.0:GL477658:181762:185386:1 gene:ENSPMAG00000003860.1 transcript:ENSPMAT00000004232.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.0846 bits (157), Expect = 2.751e-11
Identity = 28/39 (71.79%), Postives = 33/39 (84.62%), Query Frame = 3
Query: 4890 QLHNRHVHICHVSRKQEIELIRLAKSQGLKVTCEVSPHH 5006
            QLH R VH+CHV+RK+EI LIR AK  GL+VTCEV+PHH
Sbjct:    1 QLHKRSVHVCHVARKEEILLIRAAKESGLEVTCEVAPHH 39          
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Yeast
Match: URA2 (Bifunctional carbamoylphosphate synthetase/aspartate transcarbamylase; catalyzes the first two enzymatic steps in the de novo biosynthesis of pyrimidines; both activities are subject to feedback inhibition by UTP [Source:SGD;Acc:S000003666])

HSP 1 Score: 775.007 bits (2000), Expect = 0.000e+0
Identity = 431/791 (54.49%), Postives = 562/791 (71.05%), Query Frame = 2
Query:   47 LILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQW--GLPKSFESAKIHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIK---DKLLI------NPLNNPELFIDPNERNLVEEVSINEIRHY-----NK--------NGNI-HVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNADEYDALFISNGPGDPVKCTETIETIKNWITSEK-PFMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVTAVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKPKKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
            L L D TV  G  FGA K   GE+VFQTGMVGY ES++DPSY  Q+LV+TYP++G+YGV D  + D+    LP+ FES +IH  GL+++ Y+ EYS++ A+ +L +WL+  G+  + G+DTR LTK LR+ GS+ G +   K   D+ +       +  + PE ++DPN +NLV +VSINE + Y     NK        +G +  +  ID G+K NQIRCF K G  + V+P+N     ++YD LFISNGPGDP    +  + + N + ++K P  GICLGHQL+A A G  T K+K+GNRGHN PCT   + RC++TSQNHGFAV   ++   W+ LF N ND SNEGI H +LP+ SVQFHPE   GP D E LF VFI+ V   K          ++   + +     E  + A    + KK+L+LGSGGLSIGQAGEFDYSG+QA+KAL+EEGI T+L+NPNIAT+QT+ G+ADK Y +P+T ++V +VI  ERPD +Y+TFGGQTAL+ GI +++   F+   V VLGT I+TI  TEDR+ FS  ++EI E+ A S AA +V E + A +++G+PV++RAA+ALGGLGSGFANN  EL+DL + AF+ + QVLV+KS++GWKE+EYEVVRD +DNCITVCNMEN DPLGIHTG+S+VVAPSQTLS+ +Y MLR  A+ V+R+LGVVGECNIQYAL+P S  Y IIEVNARLSRSSALASKATGYPLAY AAKLGL + L  ++NSVT  T ACFEPS+DYCVVK+PRWDL KFT+V  ++SSSM
Sbjct:   24 LELKDGTVLQGYSFGAEKSVAGELVFQTGMVGYPESVTDPSYEGQILVITYPLVGNYGVPDMHLRDELVEELPRYFESNRIHIAGLVISHYTDEYSHYLAKSSLGKWLQNEGIPAVYGVDTRSLTKHLRDAGSMLGRLSLEKSGSDRTISRSSSWRSAFDVPE-WVDPNVQNLVSKVSINEPKLYVPPADNKHIELQTGPDGKVLRILAIDVGMKYNQIRCFIKRGVELKVVPWNYDFTKEDYDGLFISNGPGDPSVLDDLSQRLSNVLEAKKTPVFGICLGHQLIARAAGASTLKLKFGNRGHNIPCTSTISGRCYITSQNHGFAVDVDTLTSGWKPLFVNANDDSNEGIYHSELPYFSVQFHPESTPGPRDTEFLFDVFIQAVKEFKYT--------QVLKPIAFPGGLLEDNVKAHPRIEAKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTILINPNIATIQTSKGLADKVYFVPVTAEFVRKVILHERPDAIYVTFGGQTALSVGIAMKDE--FEALGVKVLGTPIDTIITTEDRELFSNAIDEINEKCAKSQAANSVDEALAAVKEIGFPVIVRAAYALGGLGSGFANNEKELVDLCNVAFSSSPQVLVEKSMKGWKEVEYEVVRDAFDNCITVCNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYALNPVSKDYCIIEVNARLSRSSALASKATGYPLAYTAAKLGLNIPLNEVKNSVTKSTCACFEPSLDYCVVKMPRWDLKKFTRVSTELSSSM 803          

HSP 2 Score: 769.615 bits (1986), Expect = 0.000e+0
Identity = 422/898 (46.99%), Postives = 583/898 (64.92%), Query Frame = 3
Query: 2346 SVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPY-VEKFTESGLSSPTDRRMLVLANAL-KQGVSVKEIYDLTKIDYWFLYK------FAKIIKCLNELEEPRTYLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFS-LECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDWDTGNQASSDSKKK-TFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQALRKAIYKKKICVASPTIDCITSQKIYRFPGLVDIHVHTRDPGQVHK--EDWSTVTKXXXXXXXXXXFAMPN--TAPPITNLESFELAKKRASSLAHCDYGLYVGASNDNWESLAELAPEAIGLKMYLNPTFSTLQMNNFSTWAKHFKHFPENRPICCHAEGETMAAVILLAQLHNRHVHICHVSRKQEIELIRLAKSQGLKVTCEVS 4997
            SVGE+MS+GR FEEA QKA+R  +    GF+   ++   +  L++PTD R+  +ANA  K+G SV +++++T+ID WFL K      FA+ I      EE    L   +L  AK LGF D QIA  + S E+A+R+LR E G+ P V QIDTV+AE+P YTNYLY++Y+   HD++F+   +MVLGSGVYRIGSSVEFDWCAV  ++ L+    KTIMVN NPETVSTDYD  D L+FE ++LE VLDI+ IE   GV+VSMGGQ  NNIAM LHRE + I GTSP  ID+AENR+KFSRMLD IG+ QP WKELT  + A +F   V YP LVRPSYVLSGAAMN  +S++DL  YL QAV V++D+PVVI+K+IE+AKEI++DAVA  G+L+   VSEHVENAG+HSGDATL+ PPQD+  +T+ +I     +I + LK++GP+N+Q IAKD+ + VIECN+R SRSFPF+SK +G N+I  AT+AIM  P +    E L  +   VAVKVP FSF RL GAD +LGVEM STGEVA FG  + EA+LK+ LA G K+P+   NI +SIGSYK K+ELL SV++L+++GY L+A+ GTADF  E GI+V  +  +  N+   D K + + + ++  +++DL INLP  N   RR +  ++ GYK RRLA+DY + L+TNVKC KL ++A+      + I +     D  TS +    PGL++I  +  +   V K   +    T+  +  G T    MP   + P IT++ S + A   +   ++ D+   +  +  N  S+ + A +   L + L         N  +  A+    +P  + +   A+   +A+V+LL  L NR +HI  VS K+++ LI   K++  +VTC+V+
Sbjct:  805 SVGEVMSIGRTFEEAIQKAIRSTEYANLGFNETDLDIDIDYELNNPTDMRVFAIANAFAKKGYSVDKVWEMTRIDKWFLNKLHDLVQFAEKISSFGTKEE----LPSLVLRQAKQLGFDDRQIARFLDSNEVAIRRLRKEYGITPFVKQIDTVAAEFPAYTNYLYMTYNADSHDLSFDDHGVMVLGSGVYRIGSSVEFDWCAVTAVRTLRANNIKTIMVNYNPETVSTDYDEADRLYFETINLERVLDIYEIENSSGVVVSMGGQTSNNIAMTLHRENVKILGTSPDMIDSAENRYKFSRMLDQIGVDQPAWKELTSMDEAESFAEKVGYPVLVRPSYVLSGAAMNTVYSKNDLESYLNQAVEVSRDYPVVITKYIENAKEIEMDAVARNGELVMHVVSEHVENAGVHSGDATLIVPPQDLAPETVDRIVVATAKIGKALKITGPYNIQFIAKDNEIKVIECNVRASRSFPFISKVVGVNLIELATKAIMGLPLTPYPVEKLPDD--YVAVKVPQFSFPRLAGADPVLGVEMASTGEVATFGHSKYEAYLKSLLATGFKLPKK--NILLSIGSYKEKQELLSSVQKLYNMGYKLFATSGTADFLSEHGIAVQYL--EVLNKDDDDQKSEYSLTQHLANNEIDLYINLPSANR-FRRPASYVSKGYKTRRLAVDYSVPLVTNVKCAKLLIEAI-----SRNITLDVSERDAQTSHRTITLPGLINIATYVPNASHVIKGPAELKETTRLFLESGFTYCQLMPRSISGPVITDVASLKAANSVSQDSSYTDFSFTIAGTAHNAHSVTQSASKVTALFLPLREL-----KNKITAVAELLNQWPTEKQVIAEAKTADLASVLLLTSLQNRSIHITGVSNKEDLALIMTVKAKDPRVTCDVN 1681          

HSP 3 Score: 130.183 bits (326), Expect = 1.870e-30
Identity = 104/392 (26.53%), Postives = 176/392 (44.90%), Query Frame = 3
Query: 2850 FEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHRE----KIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYG-GKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQL----IAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFS--------LECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
             E   ++VLGSG   IG + EFD+   + IK L+     TI++N N  T+ T   + D ++F  ++ E V  +   E+PD + V+ GGQ   ++ + +  E     + + GT    I   E+R  FS  +D I     K +     + A+    ++ +P +VR +Y L G     A +E +L +     VA +    V++ K ++  KE++ + V       +     E+ +  GIH+GD+ +V P Q ++++    +      + + L V G  N+Q     ++KD    +IE N R+SRS    SKA GY +   A +  ++ P +          C       +   VK+P +   +       L   M S GEV   G    EA  KA
Sbjct:  436 IEAKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTILINPNIATIQTSKGLADKVYFVPVTAEFVRKVILHERPDAIYVTFGGQTALSVGIAMKDEFEALGVKVLGTPIDTIITTEDRELFSNAIDEINEKCAKSQAANSVDEALAAVKEIGFPVIVRAAYALGGLGSGFANNEKELVDLCN--VAFSSSPQVLVEKSMKGWKEVEYEVVRDAFDNCITVCNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYALNPVSKD--YCIIEVNARLSRSSALASKATGYPLAYTAAKLGLNIPLNEVKNSVTKSTCACFEPSLDYCVVKMPRWDLKKFTRVSTELSSSMKSVGEVMSIGRTFEEAIQKA 823          

HSP 4 Score: 109.768 bits (273), Expect = 2.787e-24
Identity = 96/342 (28.07%), Postives = 162/342 (47.37%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAA--FAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFT 2311
            EFD+    A++ LR   I+T++VN N  TV T    AD+ Y   I  + V ++ ++E   GV ++ GGQT+ N  + L          V +LGTS + I   E+R +FS +L++I  +        ++ E    AE++GYPV++R ++ L G       +  +L    + A   +    V++ K +   KEIE + V    +  + V + E+V+  G+H+G++ ++ P Q L+      +     K+ + L + G  NIQ+    N  K  +IE N R SRS    SK  G  L  +A K  +G+ L               +   DY  VK+P++   +  
Sbjct:  997 EFDWCAVTAVRTLRANNIKTIMVNYNPETVSTDYDEADRLYFETINLERVLDIYEIENSSGVVVSMGGQTSNNIAMTLHRE------NVKILGTSPDMIDSAENRYKFSRMLDQIGVDQPAWKELTSMDEAESFAEKVGYPVLVRPSYVLSGAAMNTVYSKNDLESYLNQAVEVSRDYPVVITKYIENAKEIEMDAVARNGELVMHVVS-EHVENAGVHSGDATLIVPPQDLAPETVDRIVVATAKIGKALKITGPYNIQFIAKDNEIK--VIECNVRASRSFPFISKVVGVNLIELATKAIMGLPLTPY---------PVEKLPDDYVAVKVPQFSFPRLA 1320          
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Yeast
Match: CPA2 (Large subunit of carbamoyl phosphate synthetase; carbamoyl phosphate synthetase catalyzes a step in the synthesis of citrulline, an arginine precursor [Source:SGD;Acc:S000003870])

HSP 1 Score: 566.229 bits (1458), Expect = 0.000e+0
Identity = 331/709 (46.69%), Postives = 434/709 (61.21%), Query Frame = 3
Query: 2346 SVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYVE--KFTESGLSSPTDRRMLVLANAL-KQGVSVKEIYDLTKIDYWFLYKFAKIIKCLNELEEPRTY--LSKDILLNAKLLGFSDTQIAEAVKS------TEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLL-VIECNLRVSRSFPFVSKALGYNMIAAATRA-----IMSEPFSLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA-QLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDWDTGNQASSDSKK--KTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQALRKAIYKK 4412
            SVGE+M++GR +EEAFQKALR VD  L GF    E     +  L +PTDRR+L +  AL  +  +V+ + +L+KID WFLYK   I+    ELE  ++   LSKD+L  AK LGFSD QIA  +         E+ +R LR  LG+ P V +IDT++AE+P  TNYLY +Y+   +D+ F    ++VLGSGVYRIGSSVEFDWCAV   K L+   KKTIM+N NPETVSTD+D  D L+FEELS E V+DI+ +EQ +G I+S+GGQLP NIA+ L+     I GT+P  ID AENR KFS +LDSI + QP+W ELT  E A  F + V YP L+RPSYVLSGAAM+V  +E +L   LT A  V+ DHPVV+SKFIE A+EIDVDAVAY G +L  A+SEHVENAG+HSGDA+LV PPQ +++     +  I  ++A+  K++GPFNMQ+I   ++ L VIECN+R SRSFPFVSK LG N I  A +A     I+ +P  L    L  + + VA KVP FSF RL GAD  LGVEM STGEVA FG D  E++  A Q      +P P   I    G    ++ L +    + ++GY +Y +  T   Y++  I              +D +K  + F +Y I+   +L           +RA       Y  RR AID+ I L    +   LF + L+  I +K
Sbjct:  397 SVGEVMAIGRNYEEAFQKALRQVDPSLLGFQGSTEFGDQLDEALRTPTDRRVLAIGQALIHENYTVERVNELSKIDKWFLYKCMNIVNIYKELESVKSLSDLSKDLLQRAKKLGFSDKQIAVTINKHASTNINELEIRSLRKTLGIIPFVKRIDTLAAEFPAQTNYLYTTYNATKNDVEFNENGMLVLGSGVYRIGSSVEFDWCAVNTAKTLRDQGKKTIMINYNPETVSTDFDEVDRLYFEELSYERVMDIYELEQSEGCIISVGGQLPQNIALKLYDNGCNIMGTNPNDIDRAENRHKFSSILDSIDVDQPEWSELTSVEEAKLFASKVNYPVLIRPSYVLSGAAMSVVNNEEELKAKLTLASDVSPDHPVVMSKFIEGAQEIDVDAVAYNGNVLVHAISEHVENAGVHSGDASLVLPPQHLSDDVKIALKDIADKVAKAWKITGPFNMQIIKDGEHTLKVIECNIRASRSFPFVSKVLGVNFIEIAVKAFLGGDIVPKPVDL---MLNKKYDYVATKVPQFSFTRLAGADPFLGVEMASTGEVASFGRDLIESYWTAIQSTMNFHVPLPPSGIL--FGGDTSREYLGQVASIVATIGYRIYTTNETTKTYLQEHIKEKNAKVSLIKFPKNDKRKLRELFQEYDIKAVFNL---------ASKRAESTDDVDYIMRRNAIDFAIPLFNEPQTALLFAKCLKAKIAEK 1091          

HSP 2 Score: 412.149 bits (1058), Expect = 0.000e+0
Identity = 218/353 (61.76%), Postives = 279/353 (79.04%), Query Frame = 2
Query: 1283 QAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
            QAGEFDYSG+QA+KAL+E+   T+LVNPNIAT QT+  +ADK Y LP+T +Y+T +I++ERPD + LTFGGQT LNCG+ L+ESGV   Y V VLGT I+T+  +EDR  F+  L++I   +A S A  TV E ++AAE++ YPV++R+A+ALGGLGSGFANN +E+ +LA+ + +   Q+LV+KSL+GWKE+EYEVVRD   NCITVCNMEN DPLG+HTG+S+V APSQTLS+ E++MLR  A+K++R+LGV+GECN+QYAL P+   Y +IEVNARLSRSSALASKATGYPLAY AAK+GLG +L  L N +T  T A FEPS+DY V KIP+WDL+KF  V   I SSM
Sbjct:   43 QAGEFDYSGSQAIKALKEDNKFTILVNPNIATNQTSHSLADKIYYLPVTPEYITYIIELERPDAILLTFGGQTGLNCGVALDESGVLAKYNVKVLGTPIKTLITSEDRDLFASALKDINIPIAESFACETVDEALEAAERVKYPVIVRSAYALGGLGSGFANNASEMKELAAQSLSLAPQILVEKSLKGWKEVEYEVVRDRVGNCITVCNMENFDPLGVHTGDSMVFAPSQTLSDEEFHMLRSAAIKIIRHLGVIGECNVQYALQPDGLDYRVIEVNARLSRSSALASKATGYPLAYTAAKIGLGYTLPELPNPITKTTVANFEPSLDYIVAKIPKWDLSKFQYVDRSIGSSM 395          

HSP 3 Score: 139.043 bits (349), Expect = 2.044e-33
Identity = 106/389 (27.25%), Postives = 187/389 (48.07%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLH------REKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVA-YGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNL--LVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSL--------ECEFLRGEP--NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            ++V+GSG   IG + EFD+   + IK L+   K TI+VN N  T  T + + D +++  ++ E +  I  +E+PD ++++ GGQ   N  + L       +  + + GT    +  +E+R  F+  L  I I   +       + A+     V+YP +VR +Y L G     A + S++ E   Q++++     +++ K ++  KE++ + V    G  +     E+ +  G+H+GD+ +  P Q ++++    +     +I + L V G  N+Q   + D L   VIE N R+SRS    SKA GY +  A T A +   ++L        +      EP  + +  K+P +  ++    D  +G  M S GEV   G +  EAF KA
Sbjct:   31 VLVIGSGGLSIGQAGEFDYSGSQAIKALKEDNKFTILVNPNIATNQTSHSLADKIYYLPVTPEYITYIIELERPDAILLTFGGQTGLNCGVALDESGVLAKYNVKVLGTPIKTLITSEDRDLFASALKDINIPIAESFACETVDEALEAAERVKYPVIVRSAYALGGLGSGFANNASEMKELAAQSLSLAPQ--ILVEKSLKGWKEVEYEVVRDRVGNCITVCNMENFDPLGVHTGDSMVFAPSQTLSDEEFHMLRSAAIKIIRHLGVIGECNVQYALQPDGLDYRVIEVNARLSRSSALASKATGYPL--AYTAAKIGLGYTLPELPNPITKTTVANFEPSLDYIVAKIPKWDLSKFQYVDRSIGSSMKSVGEVMAIGRNYEEAFQKA 415          

HSP 4 Score: 114.005 bits (284), Expect = 1.065e-25
Identity = 98/343 (28.57%), Postives = 165/343 (48.10%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTEL---LDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNM-ENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKF 2308
            EFD+      K LR++G +T+++N N  TV T     D+ Y   ++ + V ++ ++E+ +G  ++ GGQ   N  ++L ++G       +++GT+   I   E+R +FS IL+ I  +        +V+E    A ++ YPV+IR ++ L G      NN  EL   L LAS   +    V++ K + G +EI+ + V   Y+  + V  + E+V+  G+H+G++ +V P Q LS+     L+  A KV +   + G  N+Q   D   H   +IE N R SRS    SK  G     +A K  LG  +V                  DY   K+P++   + 
Sbjct:  596 EFDWCAVNTAKTLRDQGKKTIMINYNPETVSTDFDEVDRLYFEELSYERVMDIYELEQSEGCIISVGGQLPQNIALKLYDNGC------NIMGTNPNDIDRAENRHKFSSILDSIDVDQPEWSELTSVEEAKLFASKVNYPVLIRPSYVLSGAAMSVVNNEEELKAKLTLASDV-SPDHPVVMSKFIEGAQEIDVDAV--AYNGNVLVHAISEHVENAGVHSGDASLVLPPQHLSDDVKIALKDIADKVAKAWKITGPFNMQIIKD-GEHTLKVIECNIRASRSFPFVSKVLGVNFIEIAVKAFLGGDIVP------KPVDLMLNKKYDYVATKVPQFSFTRL 922          
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Yeast
Match: CPA1 (Small subunit of carbamoyl phosphate synthetase; carbamoyl phosphate synthetase catalyzes a step in the synthesis of citrulline, an arginine precursor; translationally regulated by an attenuator peptide encoded by YOR302W within the CPA1 mRNA 5'-leader [Source:SGD;Acc:S000005829])

HSP 1 Score: 335.495 bits (859), Expect = 2.936e-103
Identity = 171/376 (45.48%), Postives = 230/376 (61.17%), Query Frame = 2
Query:   26 SRRMKGALILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLINPLNNPELFIDPNERNLVEEVSINEIRHYNK---NGNIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVN--ADEYDALFISNGPGDPVKCTETI----ETIKNWITSEKPFMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIP-DEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHV 1123
            S   K    + +   + G  FGA K   GE VF T +VGY ES++DPSY  Q+LV T P+IG+YGV   +  D++ L K FES  IH  G++V EY+ +YS+WTA  +L+QW ++ GV  I+G+DTR L + LRE GS  G I  + D       ++P  +++P + NLV +V+  +  H +        +V +IDCGVK N IRC  K GA VTV PY+  +   A E+D +F+SNGPG+P  C  TI    E + N +    P  GICLGHQLLALA G  THK+KYGNR HN P   L T +C +TSQNHG+AV   ++P D+W+  F N NDKSNEG+IH + P  S QFHPE   GP D  +LF  F +++
Sbjct:    3 SAATKATFCIQNGPSFEGISFGANKSVAGETVFTTSLVGYPESMTDPSYRGQILVFTQPLIGNYGVPSGEARDEYNLLKYFESPHIHVVGIVVAEYAYQYSHWTAVESLAQWCQREGVAAITGVDTRELVQYLREQGSSLGRIT-LAD-------HDPVPYVNPMKTNLVAQVTTKKPFHVSALPGKAKANVALIDCGVKENIIRCLVKRGANVTVFPYDYRIQDVASEFDGIFLSNGPGNPELCQATISNVRELLNNPVYDCIPIFGICLGHQLLALASGASTHKLKYGNRAHNIPAMDLTTGQCHITSQNHGYAVDPETLPKDQWKPYFVNLNDKSNEGMIHLQRPIFSTQFHPEAKGGPLDTAILFDKFFDNI 370          
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Yeast
Match: DAL1 (Allantoinase; converts allantoin to allantoate in the first step of allantoin degradation; expression sensitive to nitrogen catabolite repression [Source:SGD;Acc:S000001466])

HSP 1 Score: 62.7734 bits (151), Expect = 2.917e-10
Identity = 66/220 (30.00%), Postives = 94/220 (42.73%), Query Frame = 3
Query: 4470 FPGLVDIHVHTRDPGQVHKEDWSTVTKXXXXXXXXXXFAMP-NTAPPITNLESFELAKKRASSLAHCDYGLYVGASNDNWESLAELAPEAI-GLKMYLNPTFSTLQMNNFSTWAKHF-----------------------KHFPENRPICCHAE-----------GETMAAVILLAQLHNRH-----VHICHVSRKQEIELIRLAKSQGLKVTCEVSPHH 5006
             PGLVD HVH  +PG+   E + T T+AAI+GG+TT+  MP N  PP TN+E+F +  + A     CD G + G    N   L  L    + G K +L  +     +  F    K +                        H  + +P   H E            E  A  ++L  L  R+     VHI H++  + I LIR A++ GL VT E   H+
Sbjct:   63 LPGLVDSHVHLNEPGRTSWEGFETGTQAAISGGVTTVVDMPLNAIPPTTNVENFRIKLEAAEGQMWCDVGFWGGLVPHNLPDLIPLVKAGVRGFKGFLLDS----GVEEFPPIGKEYIEEALKVLAEEDTMMMFHAELPKAHEDQQQPEQSHREYSSFLSSRPDSFEIDAINLILECLRARNGPVPPVHIVHLASMKAIPLIRKARASGLPVTTETCFHY 278          
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Yeast
Match: TRP3 (Indole-3-glycerol-phosphate synthase; forms bifunctional hetero-oligomeric anthranilate synthase:indole-3-glycerol phosphate synthase enzyme complex with Trp2p [Source:SGD;Acc:S000001694])

HSP 1 Score: 56.225 bits (134), Expect = 2.676e-8
Identity = 49/176 (27.84%), Postives = 70/176 (39.77%), Query Frame = 2
Query:  581 NIHVCIIDC--GVKNNQIRCFCKYGARVTVMPYNAT----VNADEYDALFISNGPGDPVKCTETIETIKNWITSEKPFMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTH------LQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHM 1072
            N HV +ID       N     C+ GA+V+V   +A     + A   D L IS GPG P   +        + T + P  GIC+G Q +    G +         G   P +H          +    ++ H  A + SS+P   +     EN     G+ HKK     VQFHPE +
Sbjct:   11 NKHVVLIDNYDSFTWNVYEYLCQEGAKVSVYRNDAITVPEIAALNPDTLLISPGPGHPKTDSGISRDCIRYFTGKIPVFGICMGQQCMFDVFGGEVAYAGEIVHGKTSPISHDNCGIFKNVPQGIAVTRYHSLAGTESSLPSCLKVTASTENGII-MGVRHKKYTVEGVQFHPESI 185          
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Nematostella
Match: EDO37703 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF31])

HSP 1 Score: 997.653 bits (2578), Expect = 0.000e+0
Identity = 520/911 (57.08%), Postives = 673/911 (73.87%), Query Frame = 3
Query: 2313 KCAIKLAVL*XSVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYVEKFTESGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKII------KCLNELEEPRTYLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDW-------DTGNQASSDSKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQALRKAIYKKKICVASPTIDCITSQKIYRFPGLVDIHVHTRDPGQVHKEDWSTVTKXXXXXXXXXXFAMPNTAPPITNLESFELAKKRASSLAHCDYGLYVGASNDNWESLAELAPEAIGLKMYLNPTFSTLQMNNFSTWAKHFKHFPENRPICCHAEGETMAAVILLAQLHNRHVHICHVSRKQEIELIRLAKSQGLKVTCEVSPHH 5006
            + + K+     SVGE+M++GR FEEA QKALRMVDE   GFD +    ++  L  P+D+R+ V+A +LK+G ++  +Y+LTKID WFL++   II      K      +P TY   + LL AK LGFSD QIA+ V STE+AVR+LR E+ + P + QIDTV+AE+P  TNYLYL+Y+  + D+ F G  +MVLGSGVYRIGSSVEFD CAV CI+EL+++ K+TIMVN NPETVSTDYD CD L+F+E+S ESV+DI+  E+P+G+I+SMGGQLPNNIAM LHR++  IFGTSP  IDNAENRFKFSR+LD+IGI QP+WKELT  ESA  FC+ V YPCLVRPSYVLSGAAM VA+S++DL  YL   V +++DHPVVISKFI++AKEIDVDAVA  GK++  AVSEHVENAG+HSGDAT+V PPQD+N+ T++KI  I   I   L V+GPFNMQLIAKDD L VIECNLRVSRSFPFVSK L  + +A ATR I     ++E         +V VKVP FSF+RL GAD  LGVEM STGEVACFGE+R EAFLK  L+ G +IP+   +I +SIGSYK K ELL SV  L +LGY+LYAS+GTADFY E GI+V+AVDW         GN A+++  +++ +DY+ ++ +DL INLP R++  ++ S  +T GY+ RR+AIDY + L+T+VKC KLFV+AL++     K+      ID I++ +I R PGL+D+HVH R+PG  HKED+++ T AA+AGGIT + AMPNT PP+ + ESF LAKK  ++ A CDY LY+GA   N+  L ++A  A GLKMYLN TF+TL++++ + W KH +++P + PI CHAEG T AA++LLA+L +R VHI HV+RK+EI +IR AK +GL VTCEV+PHH
Sbjct:  752 RVSTKIGSCMKSVGEVMAIGRRFEEALQKALRMVDESNLGFDSHRNAASDEELREPSDKRIHVVAASLKEGYTIDRLYELTKIDRWFLHRMKAIIDYGTMLKSYRAGSDPVTY---NHLLEAKRLGFSDKQIAKCVHSTELAVRKLREEMKLTPFIKQIDTVAAEYPACTNYLYLTYNAQEDDLGFPGNAMMVLGSGVYRIGSSVEFDCCAVGCIRELKKLGKQTIMVNYNPETVSTDYDECDRLYFDEISFESVMDIYQREKPEGIILSMGGQLPNNIAMPLHRQEARIFGTSPEYIDNAENRFKFSRLLDNIGILQPQWKELTTVESAKEFCHKVSYPCLVRPSYVLSGAAMIVAYSDTDLENYLGSEVFLSRDHPVVISKFIQEAKEIDVDAVAQDGKVVAIAVSEHVENAGVHSGDATMVLPPQDINQVTMEKIRSICYRIGAALSVTGPFNMQLIAKDDQLKVIECNLRVSRSFPFVSKTLDTDFVAMATRVICG--LTVEPALDMDGRGRVGVKVPQFSFSRLAGADARLGVEMASTGEVACFGENRYEAFLKGLLSTGFRIPK--RSILLSIGSYKFKNELLPSVHTLRNLGYSLYASVGTADFYTEHGITVHAVDWPFADANNGNGNGATTEG-EQSIADYLSQNMIDLFINLPLRSNPGKKVSSFMTRGYQTRRMAIDYSVPLITDVKCAKLFVEALKRVCGAPKL---KTNIDIISTARIVRLPGLIDVHVHLREPGATHKEDFASGTAAALAGGITMVLAMPNTNPPLVDEESFNLAKKLGTAGARCDYALYLGAGPTNYTMLKDIAHRAAGLKMYLNETFTTLRLDDLTIWMKHLENWPLHMPIVCHAEGRTTAAILLLAELADRPVHIAHVARKEEIMVIRAAKERGLAVTCEVAPHH 1651          

HSP 2 Score: 883.248 bits (2281), Expect = 0.000e+0
Identity = 478/776 (61.60%), Postives = 579/776 (74.61%), Query Frame = 2
Query:   41 GALILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLINPLNNPEL--FIDPNERNLVEEVSINEIRHYNKNGNIHVCIIDCGVKNNQIRCFCKYGARVTVMP----YNATVNADEYDALFISNGPGDPVKCTETIETIKNWITSEKP--FMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVTAVK-SNTATVSLDQRLTNRLTYQHTQHELTLTALLENKPKKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
             +L L D +VY G LFGA K   GEVVFQTGMVGY ESL+DPSY +QLL+LTYP+IG+YG  + K  D+ GL  +FES KI A  LIV +Y  EYS+W A+ +LS WL + G+ GISGIDTR LTKK+RE G++ G       K++I+   +PE   F DPN  NLV+ VS      YN  G  H+  +DCG+K NQIRC    GA V V+P    +N  V   ++D +F+SNGPGDP  C   I+ I+  I  + P    GICLGHQLL+LA+GCK+ KMKYGNRGHN PCTH  T RCF+T+QNHGFA+  +SIP +W  LF N ND++NEGIIH  LPF SVQFHPEHM GP D+E LF +F+E V   K    + +S+ +R+  +  ++           +E KPKK+LILGSGGLSIGQAGEFDYSG+QA+KAL+EE IQTV+VNPNIATVQTT G++DK Y LPIT DYVT+VI  ERPDG+ L FGGQTALNCGIEL + GV  +Y V VLGT ++ I  TEDR+ F+E L EI E VAPS A ++V E + AA +LGYPVM+RAAFALGG+GSGFA++  EL  LAS A A++ Q+++DKSL+GWKEIEYEVVRD YDNCITVCNMENVDPLGIHTGES+VVAPSQTL+N EY MLR  A+KV+++LGVVGECNIQYAL+P+S +Y+IIEVNARLSRSSALASKATGYPLAYVAAKL LG  L  LRNSVT  TTACFEPS+DY VVKIPRWDL+KF++V  KI S M
Sbjct:    2 ASLFLDDGSVYRGKLFGAAKNVPGEVVFQTGMVGYPESLTDPSYQAQLLILTYPLIGNYGAPEAKQ-DKHGLDLNFESHKIWAAALIVGDYIEEYSHWNAKRSLSTWLTEQGIPGISGIDTRALTKKIREKGTMLG-------KIVIDG-TDPETVPFHDPNLENLVDIVSCKIPTVYNPQGTPHIIALDCGIKYNQIRCLVSRGACVKVVPWSHDFNPEVKNGDFDGVFLSNGPGDPSYCMAAIDNIRQHIHDKNPIPLFGICLGHQLLSLAVGCKSFKMKYGNRGHNIPCTHHGTNRCFITTQNHGFAIDTTSIPKDWSTLFTNANDQTNEGIIHNTLPFFSVQFHPEHMGGPRDLECLFDIFLETVKQYKLGKVSDMSVKERIQQQFMFKPVNP-------VETKPKKVLILGSGGLSIGQAGEFDYSGSQAIKALKEECIQTVVVNPNIATVQTTKGLSDKVYFLPITADYVTQVIHSERPDGILLAFGGQTALNCGIELRDRGVLDEYNVKVLGTPVDAIVCTEDRKMFAEKLLEIDEHVAPSEAVFSVDEALAAAGRLGYPVMVRAAFALGGMGSGFADDKEELTQLASMALANSKQLIIDKSLKGWKEIEYEVVRDAYDNCITVCNMENVDPLGIHTGESIVVAPSQTLTNSEYNMLRSTAIKVIKHLGVVGECNIQYALNPDSQEYFIIEVNARLSRSSALASKATGYPLAYVAAKLALGRPLPVLRNSVTNSTTACFEPSLDYVVVKIPRWDLSKFSRVSTKIGSCM 761          

HSP 3 Score: 136.732 bits (343), Expect = 5.275e-32
Identity = 109/392 (27.81%), Postives = 182/392 (46.43%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHRE------KIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAV--AYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDN--LLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRG----------EP--NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            +++LGSG   IG + EFD+   + IK L+    +T++VN N  TV T   + D ++F  ++ + V  + H E+PDG++++ GGQ   N  + L          + + GT    I   E+R  F+  L  I       + +   + A+     + YP +VR ++ L G     A  + +LT+  + A+A +K   ++I K ++  KEI+ + V  AY    +     E+V+  GIH+G++ +V P Q +       +     ++ + L V G  N+Q     D+    +IE N R+SRS    SKA GY +   A +  +  P  +    LR           EP  + V VK+P +  ++       +G  M S GEV   G    EA  KA
Sbjct:  397 VLILGSGGLSIGQAGEFDYSGSQAIKALKEECIQTVVVNPNIATVQTTKGLSDKVYFLPITADYVTQVIHSERPDGILLAFGGQTALNCGIELRDRGVLDEYNVKVLGTPVDAIVCTEDRKMFAEKLLEIDEHVAPSEAVFSVDEALAAAGRLGYPVMVRAAFALGGMGSGFADDKEELTQLASMALANSKQ--LIIDKSLKGWKEIEYEVVRDAY-DNCITVCNMENVDPLGIHTGESIVVAPSQTLTNSEYNMLRSTAIKVIKHLGVVGECNIQYALNPDSQEYFIIEVNARLSRSSALASKATGYPLAYVAAKLALGRPLPV----LRNSVTNSTTACFEPSLDYVVVKIPRWDLSKFSRVSTKIGSCMKSVGEVMAIGRRFEEALQKA 781          

HSP 4 Score: 91.6633 bits (226), Expect = 2.656e-18
Identity = 74/276 (26.81%), Postives = 132/276 (47.83%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLD-LASAAF-AHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVN 2113
            EFD      ++ L++ G QT++VN N  TV T     D+ Y   I+ + V ++ + E+P+G+ L+ GGQ   N  + L         +  + GTS E I   E+R +FS +L+ I           TV+   +   ++ YP ++R ++ L G     A + T+L + L S  F +    V++ K ++  KEI+ + V       + +   E+V+  G+H+G++ +V P Q ++      +R    ++   L V G  N+Q  L     +  +IE N
Sbjct:  954 EFDCCAVGCIRELKKLGKQTIMVNYNPETVSTDYDECDRLYFDEISFESVMDIYQREKPEGIILSMGGQLPNNIAMPLHRQ------EARIFGTSPEYIDNAENRFKFSRLLDNIGILQPQWKELTTVESAKEFCHKVSYPCLVRPSYVLSGAAMIVAYSDTDLENYLGSEVFLSRDHPVVISKFIQEAKEIDVDAVAQ-DGKVVAIAVSEHVENAGVHSGDATMVLPPQDINQVTMEKIRSICYRIGAALSVTGPFNMQ--LIAKDDQLKVIECN 1220          
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Nematostella
Match: EDO33367 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSG4])

HSP 1 Score: 773.081 bits (1995), Expect = 0.000e+0
Identity = 421/772 (54.53%), Postives = 542/772 (70.21%), Query Frame = 2
Query:   41 GALILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLINPLNNPELFIDPNERNLVEEVSINEIRHYNKNGNIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNADEYDALFISNGPGDPVKCTETIETIKNWITSEK--PFMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVTAVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKPKKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTTM---GVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
             +LIL D T   G  FG      GEVVF TG+VGY E+L+DPSY+ Q+L LTYPI+G+YGV D K +DQ+GL K  ES+K+  +GL+V +YS EYS+W A  +LS+WL +  V  + GIDTR LTK +RE G++ G I            N P  FI+PN RNL  EVS    + Y K   + +  +DCG+K N IR   + GA V V+P+N   + +EYD LF+SNGPGDP   T+ I  ++  I  ++  P  GIC+G+QL++LA G KT K+  GNRGHNQP  +  T + F+TSQNHG+AV  +++P +W+ +F N ND SNEGI+H   P ++ QFHPEH  GPTD E LF  FI  V   KS    + L  + T R                  + KK+L+LGSGGLSIGQAGEFDYSG+QA+KAL+EE I+TVL+NPNIA+VQT       AD  Y +P+T +++ +VIK ERPDGV L+ GGQTALNCG++L + G+F+ Y V VLGT IE+IK TEDRQ F+  L+EI E++APS+A Y+V+E + AA+++ YPVM+RAA+ALGGLGSG   N  +L  LA  A A   Q+L+++SL GWKE+EYEVVRD  +NCITVCNMEN DPLG+HTG+SVVVAPSQTLSN EY+MLR+ A+KVVR+ G+VGECNIQYAL P S +Y IIE+NARLSRSSALASKATGYPLA++AAKL LG+ L  ++N+ T VTTACFEPS+DY V KIPRWDL++F     +I SSM
Sbjct:    1 ASLILEDGTRLEGFSFGKPVSTSGEVVFNTGLVGYPEALTDPSYYGQILTLTYPILGNYGVPDTKAVDQYGLLKYVESSKVQVSGLLVQDYSHEYSHWNAVKSLSEWLTEENVPALYGIDTRMLTKFVREKGTVLGKI---------QFENQPIDFINPNLRNLTAEVSTRYFKVYGKGNALKIIAVDCGIKENIIRNLVQRGAEVHVVPWNYDYSQEEYDGLFLSNGPGDPATTTDAINNLRKVINGDRNEPIFGICMGNQLVSLAAGAKTFKLPLGNRGHNQPVINRLTGQAFITSQNHGYAVDEATLPRDWKPIFVNANDGSNEGIMHTSKPIVTAQFHPEHFGGPTDTEFLFDAFISMVRDGKSPVEAMRLPSKPTER-----------------KQLKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEENIETVLMNPNIASVQTNEVGEKQADTVYFVPVTSEFIEDVIKRERPDGVLLSMGGQTALNCGVDLYDKGIFQKYNVQVLGTPIESIKATEDRQIFANRLKEINEKLAPSVAVYSVEEAVKAAKKIKYPVMVRAAYALGGLGSGLCENEAKLRALAKKALAIAPQILIEQSLLGWKEVEYEVVRDAANNCITVCNMENFDPLGVHTGDSVVVAPSQTLSNQEYHMLRETAIKVVRHFGIVGECNIQYALHPTSLEYCIIEINARLSRSSALASKATGYPLAFIAAKLALGIELPDIKNATTQVTTACFEPSLDYIVTKIPRWDLDRFQMTPKEIGSSM 746          

HSP 2 Score: 173.326 bits (438), Expect = 0.000e+0
Identity = 94/199 (47.24%), Postives = 130/199 (65.33%), Query Frame = 3
Query: 2346 SVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYVEKFT-------ESGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKIIKCLNELEE--PRTYLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEF 2915
            SVGE+M++GR FEE+ QKALRMV   + GF   V   +       +  L  P++ RM  +A AL++G SV+ I +LT ID WFL K  +IIK   +++   P T L  D L+ AK +GFSD Q+A  + + E+++R+ RI  GV P V QIDT++AE+P  TNYLY++Y+G +HD+ F+   IMVLG G Y IGSSVEF
Sbjct:  748 SVGEVMAIGRTFEESLQKALRMVHPSVDGFISKVPDLSVKWASNLDEALRVPSNTRMYSIARALEEGYSVERINELTAIDPWFLCKLERIIKLEKDIKNTSPET-LPLDTLVYAKKMGFSDRQMARLMATDELSMRKNRIAKGVTPWVKQIDTMAAEYPASTNYLYMTYNGQEHDLVFDEHGIMVLGCGPYHIGSSVEF 945          

HSP 3 Score: 118.627 bits (296), Expect = 8.802e-27
Identity = 104/415 (25.06%), Postives = 185/415 (44.58%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTD---YDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLH------REKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVA-YGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNL--LVIECNLRVSRSFPFVSKALGYNM---------------IAAATRAIMSEPFSLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFIS 4028
            ++VLGSG   IG + EFD+   + IK L+    +T+++N N  +V T+       D ++F  ++ E + D+   E+PDGV++SMGGQ   N  + L+      +  + + GT    I   E+R  F+  L  I         +   E A+     ++YP +VR +Y L G    +  +E+ L     +A+A+     ++I + +   KE++ + V       +     E+ +  G+H+GD+ +V P Q ++ +    + +   ++ +   + G  N+Q      +L   +IE N R+SRS    SKA GY +               I  AT  + +  F    ++       +  K+P +   R       +G  M S GEV   G    E+  KA     +++  P  + FIS
Sbjct:  379 VLVLGSGGLSIGQAGEFDYSGSQAIKALKEENIETVLMNPNIASVQTNEVGEKQADTVYFVPVTSEFIEDVIKRERPDGVLLSMGGQTALNCGVDLYDKGIFQKYNVQVLGTPIESIKATEDRQIFANRLKEINEKLAPSVAVYSVEEAVKAAKKIKYPVMVRAAYALGGLGSGLCENEAKLRALAKKALAIAPQ--ILIEQSLLGWKEVEYEVVRDAANNCITVCNMENFDPLGVHTGDSVVVAPSQTLSNQEYHMLRETAIKVVRHFGIVGECNIQYALHPTSLEYCIIEINARLSRSSALASKATGYPLAFIAAKLALGIELPDIKNATTQVTTACFEPSLDY-------IVTKIPRWDLDRFQMTPKEIGSSMKSVGEVMAIGRTFEESLQKA-----LRMVHPSVDGFIS 779          
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Nematostella
Match: EDO43751 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXC8])

HSP 1 Score: 415.616 bits (1067), Expect = 2.351e-130
Identity = 224/479 (46.76%), Postives = 311/479 (64.93%), Query Frame = 3
Query: 2970 IMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRGEPNK----VAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGS-YKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDWDTGNQASSDSKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQAL 4391
            ++VN NPETVSTDYD CD L+FEELSLE VLDI+  E  +G I+S+GGQ+PNN+A+ LH   + I GTSP+ ID AE R +FS ++D I + Q  W+ L   + A++F   V YPCL+RPS+VLSG+AMNVA+   DL  +L++A  V++DHPVVI+KF+  A+E+++DAVA  G ++  A+SEHVENAG+HSGDATL+ PPQ++    + KI ++ ++IA+   +SGPFNMQ + KD+ ++VIECNLR SRSFPFVSK +G + I  AT+ +++ P  L+       P +    V +K PMFS+ RL  AD LL  EM STGEVACFG   N AFL A L+ G KIP    N+ I I   ++H  E L +  +L  +GY L+A+  T+ +  +  I    V W    +    +  +  S    E K+D++INLP +N+        + + Y  RR AID GI L+TN + TKL  QAL
Sbjct:   12 VVVNNNPETVSTDYDECDRLYFEELSLERVLDIYQTEGCEGAIISVGGQIPNNLALPLHNNGVKILGTSPLSIDAAEERSRFSEIMDEIEVNQAPWRALYAVDDALDFAAHVGYPCLLRPSFVLSGSAMNVAYGPEDLKRFLSEAARVSQDHPVVITKFVTGAREVEMDAVAKRGHVVCHAISEHVENAGVHSGDATLILPPQNIRSDDIAKIKEVTSKIAKRFNISGPFNMQFLVKDNRVMVIECNLRASRSFPFVSKTIGKDFIECATKIMVNHPQDLKAFPDLNTPLQPQGFVGIKAPMFSWPRLRDADPLLRCEMASTGEVACFGRTVNSAFLMALLSTGFKIPE--KNVMIGIQQDFQH--EFLPTANKLHRMGYKLFATDATSKYLKDHNIPAQTVSWPLHPEGEYPNAGRLIS----EKKIDMVINLPNQNTK------YVKDNYIIRRAAIDNGIPLITNFEVTKLLAQAL 476          

HSP 2 Score: 108.227 bits (269), Expect = 3.444e-24
Identity = 78/259 (30.12%), Postives = 133/259 (51.35%), Query Frame = 2
Query: 1352 VLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQ---VLVDKSLRGWKEIEYEVVRDVYDNCITVCNM--ENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVN 2113
            V+VN N  TV T     D+ Y   ++ + V ++ + E  +G  ++ GGQ   N  + L  +GV       +LGTS  +I   E+R RFSEI++EI+   AP  A Y V + +D A  +GYP ++R +F L G     A  P +L    S A A  SQ   V++ K + G +E+E + V         VC+   E+V+  G+H+G++ ++ P Q + + +   +++   K+ +   + G  N+Q+ +  N  +  +IE N
Sbjct:   12 VVVNNNPETVSTDYDECDRLYFEELSLERVLDIYQTEGCEGAIISVGGQIPNNLALPLHNNGV------KILGTSPLSIDAAEERSRFSEIMDEIEVNQAPWRALYAVDDALDFAAHVGYPCLLRPSFVLSGSAMNVAYGPEDLKRFLSEA-ARVSQDHPVVITKFVTGAREVEMDAVA---KRGHVVCHAISEHVENAGVHSGDATLILPPQNIRSDDIAKIKEVTSKIAKRFNISGPFNMQFLVKDN--RVMVIECN 258          
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Nematostella
Match: EDO29083 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4N0])

HSP 1 Score: 392.504 bits (1007), Expect = 1.762e-113
Identity = 219/342 (64.04%), Postives = 269/342 (78.65%), Query Frame = 2
Query: 1070 MSGPTDMELLFQVFIEHVTAVK-SNTATVSLDQRLTNRLTYQHTQHELTLTALLENKPKKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHK 2092
            M GP D+E LF +F+E V   K    + +S+ +R+  +  ++           +E KPKK+LILGSGGLSIGQAGEFDYSG+QA+KAL+EE IQTV+VNPNIATVQTT G++DK Y LPIT DYVT+VI  ERPDG+ L FGGQTALNCGIEL + GV  +Y V VLGT ++ I  TEDR+ F+E L EI E VAPS A ++V E + AA +LGYPVM+RAAFALGG+GSGFA++  EL  LAS A A++ Q+++DKSL+GWKEIEYEVVRD YDNCITVCNMENVDPLGIHTGES+VVAPSQTL+N EY MLR  A+KV+++LGVVGECNIQYAL+P+S +
Sbjct:    1 MGGPRDLECLFDIFLETVKQYKLGKVSDMSVKERIQQQFMFKPVNP-------VETKPKKVLILGSGGLSIGQAGEFDYSGSQAIKALKEECIQTVVVNPNIATVQTTKGLSDKVYFLPITADYVTQVIHSERPDGILLAFGGQTALNCGIELRDRGVLDEYNVKVLGTPVDAIVCTEDRKMFAEKLLEIDEHVAPSEAVFSVDEALAAAGRLGYPVMVRAAFALGGMGSGFADDKEELTQLASMALANSKQLIIDKSLKGWKEIEYEVVRDAYDNCITVCNMENVDPLGIHTGESIVVAPSQTLTNSEYNMLRSTAIKVIKHLGVVGECNIQYALNPDSQE 335          

HSP 2 Score: 291.197 bits (744), Expect = 4.050e-80
Identity = 159/324 (49.07%), Postives = 218/324 (67.28%), Query Frame = 3
Query: 4035 SYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDWDTGNQASSDSKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQALRKAIYKKKICVASPTIDCITSQKIYRFPGLVDIHVHTRDPGQVHKEDWSTVTKXXXXXXXXXXFAMPNTAPPITNLESFELAKKRASSLAHCDYGLYVGASNDNWESLAELAPEAIGLKMYLNPTFSTLQMNNFSTWAKHFKHFPENRPICCHAEGETMAAVILLAQLHNRHVHICHVSRKQEIELIRLAKSQGLKVTCEVSPHH 5006
            S + K ELL SV  L +LGY+LYAS+GTADFY E GI+                           + +DL INLP R++  ++ S  +T GY+ RR+AIDY + L+T+VKC KLFV+AL++     K+      ID I++ +I R PGL+D+HVH R+PG  HKED+++ T AA+AGGIT + AMPNT PP+ + ESF LAKK  ++ A CDY LY+GA   N+  L ++A  A GLKMYLN TF+TL++++ + W KH +++P + PI CHAEG T AA++LLA+L +R VHI HV+RK+EI +IR AK +GL VTCEV+PHH
Sbjct:  785 SAEFKNELLPSVHTLRNLGYSLYASVGTADFYTEHGIT---------------------------NMIDLFINLPLRSNPGKKVSSFMTRGYQTRRMAIDYSVPLITDVKCAKLFVEALKRVCGAPKL---KTNIDIISTARIVRLPGLIDVHVHLREPGATHKEDFASGTAAALAGGITMVLAMPNTNPPLVDEESFNLAKKLGTAGARCDYALYLGAGPTNYTMLKDIAHRAAGLKMYLNETFTTLRLDDLTIWMKHLENWPLHMPIVCHAEGRTTAAILLLAELADRPVHIAHVARKEEIMVIRAAKERGLAVTCEVAPHH 1078          

HSP 3 Score: 217.624 bits (553), Expect = 5.288e-57
Identity = 117/221 (52.94%), Postives = 143/221 (64.71%), Query Frame = 3
Query: 2616 EEPRTYLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSE 3278
            +E +  ++ + LL AK LGFSD QIA+ V STE+AVR+LR E+ + P + QIDTV+AE+P  TNYLYL+Y+  + D+ F G  +MVLGSGVYRIGSSVEFD CAV CI+EL+++ K+TIMVN NPETVSTDYD CD             D    E                           IFGTSP  IDNAENRFKFSR+LD+IGI QP+WKELT  E
Sbjct:  401 KEKKPEVTYNHLLEAKRLGFSDKQIAKCVHSTELAVRKLREEMKLTPFIKQIDTVAAEYPACTNYLYLTYNAQEDDLGFPGNAMMVLGSGVYRIGSSVEFDCCAVGCIRELKKLGKQTIMVNYNPETVSTDYDECDR---------LYFDEISFEA-------------------------RIFGTSPEYIDNAENRFKFSRLLDNIGILQPQWKELTTVE 587          

HSP 4 Score: 101.679 bits (252), Expect = 1.958e-21
Identity = 76/283 (26.86%), Postives = 137/283 (48.41%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHRE------KIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAV--AYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDN 3689
            +++LGSG   IG + EFD+   + IK L+    +T++VN N  TV T   + D ++F  ++ + V  + H E+PDG++++ GGQ   N  + L          + + GT    I   E+R  F+  L  I       + +   + A+     + YP +VR ++ L G     A  + +LT+  + A+A +K   ++I K ++  KEI+ + V  AY    +     E+V+  GIH+G++ +V P Q +       +     ++ + L V G  N+Q     D+
Sbjct:   54 VLILGSGGLSIGQAGEFDYSGSQAIKALKEECIQTVVVNPNIATVQTTKGLSDKVYFLPITADYVTQVIHSERPDGILLAFGGQTALNCGIELRDRGVLDEYNVKVLGTPVDAIVCTEDRKMFAEKLLEIDEHVAPSEAVFSVDEALAAAGRLGYPVMVRAAFALGGMGSGFADDKEELTQLASMALANSKQ--LIIDKSLKGWKEIEYEVVRDAY-DNCITVCNMENVDPLGIHTGESIVVAPSQTLTNSEYNMLRSTAIKVIKHLGVVGECNIQYALNPDS 333          

HSP 5 Score: 55.8398 bits (133), Expect = 1.768e-7
Identity = 26/37 (70.27%), Postives = 29/37 (78.38%), Query Frame = 3
Query: 3678 KDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAI 3788
            +DD L VIECNLRVSRSFPFVSK L  + +A ATR I
Sbjct:  587 EDDQLKVIECNLRVSRSFPFVSKTLDTDFVAMATRVI 623          
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Nematostella
Match: EDO25883 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TDG2])

HSP 1 Score: 185.652 bits (470), Expect = 2.904e-52
Identity = 108/274 (39.42%), Postives = 160/274 (58.39%), Query Frame = 3
Query: 2346 SVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYVEKFTESGLS-------SPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKIIKCLNELEE-PRTYLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGL 3143
            SVGE+M++GR  +E+ QKALR ++    GFDP V+  +E   S        P   R+  L +A + G+SV E+Y+++ ID WFL +   +IK    + E   + L  D +   K  GFSD ++A  +  +E   R+ R  + +RP+  ++DT +AE+   T Y+Y +Y      +  +   IMV+G G  RIG  +EFD+C V      +    +TIMVNCNPETVSTDYD  D L+FE ++LE VL+I ++E+P GVIV  GGQ P  +A+ L
Sbjct:   23 SVGEVMAIGRTQQESLQKALRGLEVGATGFDPIVDLKSEDARSDIVREMKQPGAERIWYLGDAFRLGMSVDELYEISGIDPWFLVQVEDLIKEEQRVAEMALSDLDADAIFRLKRKGFSDARLATLLGVSEKQFRKHRQAMNIRPVFKRVDTCAAEFATDTAYMYSTYEEECEAVPTDRQKIMVIGGGPNRIGQGIEFDYCCVHAALAAREAGFETIMVNCNPETVSTDYDTSDRLYFEPITLEDVLEIVNVEKPAGVIVQFGGQTPLKLAVAL 296          

HSP 2 Score: 68.5514 bits (166), Expect = 3.247e-12
Identity = 35/81 (43.21%), Postives = 47/81 (58.02%), Query Frame = 2
Query: 1283 QAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIEL 1525
            Q  EFDY    A  A RE G +T++VN N  TV T    +D+ Y  PIT + V E++ +E+P GV + FGGQT L   + L
Sbjct:  216 QGIEFDYCCVHAALAAREAGFETIMVNCNPETVSTDYDTSDRLYFEPITLEDVLEIVNVEKPAGVIVQFGGQTPLKLAVAL 296          
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Medaka
Match: cad (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:ZFIN;Acc:ZDB-GENE-021030-4])

HSP 1 Score: 901.353 bits (2328), Expect = 0.000e+0
Identity = 474/767 (61.80%), Postives = 589/767 (76.79%), Query Frame = 2
Query:   47 LILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLINPLNNPELFIDPNERNLVEEVSINEIRHYNKNGNIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNADEYDALFISNGPGDPVKCTETIETIKNWITSE--KPFMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVTAVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKPKKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
            LIL D T + G LFGA     GEVVFQTGMVGY E+L+DPSY  QLL LTYP++G+YGV  D+   ++GL + FES KI A  L++ E S   S+W++  +L +WL++HGV G+ G+DTR LTKK+RE G++ G +V         PL+NP+      +RNLV+EVS+ E + +N +G++ +  +DCG+K NQIRC  + GARVTV+P++  ++ D++D LFISNGPGDP  C  TI  I+  +  +  KP  GICLGHQLL+L IG +T+KMKYGNRGHNQPC H  T RCF+TSQNHGFAV   ++P +W  LF N ND +NEGI+H+  P  SVQFHPEH +GPTD+  LF VF++ V   K      S+ QRL + LTY  +     +      +PKK+LILGSGGLSIGQAGEFDYSG+QA+KAL+EE IQTVL+NPNIATVQT+ G+ADK Y LPIT +YVT+VIK ERPDGV LTFGGQTALNCG++L + GV + Y V VLGT + +I+MTEDR+ F E +EEI E VAPS AA +V++ + AAE+LGYPV++R+AFALGGLGSGFAN   EL  L ++AFAHTSQVLVDKSL+GWKEIEYEVVRD YDNC+TVCNMEN+DPLGIHTGES+VVAPSQTL+++EY MLR  A+KV+R+LG+VGECNIQYAL+P S +YYIIEVNARLSRSSALASKATGYPLAYVAAKLGLG+ L  L+NSVT  TTA FEPS+DYCVVK+PRWDL+KF +V  KI SSM
Sbjct:    7 LILEDGTAFSGRLFGANVSVSGEVVFQTGMVGYPEALTDPSYRCQLLTLTYPLVGNYGVPKDEA-GEFGLSRWFESRKIQAAALVIGELSENPSHWSSVKSLDEWLKEHGVPGLQGVDTRRLTKKIREKGTMLGKLVVDGTPEDGVPLDNPD------QRNLVQEVSMKEPKVFNPDGSLRITAVDCGIKYNQIRCLARRGARVTVVPWDHPLDVDDFDGLFISNGPGDPRFCQATISNIRKVVCVDRPKPVFGICLGHQLLSLVIGARTYKMKYGNRGHNQPCVHTGTGRCFITSQNHGFAVDPDTLPKDWDVLFTNANDHTNEGIVHRTKPIFSVQFHPEHSAGPTDLVSLFDVFLQTVKDHKDGNTQKSVKQRLMDHLTYPGSLKPEDVI-----RPKKVLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTVLINPNIATVQTSKGLADKVYFLPITAEYVTQVIKNERPDGVLLTFGGQTALNCGVDLTKLGVLEKYNVRVLGTPVASIEMTEDRKVFVEKMEEINEHVAPSEAALSVEQAVAAAERLGYPVLVRSAFALGGLGSGFANTREELTSLVTSAFAHTSQVLVDKSLKGWKEIEYEVVRDAYDNCVTVCNMENIDPLGIHTGESIVVAPSQTLNDHEYNMLRNTAIKVIRHLGIVGECNIQYALNPESDQYYIIEVNARLSRSSALASKATGYPLAYVAAKLGLGIPLPQLKNSVTNSTTANFEPSLDYCVVKVPRWDLSKFLRVSTKIGSSM 761          

HSP 2 Score: 239.58 bits (610), Expect = 2.301e-64
Identity = 116/205 (56.59%), Postives = 154/205 (75.12%), Query Frame = 3
Query: 2346 SVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYVEKFTESGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKIIKCLNELEEPRTYLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMK 2960
            SVGE+M++GR FEEAFQKALRMVDE   GFD  ++  +++ L +PTD+R+ VLA ALK G +V ++Y LTKID WFL+K   I      LE   TY        AK LGFSD QIA+AV+STE+AVR++R +  + P+V QIDTV+AEWP YTNYLYL+Y G ++D++F+  ++MV+GSGVYRIGSSVEFDWCAV CI +L++++
Sbjct:  763 SVGEVMAIGRCFEEAFQKALRMVDENCVGFDHTIKPVSDNELQTPTDKRIFVLAAALKAGYTVDQLYQLTKIDRWFLHKMKNISDHERLLE---TYN------QAKQLGFSDKQIAQAVQSTELAVRKMRRDWSILPVVKQIDTVAAEWPAYTNYLYLTYHGTENDLSFQEPHVMVIGSGVYRIGSSVEFDWCAVGCITKLRKVR 958          

HSP 3 Score: 141.354 bits (355), Expect = 2.422e-33
Identity = 111/391 (28.39%), Postives = 181/391 (46.29%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMG------LHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAV--AYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQ--LIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPF---------SLECEFLRGEP--NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            +++LGSG   IG + EFD+   + IK L+    +T+++N N  TV T   + D ++F  ++ E V  +   E+PDGV+++ GGQ   N  +       L +  + + GT    I+  E+R  F   ++ I       +     E A+     + YP LVR ++ L G     A +  +LT  +T A A      V++ K ++  KEI+ + V  AY    +     E+++  GIH+G++ +V P Q +N+     +     ++ + L + G  N+Q  L  + D   +IE N R+SRS    SKA GY +   A +  +  P          S    F   EP  +   VKVP +  ++       +G  M S GEV   G    EAF KA
Sbjct:  397 VLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTVLINPNIATVQTSKGLADKVYFLPITAEYVTQVIKNERPDGVLLTFGGQTALNCGVDLTKLGVLEKYNVRVLGTPVASIEMTEDRKVFVEKMEEINEHVAPSEAALSVEQAVAAAERLGYPVLVRSAFALGGLGSGFANTREELTSLVTSAFAHTSQ--VLVDKSLKGWKEIEYEVVRDAY-DNCVTVCNMENIDPLGIHTGESIVVAPSQTLNDHEYNMLRNTAIKVIRHLGIVGECNIQYALNPESDQYYIIEVNARLSRSSALASKATGYPLAYVAAKLGLGIPLPQLKNSVTNSTTANF---EPSLDYCVVKVPRWDLSKFLRVSTKIGSSMKSVGEVMAIGRCFEEAFQKA 781          
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Medaka
Match: cps1 (carbamoyl-phosphate synthase 1 [Source:NCBI gene;Acc:101164854])

HSP 1 Score: 752.281 bits (1941), Expect = 0.000e+0
Identity = 410/788 (52.03%), Postives = 545/788 (69.16%), Query Frame = 2
Query:   20 KFSRRMKGA-LILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLINPLNNPELFIDPNERNLVEEVSINEIRHYNKNGNIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNADEYDALFISNGPGDPVKCTETIETIKNWITSEKP--FMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVTAVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKP--------KKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTT---MGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
            +FS + + A L+L D T   G  FG      GE+VF TG+VGY E+L+DPSY  Q+L LTYPI+G+YGV + + LD+ GL K  ES +I  +GL+V +YS EYS+W +  +L QWL++  V  + GIDTR LTK +R+ G++ G       K+  +    P    DPN++NLV EVS  E + + K   + V  +DCGVK+N IR   K GA V ++P+N  + + +YD LFISNGPGDP      I  ++  + S++P    GIC+G+Q+ ALA G K++K+  GNRG NQP  ++ T + F+T+QNHG+ + + S+P  W  LF N ND +NEGI+H   P  + QFHPE   GPTD E LF  FI  +   K                       +  + +++  KP         K+L+LGSGGLSIGQAGEFDYSG+QA+KA++EE ++TVL+NPNIA+VQT       AD  Y LP+T ++VTEVIK ERPDG+ L+ GGQTALNCG+EL +SG+ + Y+V VLGT +E+I  TEDRQ F++ L +I E++APS A  +V + + AAEQ+GYPVM+R+A+ALGGLGSG   N  +L + A  A A +SQ+LV++SL GWKE+EYEVVRDV DNC+TVCNMEN DPLGIHTG+S+VVAPSQTLSN EY+MLR+ A+KVVR+LG+VGECNIQYAL P+S +Y IIEVNARLSRSSALASKATGYPLA+VAAKL LG+ L  ++N+V+  TTACFEPS+DY V KIPRWDL++F  +  +I S+M
Sbjct:   38 RFSLKAQTARLVLEDGTSMKGFSFGHTASVAGELVFNTGLVGYPEALTDPSYRGQILTLTYPIVGNYGVPNTEELDELGLRKHVESERIQVSGLLVQDYSHEYSHWNSVKSLGQWLQEEKVPALFGIDTRMLTKIIRDKGTVLG-------KIEFD--GQPVDITDPNQKNLVAEVSTKETKVFGKGNPVKVVAVDCGVKHNIIRLLVKRGAEVHLVPWNQDLLSLKYDGLFISNGPGDPSLAETLINNVRKVLDSDRPEPVFGICMGNQITALAAGAKSYKLPMGNRGQNQPVLNVMTGQAFITAQNHGYGIDSKSLPPGWSSLFINANDGTNEGIMHNSKPVFTAQFHPEAKGGPTDTEFLFDAFISMIKKGK-----------------------DANIVSVMPKKPCLPPRAQVSKVLVLGSGGLSIGQAGEFDYSGSQAIKAMKEENLKTVLMNPNIASVQTNEVGSKQADSVYFLPVTPEFVTEVIKAERPDGILLSMGGQTALNCGVELFQSGILEKYEVKVLGTPVESIIATEDRQLFADKLMQINEKIAPSFAVESVSDALKAAEQIGYPVMLRSAYALGGLGSGLCANKEKLEETAHKALAMSSQILVERSLLGWKEVEYEVVRDVADNCVTVCNMENFDPLGIHTGDSIVVAPSQTLSNEEYHMLRETAIKVVRHLGIVGECNIQYALHPSSLEYCIIEVNARLSRSSALASKATGYPLAFVAAKLALGIPLPEIQNAVSEKTTACFEPSLDYIVTKIPRWDLDRFQGMSREIGSAM 793          

HSP 2 Score: 603.979 bits (1556), Expect = 0.000e+0
Identity = 325/700 (46.43%), Postives = 453/700 (64.71%), Query Frame = 3
Query: 2346 SVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYV--------EKFTESGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKIIKCLNELEEPRT-YLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPF------SLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDWDTGNQASSDSKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQALRKA 4400
            SVGE+M+VGR FEE+ QKALRM    + GF P +            +  L+ P+  R+  LA AL QG+SV EI+ LT ID WFL+K  +I    + L+  ++  + +++LL AK  GFSD QI   +   E   R+LR+  G+RP V QIDT++AE+P  TNYLY +Y+G +HD+ F+   IMVLG G Y IGSSVEFDWCAV  I+ L+++ KKT++VN NPETVSTD+D CD L+FEEL+LE +LDI   E   G IVS+GGQ+PNN+A+ LH   + I GTSP+ ID AE R  FSR+LD + + Q  W+ L+  E A  F N V YPCL+RPSYVLSG+AMNVA+ E ++  +L +A  V+++HPVVI+KF+  A+E++VDAVA  GK+L  A++EHVE+AG+HSGDATL+ P Q +++  L+K+     +IAQ  ++SGPFN Q + KD++++VIECNLR SRSFPFVSK +G + I  AT+ ++ EP       SL+  F+    + V +K PMFS+ RL  AD +L  EM STGEVACFG +   AFLKA L+ G K+P+ G  I I I     +   L +  QL   G+ LYA+  T+ +   + +    V W T       ++  T    I E ++DL++NLP  N+   + + +I      RR+AID+G+ L+TN +  KLF +A+R A
Sbjct:  795 SVGEVMAVGRTFEESIQKALRMCHPSVDGFVPQLPLKKAWADTHDLQQELAVPSSTRIFSLAKALHQGMSVGEIHQLTAIDKWFLHKLQRITHLEHHLKTYKSNTIPRELLLKAKQDGFSDKQIGRILGGNETGTRELRLARGIRPWVKQIDTLAAEYPAMTNYLYCTYNGQEHDLDFQDKGIMVLGCGPYHIGSSVEFDWCAVSAIRALRQLGKKTVVVNHNPETVSTDFDECDRLYFEELTLERILDITQQEDCSGSIVSVGGQIPNNLAIPLHMSGVKILGTSPLQIDRAEERSVFSRILDELEVSQAPWRALSSLEDAFAFANQVGYPCLLRPSYVLSGSAMNVAYGEEEMKRFLEEATQVSQEHPVVITKFVRGAREVEVDAVAKDGKVLVHAITEHVEDAGVHSGDATLMLPTQTISQGALEKVKIATRKIAQAFEISGPFNTQFLVKDNDVMVIECNLRASRSFPFVSKTIGVDFINVATKVMVGEPLDESILPSLDKPFI--PVDYVGIKAPMFSWPRLRDADPVLRCEMASTGEVACFGPNIYSAFLKAMLSTGFKLPQKG--ILIGI-QQSFRPNFLATAHQLKEEGFKLYATEATSAWLCANDVPAIPVAWPTEKGV---TELPTIKGLINEGQIDLVVNLPNNNTRHLKDNFLI------RRMAIDHGVPLITNYQVVKLFAEAIRYA 1480          

HSP 3 Score: 121.709 bits (304), Expect = 4.100e-27
Identity = 100/390 (25.64%), Postives = 178/390 (45.64%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTD---YDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMG------LHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVA-YGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNL--LVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFS------LECEFLRGEP--NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            ++VLGSG   IG + EFD+   + IK ++    KT+++N N  +V T+       D ++F  ++ E V ++   E+PDG+++SMGGQ   N  +       L + ++ + GT    I   E+R  F+  L  I         +     A+     + YP ++R +Y L G    +  ++  L E   +A+A++    +++ + +   KE++ + V       +     E+ +  GIH+GD+ +V P Q ++ +    + +   ++ + L + G  N+Q      +L   +IE N R+SRS    SKA GY +   A +  +  P         E      EP  + +  K+P +   R  G    +G  M S GEV   G    E+  KA
Sbjct:  426 VLVLGSGGLSIGQAGEFDYSGSQAIKAMKEENLKTVLMNPNIASVQTNEVGSKQADSVYFLPVTPEFVTEVIKAERPDGILLSMGGQTALNCGVELFQSGILEKYEVKVLGTPVESIIATEDRQLFADKLMQINEKIAPSFAVESVSDALKAAEQIGYPVMLRSAYALGGLGSGLCANKEKLEETAHKALAMSSQ--ILVERSLLGWKEVEYEVVRDVADNCVTVCNMENFDPLGIHTGDSIVVAPSQTLSNEEYHMLRETAIKVVRHLGIVGECNIQYALHPSSLEYCIIEVNARLSRSSALASKATGYPLAFVAAKLALGIPLPEIQNAVSEKTTACFEPSLDYIVTKIPRWDLDRFQGMSREIGSAMKSVGEVMAVGRTFEESIQKA 813          

HSP 4 Score: 119.013 bits (297), Expect = 2.483e-26
Identity = 105/366 (28.69%), Postives = 172/366 (46.99%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAA--FAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNM-ENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKV-----CNKISSSMXKCW*NNV 2365
            EFD+    A++ALR+ G +TV+VN N  TV T     D+ Y   +T + + ++ + E   G  ++ GGQ   N  I L  SG      V +LGTS   I   E+R  FS IL+E++   AP  A  ++++    A Q+GYP ++R ++ L G     A    E+      A   +    V++ K +RG +E+E + V    D  + V  + E+V+  G+H+G++ ++ P+QT+S      ++    K+ +   + G  N Q+ +  N     +IE N R SRS    SK  G     VA K+ +G     L  S+       F P +DY  +K P +   +         C   S+    C+  N+
Sbjct:  992 EFDWCAVSAIRALRQLGKKTVVVNHNPETVSTDFDECDRLYFEELTLERILDITQQEDCSGSIVSVGGQIPNNLAIPLHMSG------VKILGTSPLQIDRAEERSVFSRILDELEVSQAPWRALSSLEDAFAFANQVGYPCLLRPSYVLSGSAMNVAYGEEEMKRFLEEATQVSQEHPVVITKFVRGAREVEVDAV--AKDGKVLVHAITEHVEDAGVHSGDATLMLPTQTISQGALEKVKIATRKIAQAFEISGPFNTQFLVKDND--VMVIECNLRASRSFPFVSKTIGVDFINVATKVMVGE---PLDESILPSLDKPFIP-VDYVGIKAPMFSWPRLRDADPVLRCEMASTGEVACFGPNI 1343          
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Medaka
Match: cps1 (carbamoyl-phosphate synthase 1 [Source:NCBI gene;Acc:101164854])

HSP 1 Score: 752.281 bits (1941), Expect = 0.000e+0
Identity = 410/788 (52.03%), Postives = 545/788 (69.16%), Query Frame = 2
Query:   20 KFSRRMKGA-LILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLINPLNNPELFIDPNERNLVEEVSINEIRHYNKNGNIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNADEYDALFISNGPGDPVKCTETIETIKNWITSEKP--FMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVTAVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKP--------KKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTT---MGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
            +FS + + A L+L D T   G  FG      GE+VF TG+VGY E+L+DPSY  Q+L LTYPI+G+YGV + + LD+ GL K  ES +I  +GL+V +YS EYS+W +  +L QWL++  V  + GIDTR LTK +R+ G++ G       K+  +    P    DPN++NLV EVS  E + + K   + V  +DCGVK+N IR   K GA V ++P+N  + + +YD LFISNGPGDP      I  ++  + S++P    GIC+G+Q+ ALA G K++K+  GNRG NQP  ++ T + F+T+QNHG+ + + S+P  W  LF N ND +NEGI+H   P  + QFHPE   GPTD E LF  FI  +   K                       +  + +++  KP         K+L+LGSGGLSIGQAGEFDYSG+QA+KA++EE ++TVL+NPNIA+VQT       AD  Y LP+T ++VTEVIK ERPDG+ L+ GGQTALNCG+EL +SG+ + Y+V VLGT +E+I  TEDRQ F++ L +I E++APS A  +V + + AAEQ+GYPVM+R+A+ALGGLGSG   N  +L + A  A A +SQ+LV++SL GWKE+EYEVVRDV DNC+TVCNMEN DPLGIHTG+S+VVAPSQTLSN EY+MLR+ A+KVVR+LG+VGECNIQYAL P+S +Y IIEVNARLSRSSALASKATGYPLA+VAAKL LG+ L  ++N+V+  TTACFEPS+DY V KIPRWDL++F  +  +I S+M
Sbjct:   38 RFSLKAQTARLVLEDGTSMKGFSFGHTASVAGELVFNTGLVGYPEALTDPSYRGQILTLTYPIVGNYGVPNTEELDELGLRKHVESERIQVSGLLVQDYSHEYSHWNSVKSLGQWLQEEKVPALFGIDTRMLTKIIRDKGTVLG-------KIEFD--GQPVDITDPNQKNLVAEVSTKETKVFGKGNPVKVVAVDCGVKHNIIRLLVKRGAEVHLVPWNQDLLSLKYDGLFISNGPGDPSLAETLINNVRKVLDSDRPEPVFGICMGNQITALAAGAKSYKLPMGNRGQNQPVLNVMTGQAFITAQNHGYGIDSKSLPPGWSSLFINANDGTNEGIMHNSKPVFTAQFHPEAKGGPTDTEFLFDAFISMIKKGK-----------------------DANIVSVMPKKPCLPPRAQVSKVLVLGSGGLSIGQAGEFDYSGSQAIKAMKEENLKTVLMNPNIASVQTNEVGSKQADSVYFLPVTPEFVTEVIKAERPDGILLSMGGQTALNCGVELFQSGILEKYEVKVLGTPVESIIATEDRQLFADKLMQINEKIAPSFAVESVSDALKAAEQIGYPVMLRSAYALGGLGSGLCANKEKLEETAHKALAMSSQILVERSLLGWKEVEYEVVRDVADNCVTVCNMENFDPLGIHTGDSIVVAPSQTLSNEEYHMLRETAIKVVRHLGIVGECNIQYALHPSSLEYCIIEVNARLSRSSALASKATGYPLAFVAAKLALGIPLPEIQNAVSEKTTACFEPSLDYIVTKIPRWDLDRFQGMSREIGSAM 793          

HSP 2 Score: 603.979 bits (1556), Expect = 0.000e+0
Identity = 325/700 (46.43%), Postives = 453/700 (64.71%), Query Frame = 3
Query: 2346 SVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYV--------EKFTESGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKIIKCLNELEEPRT-YLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPF------SLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDWDTGNQASSDSKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQALRKA 4400
            SVGE+M+VGR FEE+ QKALRM    + GF P +            +  L+ P+  R+  LA AL QG+SV EI+ LT ID WFL+K  +I    + L+  ++  + +++LL AK  GFSD QI   +   E   R+LR+  G+RP V QIDT++AE+P  TNYLY +Y+G +HD+ F+   IMVLG G Y IGSSVEFDWCAV  I+ L+++ KKT++VN NPETVSTD+D CD L+FEEL+LE +LDI   E   G IVS+GGQ+PNN+A+ LH   + I GTSP+ ID AE R  FSR+LD + + Q  W+ L+  E A  F N V YPCL+RPSYVLSG+AMNVA+ E ++  +L +A  V+++HPVVI+KF+  A+E++VDAVA  GK+L  A++EHVE+AG+HSGDATL+ P Q +++  L+K+     +IAQ  ++SGPFN Q + KD++++VIECNLR SRSFPFVSK +G + I  AT+ ++ EP       SL+  F+    + V +K PMFS+ RL  AD +L  EM STGEVACFG +   AFLKA L+ G K+P+ G  I I I     +   L +  QL   G+ LYA+  T+ +   + +    V W T       ++  T    I E ++DL++NLP  N+   + + +I      RR+AID+G+ L+TN +  KLF +A+R A
Sbjct:  795 SVGEVMAVGRTFEESIQKALRMCHPSVDGFVPQLPLKKAWADTHDLQQELAVPSSTRIFSLAKALHQGMSVGEIHQLTAIDKWFLHKLQRITHLEHHLKTYKSNTIPRELLLKAKQDGFSDKQIGRILGGNETGTRELRLARGIRPWVKQIDTLAAEYPAMTNYLYCTYNGQEHDLDFQDKGIMVLGCGPYHIGSSVEFDWCAVSAIRALRQLGKKTVVVNHNPETVSTDFDECDRLYFEELTLERILDITQQEDCSGSIVSVGGQIPNNLAIPLHMSGVKILGTSPLQIDRAEERSVFSRILDELEVSQAPWRALSSLEDAFAFANQVGYPCLLRPSYVLSGSAMNVAYGEEEMKRFLEEATQVSQEHPVVITKFVRGAREVEVDAVAKDGKVLVHAITEHVEDAGVHSGDATLMLPTQTISQGALEKVKIATRKIAQAFEISGPFNTQFLVKDNDVMVIECNLRASRSFPFVSKTIGVDFINVATKVMVGEPLDESILPSLDKPFI--PVDYVGIKAPMFSWPRLRDADPVLRCEMASTGEVACFGPNIYSAFLKAMLSTGFKLPQKG--ILIGI-QQSFRPNFLATAHQLKEEGFKLYATEATSAWLCANDVPAIPVAWPTEKGV---TELPTIKGLINEGQIDLVVNLPNNNTRHLKDNFLI------RRMAIDHGVPLITNYQVVKLFAEAIRYA 1480          

HSP 3 Score: 121.709 bits (304), Expect = 4.293e-27
Identity = 100/390 (25.64%), Postives = 178/390 (45.64%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTD---YDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMG------LHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVA-YGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNL--LVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFS------LECEFLRGEP--NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            ++VLGSG   IG + EFD+   + IK ++    KT+++N N  +V T+       D ++F  ++ E V ++   E+PDG+++SMGGQ   N  +       L + ++ + GT    I   E+R  F+  L  I         +     A+     + YP ++R +Y L G    +  ++  L E   +A+A++    +++ + +   KE++ + V       +     E+ +  GIH+GD+ +V P Q ++ +    + +   ++ + L + G  N+Q      +L   +IE N R+SRS    SKA GY +   A +  +  P         E      EP  + +  K+P +   R  G    +G  M S GEV   G    E+  KA
Sbjct:  426 VLVLGSGGLSIGQAGEFDYSGSQAIKAMKEENLKTVLMNPNIASVQTNEVGSKQADSVYFLPVTPEFVTEVIKAERPDGILLSMGGQTALNCGVELFQSGILEKYEVKVLGTPVESIIATEDRQLFADKLMQINEKIAPSFAVESVSDALKAAEQIGYPVMLRSAYALGGLGSGLCANKEKLEETAHKALAMSSQ--ILVERSLLGWKEVEYEVVRDVADNCVTVCNMENFDPLGIHTGDSIVVAPSQTLSNEEYHMLRETAIKVVRHLGIVGECNIQYALHPSSLEYCIIEVNARLSRSSALASKATGYPLAFVAAKLALGIPLPEIQNAVSEKTTACFEPSLDYIVTKIPRWDLDRFQGMSREIGSAMKSVGEVMAVGRTFEESIQKA 813          

HSP 4 Score: 119.398 bits (298), Expect = 2.251e-26
Identity = 105/366 (28.69%), Postives = 172/366 (46.99%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAA--FAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNM-ENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKV-----CNKISSSMXKCW*NNV 2365
            EFD+    A++ALR+ G +TV+VN N  TV T     D+ Y   +T + + ++ + E   G  ++ GGQ   N  I L  SG      V +LGTS   I   E+R  FS IL+E++   AP  A  ++++    A Q+GYP ++R ++ L G     A    E+      A   +    V++ K +RG +E+E + V    D  + V  + E+V+  G+H+G++ ++ P+QT+S      ++    K+ +   + G  N Q+ +  N     +IE N R SRS    SK  G     VA K+ +G     L  S+       F P +DY  +K P +   +         C   S+    C+  N+
Sbjct:  992 EFDWCAVSAIRALRQLGKKTVVVNHNPETVSTDFDECDRLYFEELTLERILDITQQEDCSGSIVSVGGQIPNNLAIPLHMSG------VKILGTSPLQIDRAEERSVFSRILDELEVSQAPWRALSSLEDAFAFANQVGYPCLLRPSYVLSGSAMNVAYGEEEMKRFLEEATQVSQEHPVVITKFVRGAREVEVDAV--AKDGKVLVHAITEHVEDAGVHSGDATLMLPTQTISQGALEKVKIATRKIAQAFEISGPFNTQFLVKDND--VMVIECNLRASRSFPFVSKTIGVDFINVATKVMVGE---PLDESILPSLDKPFIP-VDYVGIKAPMFSWPRLRDADPVLRCEMASTGEVACFGPNI 1343          
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Medaka
Match: cps1 (carbamoyl-phosphate synthase 1 [Source:NCBI gene;Acc:101164854])

HSP 1 Score: 751.895 bits (1940), Expect = 0.000e+0
Identity = 410/788 (52.03%), Postives = 545/788 (69.16%), Query Frame = 2
Query:   20 KFSRRMKGA-LILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLINPLNNPELFIDPNERNLVEEVSINEIRHYNKNGNIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNADEYDALFISNGPGDPVKCTETIETIKNWITSEKP--FMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVTAVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKP--------KKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTT---MGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
            +FS + + A L+L D T   G  FG      GE+VF TG+VGY E+L+DPSY  Q+L LTYPI+G+YGV + + LD+ GL K  ES +I  +GL+V +YS EYS+W +  +L QWL++  V  + GIDTR LTK +R+ G++ G       K+  +    P    DPN++NLV EVS  E + + K   + V  +DCGVK+N IR   K GA V ++P+N  + + +YD LFISNGPGDP      I  ++  + S++P    GIC+G+Q+ ALA G K++K+  GNRG NQP  ++ T + F+T+QNHG+ + + S+P  W  LF N ND +NEGI+H   P  + QFHPE   GPTD E LF  FI  +   K                       +  + +++  KP         K+L+LGSGGLSIGQAGEFDYSG+QA+KA++EE ++TVL+NPNIA+VQT       AD  Y LP+T ++VTEVIK ERPDG+ L+ GGQTALNCG+EL +SG+ + Y+V VLGT +E+I  TEDRQ F++ L +I E++APS A  +V + + AAEQ+GYPVM+R+A+ALGGLGSG   N  +L + A  A A +SQ+LV++SL GWKE+EYEVVRDV DNC+TVCNMEN DPLGIHTG+S+VVAPSQTLSN EY+MLR+ A+KVVR+LG+VGECNIQYAL P+S +Y IIEVNARLSRSSALASKATGYPLA+VAAKL LG+ L  ++N+V+  TTACFEPS+DY V KIPRWDL++F  +  +I S+M
Sbjct:   38 RFSLKAQTARLVLEDGTSMKGFSFGHTASVAGELVFNTGLVGYPEALTDPSYRGQILTLTYPIVGNYGVPNTEELDELGLRKHVESERIQVSGLLVQDYSHEYSHWNSVKSLGQWLQEEKVPALFGIDTRMLTKIIRDKGTVLG-------KIEFD--GQPVDITDPNQKNLVAEVSTKETKVFGKGNPVKVVAVDCGVKHNIIRLLVKRGAEVHLVPWNQDLLSLKYDGLFISNGPGDPSLAETLINNVRKVLDSDRPEPVFGICMGNQITALAAGAKSYKLPMGNRGQNQPVLNVMTGQAFITAQNHGYGIDSKSLPPGWSSLFINANDGTNEGIMHNSKPVFTAQFHPEAKGGPTDTEFLFDAFISMIKKGK-----------------------DANIVSVMPKKPCLPPRAQVSKVLVLGSGGLSIGQAGEFDYSGSQAIKAMKEENLKTVLMNPNIASVQTNEVGSKQADSVYFLPVTPEFVTEVIKAERPDGILLSMGGQTALNCGVELFQSGILEKYEVKVLGTPVESIIATEDRQLFADKLMQINEKIAPSFAVESVSDALKAAEQIGYPVMLRSAYALGGLGSGLCANKEKLEETAHKALAMSSQILVERSLLGWKEVEYEVVRDVADNCVTVCNMENFDPLGIHTGDSIVVAPSQTLSNEEYHMLRETAIKVVRHLGIVGECNIQYALHPSSLEYCIIEVNARLSRSSALASKATGYPLAFVAAKLALGIPLPEIQNAVSEKTTACFEPSLDYIVTKIPRWDLDRFQGMSREIGSAM 793          

HSP 2 Score: 603.979 bits (1556), Expect = 0.000e+0
Identity = 325/700 (46.43%), Postives = 453/700 (64.71%), Query Frame = 3
Query: 2346 SVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYV--------EKFTESGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKIIKCLNELEEPRT-YLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPF------SLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDWDTGNQASSDSKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQALRKA 4400
            SVGE+M+VGR FEE+ QKALRM    + GF P +            +  L+ P+  R+  LA AL QG+SV EI+ LT ID WFL+K  +I    + L+  ++  + +++LL AK  GFSD QI   +   E   R+LR+  G+RP V QIDT++AE+P  TNYLY +Y+G +HD+ F+   IMVLG G Y IGSSVEFDWCAV  I+ L+++ KKT++VN NPETVSTD+D CD L+FEEL+LE +LDI   E   G IVS+GGQ+PNN+A+ LH   + I GTSP+ ID AE R  FSR+LD + + Q  W+ L+  E A  F N V YPCL+RPSYVLSG+AMNVA+ E ++  +L +A  V+++HPVVI+KF+  A+E++VDAVA  GK+L  A++EHVE+AG+HSGDATL+ P Q +++  L+K+     +IAQ  ++SGPFN Q + KD++++VIECNLR SRSFPFVSK +G + I  AT+ ++ EP       SL+  F+    + V +K PMFS+ RL  AD +L  EM STGEVACFG +   AFLKA L+ G K+P+ G  I I I     +   L +  QL   G+ LYA+  T+ +   + +    V W T       ++  T    I E ++DL++NLP  N+   + + +I      RR+AID+G+ L+TN +  KLF +A+R A
Sbjct:  795 SVGEVMAVGRTFEESIQKALRMCHPSVDGFVPQLPLKKAWADTHDLQQELAVPSSTRIFSLAKALHQGMSVGEIHQLTAIDKWFLHKLQRITHLEHHLKTYKSNTIPRELLLKAKQDGFSDKQIGRILGGNETGTRELRLARGIRPWVKQIDTLAAEYPAMTNYLYCTYNGQEHDLDFQDKGIMVLGCGPYHIGSSVEFDWCAVSAIRALRQLGKKTVVVNHNPETVSTDFDECDRLYFEELTLERILDITQQEDCSGSIVSVGGQIPNNLAIPLHMSGVKILGTSPLQIDRAEERSVFSRILDELEVSQAPWRALSSLEDAFAFANQVGYPCLLRPSYVLSGSAMNVAYGEEEMKRFLEEATQVSQEHPVVITKFVRGAREVEVDAVAKDGKVLVHAITEHVEDAGVHSGDATLMLPTQTISQGALEKVKIATRKIAQAFEISGPFNTQFLVKDNDVMVIECNLRASRSFPFVSKTIGVDFINVATKVMVGEPLDESILPSLDKPFI--PVDYVGIKAPMFSWPRLRDADPVLRCEMASTGEVACFGPNIYSAFLKAMLSTGFKLPQKG--ILIGI-QQSFRPNFLATAHQLKEEGFKLYATEATSAWLCANDVPAIPVAWPTEKGV---TELPTIKGLINEGQIDLVVNLPNNNTRHLKDNFLI------RRMAIDHGVPLITNYQVVKLFAEAIRYA 1480          

HSP 3 Score: 121.709 bits (304), Expect = 4.356e-27
Identity = 100/390 (25.64%), Postives = 178/390 (45.64%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTD---YDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMG------LHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVA-YGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNL--LVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFS------LECEFLRGEP--NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            ++VLGSG   IG + EFD+   + IK ++    KT+++N N  +V T+       D ++F  ++ E V ++   E+PDG+++SMGGQ   N  +       L + ++ + GT    I   E+R  F+  L  I         +     A+     + YP ++R +Y L G    +  ++  L E   +A+A++    +++ + +   KE++ + V       +     E+ +  GIH+GD+ +V P Q ++ +    + +   ++ + L + G  N+Q      +L   +IE N R+SRS    SKA GY +   A +  +  P         E      EP  + +  K+P +   R  G    +G  M S GEV   G    E+  KA
Sbjct:  426 VLVLGSGGLSIGQAGEFDYSGSQAIKAMKEENLKTVLMNPNIASVQTNEVGSKQADSVYFLPVTPEFVTEVIKAERPDGILLSMGGQTALNCGVELFQSGILEKYEVKVLGTPVESIIATEDRQLFADKLMQINEKIAPSFAVESVSDALKAAEQIGYPVMLRSAYALGGLGSGLCANKEKLEETAHKALAMSSQ--ILVERSLLGWKEVEYEVVRDVADNCVTVCNMENFDPLGIHTGDSIVVAPSQTLSNEEYHMLRETAIKVVRHLGIVGECNIQYALHPSSLEYCIIEVNARLSRSSALASKATGYPLAFVAAKLALGIPLPEIQNAVSEKTTACFEPSLDYIVTKIPRWDLDRFQGMSREIGSAMKSVGEVMAVGRTFEESIQKA 813          

HSP 4 Score: 119.013 bits (297), Expect = 2.529e-26
Identity = 105/366 (28.69%), Postives = 172/366 (46.99%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAA--FAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNM-ENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKV-----CNKISSSMXKCW*NNV 2365
            EFD+    A++ALR+ G +TV+VN N  TV T     D+ Y   +T + + ++ + E   G  ++ GGQ   N  I L  SG      V +LGTS   I   E+R  FS IL+E++   AP  A  ++++    A Q+GYP ++R ++ L G     A    E+      A   +    V++ K +RG +E+E + V    D  + V  + E+V+  G+H+G++ ++ P+QT+S      ++    K+ +   + G  N Q+ +  N     +IE N R SRS    SK  G     VA K+ +G     L  S+       F P +DY  +K P +   +         C   S+    C+  N+
Sbjct:  992 EFDWCAVSAIRALRQLGKKTVVVNHNPETVSTDFDECDRLYFEELTLERILDITQQEDCSGSIVSVGGQIPNNLAIPLHMSG------VKILGTSPLQIDRAEERSVFSRILDELEVSQAPWRALSSLEDAFAFANQVGYPCLLRPSYVLSGSAMNVAYGEEEMKRFLEEATQVSQEHPVVITKFVRGAREVEVDAV--AKDGKVLVHAITEHVEDAGVHSGDATLMLPTQTISQGALEKVKIATRKIAQAFEISGPFNTQFLVKDND--VMVIECNLRASRSFPFVSKTIGVDFINVATKVMVGE---PLDESILPSLDKPFIP-VDYVGIKAPMFSWPRLRDADPVLRCEMASTGEVACFGPNI 1343          
BLAST of Carbamoyl-phosphate synthase large chain vs. Planmine SMEST
Match: SMESG000012911.1 (SMESG000012911.1)

HSP 1 Score: 1806.96 bits (4679), Expect = 0.000e+0
Identity = 885/887 (99.77%), Postives = 886/887 (99.89%), Query Frame = 3
Query: 2346 SVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYVEKFTESGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKIIKCLNELEEPRTYLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDWDTGNQASSDSKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQALRKAIYKKKICVASPTIDCITSQKIYRFPGLVDIHVHTRDPGQVHKEDWSTVTKXXXXXXXXXXFAMPNTAPPITNLESFELAKKRASSLAHCDYGLYVGASNDNWESLAELAPEAIGLKMYLNPTFSTLQMNNFSTWAKHFKHFPENRPICCHAEGETMAAVILLAQLHNRHVHICHVSRKQEIELIRLAKSQGLKVTCEVSPHH 5006
            SVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYVEKFTESGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKIIKCLNELEEPRTYLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRM+KKTIMVNCNPETVSTDYDMCDHLFFEELSLESVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDL EYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDWDTGNQASSDSKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQALRKAIYKKKICVASPTIDCITSQKIYRFPGLVDIHVHTRDPGQVHKEDWSTVTKAAIAGGITTIFAMPNTAPPITNLESFELAKKRASSLAHCDYGLYVGASNDNWESLAELAPEAIGLKMYLNPTFSTLQMNNFSTWAKHFKHFPENRPICCHAEGETMAAVILLAQLHNRHVHICHVSRKQEIELIRLAKSQGLKVTCEVSPHH
Sbjct:  771 SVGEIMSVGRGFEEAFQKALRMVDEKLKGFDPYVEKFTESGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKIIKCLNELEEPRTYLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMRKKTIMVNCNPETVSTDYDMCDHLFFEELSLESVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLIEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDWDTGNQASSDSKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQALRKAIYKKKICVASPTIDCITSQKIYRFPGLVDIHVHTRDPGQVHKEDWSTVTKAAIAGGITTIFAMPNTAPPITNLESFELAKKRASSLAHCDYGLYVGASNDNWESLAELAPEAIGLKMYLNPTFSTLQMNNFSTWAKHFKHFPENRPICCHAEGETMAAVILLAQLHNRHVHICHVSRKQEIELIRLAKSQGLKVTCEVSPHH 1657          

HSP 2 Score: 1513.05 bits (3916), Expect = 0.000e+0
Identity = 767/769 (99.74%), Postives = 768/769 (99.87%), Query Frame = 2
Query:   35 MKGALILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLINPLNNPELFIDPNERNLVEEVSINEIRHYNKNGNIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNADEYDALFISNGPGDPVKCTETIETIKNWITSEKPFMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVTAVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKPKKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
            MKGALILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLINPLNNPELFIDPNERNLVEEVSINEIRHYNKNGNIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVN DEYDALFISNGPGDPVKCTETIETIKNWITSEKPFMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLF+VFIEHVTAVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKPKKILILGSGGLSIGQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRAAFALGGLGSGFANNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNARLSRSSALASKATGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM
Sbjct:    1 MKGALILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLINPLNNPELFIDPNERNLVEEVSINEIRHYNKNGNIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNVDEYDALFISNGPGDPVKCTETIETIKNWITSEKPFMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFEVFIEHVTAVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKPKKILILGSGGLSIGQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRAAFALGGLGSGFANNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNARLSRSSALASKATGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 769          

HSP 3 Score: 129.798 bits (325), Expect = 1.422e-29
Identity = 108/411 (26.28%), Postives = 185/411 (45.01%), Query Frame = 3
Query: 2817 LSYSGIDHDITFEG------GYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHRE------KIPIFGTSPICIDNAENRFKFSRMLDSIG-ICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVA-YGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDN---LLVIECNLRVSRSFPFVSKALGYNMIAAATR--------AIMSEPFSLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            L+Y    H++T           I++LGSG   IG + EFD+   + +K L+    +T++VN N  TV T   + D  +   ++ + V ++  +E+PDGV ++ GGQ   N  + L         K+ + GTS   I   E+R +FS +L+ I     P     T  E  I+    + YP ++R ++ L G     A + ++L +  + A A      V++ K +   KEI+ + V       +     E+V+  GIH+G++ +V P Q ++      + +   ++ + L V G  N+Q  A D N     +IE N R+SRS    SKA GY +   A +        ++ +   ++         +   VK+P +   +       +   M S GE+   G    EAF KA
Sbjct:  383 LTYQHTQHELTLTALLENKPKKILILGSGGLSIGQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKE-CIDAAEQLGYPVMIRAAFALGGLGSGFANNPTELLDLASAAFAHTSQ--VLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQY-ALDPNSHKYYIIEVNARLSRSSALASKATGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSMKSVGEIMSVGRGFEEAFQKA 789          

HSP 4 Score: 84.7297 bits (208), Expect = 5.572e-16
Identity = 84/302 (27.81%), Postives = 145/302 (48.01%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKE-CIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQ--VLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQY-ALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAK 2185
            EFD+   + +K L+    +T++VN N  TV T   + D  +   ++ + V ++  +E+PDGV ++ GGQ   N  + L         K+ + GTS   I   E+R +FS +L+ I     P     T  E  I+    + YP ++R ++ L G     A + ++L++  + A A      V++ K +   KEI+ + V       +     E+V+  GIH+G++ +V P Q ++      + +   ++ + L V G  N+Q  A D N     +IE N R+SRS    SKA GY +   A +
Sbjct:  959 EFDWCAVECIKELQRMRKKTIMVNCNPETVSTDYDMCDHLFFEELSLESVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHRE------KIPIFGTSPICIDNAENRFKFSRMLDSIG-ICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLIEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVA-YGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDN---LLVIECNLRVSRSFPFVSKALGYNMIAAATR 1249          
BLAST of Carbamoyl-phosphate synthase large chain vs. Planmine SMEST
Match: SMESG000066808.1 (SMESG000066808.1)

HSP 1 Score: 755.362 bits (1949), Expect = 0.000e+0
Identity = 410/772 (53.11%), Postives = 537/772 (69.56%), Query Frame = 2
Query:   38 KGALILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLINPLNNPELFIDPNERNLVEEVSINEIRHYNKNGNIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNADEYDALFISNGPGDPVKCTETIETIKNWI-TSEKPFMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVTAVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKPKKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTTM---GVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
            K  L L++  V+ G  FG  K   GE+VF TG+ GY ESL+DPSY  Q+L LTYPI+G+YGV D    D  GL  + ES +IH +GLIV +YS   S+W +  +LSQWL    V  + GIDTR LTK +R+ G++   I    D         P  F DPN+ NL  +VS N I+ + +     +  +DCG+K+N I+     GA VT++P++     D+YD LFISNGPGDP   +ET++ IK  I T  +P  GIC G+QL+ LA G  T+K+  GNRGHNQP  ++ T + F+TSQNHG+ ++  S+ D+W+ LF N NDK+NEGI++ K P  + QFHPE   GPTD E LF  ++E V + KS T  +   + +                     K KK+L+LGSGGLSIGQAGEFDYSG+QA+KAL+EEGI+T+L+NPNIA+VQT       AD  Y LP+T ++V +V++ ERPDG+ L+ GGQTALN GIEL E G+   Y V VLGT I++I  TEDRQ F++ L+EI  ++APS A  ++++ I+AA Q+GYPVM+RAAFALGGLGSG A+N  +L+D+   AFA T+QVL+++SL GWKE+EYEVVRD  DNCITVCNMEN DPLG+HTG+S+VVAPSQTLSNYEY+MLR+ ALKV+R+ G+VGECNIQYAL P S +Y IIE+NARLSRSSALASKATGYPLA++AAKL LG+ L  ++N+ T +T+ACFEPS+DY   KIPRWDL++F     +I SSM
Sbjct:   35 KARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLIDEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDTD---------PIEFKDPNKSNLTADVSTNHIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIETRNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKS-KSKTTIIPSPKTID----------------FEPPKVKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADYVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINARLSRSSALASKATGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSM 780          

HSP 2 Score: 584.334 bits (1505), Expect = 0.000e+0
Identity = 313/697 (44.91%), Postives = 449/697 (64.42%), Query Frame = 3
Query: 2346 SVGEIMSVGRGFEEAFQKALRM-------VDEKLKGFDPYVEKFT-ESGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKIIKC---LNELEEPRTYLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRGEP----NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDWDTGNQASSDSKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQAL 4391
            SVGE+M++GR FEE+ QKALRM       +  KL G   Y E F  +  L +P++ R+  + NA ++G SV++I+ LTKID WFL+K  +I+     ++E+      LS + L  AK  GFSD QI   +  +EM VR++R  + + P V  IDT++AE+P  TNYLY SY+G++HD+TF+   +MVLG G Y IGSSVEFDWCAV  I+ L++  ++T+++N NPETVSTD+D  D L+FEELSLE VLDI+  E P G I+S+GGQ+PNN+A+ L +  + I GT P  ID+AE+R KFS +LD I + Q  W+ L+  + A+ F + V YPCLVRPSY+LSG+AMNVA++ ++L  +L  A  +++D+PVVI+KF+E AKEI+ DA+A  G ++  A+SEH+ENAG+HSGDATLV PP  +++    +I +I ++IA++ ++SGPFN+Q + K+  +LVIECNLR SRS PFVSK +G +MIA AT+ +M+ P   +  F    P    N + +K PMFS+ RL  AD +L  EM STGEVACFGE+   AFLKA  +   ++PR   NI I +  ++ +   L + + L   GYN+YA+  TA++     I  N V W T  +   +      +  I +   DL+INLP   +        +T  Y  RR AID    L+ N +  K+ V++L
Sbjct:  782 SVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGL-QHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSAEDFQNLDIPAATKLISDKFFDLVINLPNYKTK------YVTENYLIRRAAIDSATPLMINFELVKMLVESL 1471          

HSP 3 Score: 134.42 bits (337), Expect = 3.557e-31
Identity = 107/397 (26.95%), Postives = 181/397 (45.59%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYD---MCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKI------PIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGG-KLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNL--LVIECNLRVSRSFPFVSKALGYNM---------------IAAATRAIMSEPFSLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            ++VLGSG   IG + EFD+   + IK L+    +TI++N N  +V T+ +     D+++F  ++ E V  +   E+PDG+++SMGGQ   N+ + LH + I       + GT    I   E+R  F+  L  IG      + +   E AI   N + YP +VR ++ L G    +A ++  L +   +A A+     V+I + +   KE++ + V       +     E+ +  G+H+GD+ +V P Q ++      + +   ++ +   + G  N+Q     ++L   +IE N R+SRS    SKA GY +               I  AT  I S  F    ++       +  K+P +   R       +G  M S GEV   G    E+  KA
Sbjct:  413 VLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADYVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQ--VLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINARLSRSSALASKATGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDY-------ITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKA 800          

HSP 4 Score: 125.176 bits (313), Expect = 2.363e-28
Identity = 106/367 (28.88%), Postives = 179/367 (48.77%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAA--FAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNM--ENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKV-----CNKISSSMXKCW*NNV 2365
            EFD+    A++ALR+ G QTV++N N  TV T    +D+ Y   ++ + V ++ + E P G  ++ GGQ   N  + L     FK+  V++LGT    I   EDR +FS IL+EI  + A   +  +V + ++ A ++GYP ++R ++ L G     A  P EL+    +A   +    V++ K L G KEIE + +     + + VC+   E+++  G+H+G++ +V P  T+S      +R+ + K+ +   + G  N+Q+ +     +  +IE N R SRS    SK  G  +   A K+   M  + L            EP  +Y  +K P +   + TK      C   S+    C+  NV
Sbjct:  981 EFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPL-----FKN-SVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIA---KDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLV--KEGEILVIECNLRASRSCPFVSKTIGTDMIATATKV---MMNIPLDEKDYFTIDNPREPK-NYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENV 1332          
BLAST of Carbamoyl-phosphate synthase large chain vs. Planmine SMEST
Match: SMESG000066808.1 (SMESG000066808.1)

HSP 1 Score: 754.592 bits (1947), Expect = 0.000e+0
Identity = 410/772 (53.11%), Postives = 537/772 (69.56%), Query Frame = 2
Query:   38 KGALILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLINPLNNPELFIDPNERNLVEEVSINEIRHYNKNGNIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNADEYDALFISNGPGDPVKCTETIETIKNWI-TSEKPFMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFQVFIEHVTAVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKPKKXXXXXXXXXXXXQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTTM---GVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSM 2341
            K  L L++  V+ G  FG  K   GE+VF TG+ GY ESL+DPSY  Q+L LTYPI+G+YGV D    D  GL  + ES +IH +GLIV +YS   S+W +  +LSQWL    V  + GIDTR LTK +R+ G++   I    D         P  F DPN+ NL  +VS N I+ + +     +  +DCG+K+N I+     GA VT++P++     D+YD LFISNGPGDP   +ET++ IK  I T  +P  GIC G+QL+ LA G  T+K+  GNRGHNQP  ++ T + F+TSQNHG+ ++  S+ D+W+ LF N NDK+NEGI++ K P  + QFHPE   GPTD E LF  ++E V + KS T  +   + +                     K KK+L+LGSGGLSIGQAGEFDYSG+QA+KAL+EEGI+T+L+NPNIA+VQT       AD  Y LP+T ++V +V++ ERPDG+ L+ GGQTALN GIEL E G+   Y V VLGT I++I  TEDRQ F++ L+EI  ++APS A  ++++ I+AA Q+GYPVM+RAAFALGGLGSG A+N  +L+D+   AFA T+QVL+++SL GWKE+EYEVVRD  DNCITVCNMEN DPLG+HTG+S+VVAPSQTLSNYEY+MLR+ ALKV+R+ G+VGECNIQYAL P S +Y IIE+NARLSRSSALASKATGYPLA++AAKL LG+ L  ++N+ T +T+ACFEPS+DY   KIPRWDL++F     +I SSM
Sbjct:    4 KARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLIDEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDTD---------PIEFKDPNKSNLTADVSTNHIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIETRNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKS-KSKTTIIPSPKTID----------------FEPPKVKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADYVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINARLSRSSALASKATGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSM 749          

HSP 2 Score: 583.948 bits (1504), Expect = 0.000e+0
Identity = 313/697 (44.91%), Postives = 449/697 (64.42%), Query Frame = 3
Query: 2346 SVGEIMSVGRGFEEAFQKALRM-------VDEKLKGFDPYVEKFT-ESGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKIIKC---LNELEEPRTYLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYDMCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRGEP----NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDWDTGNQASSDSKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQAL 4391
            SVGE+M++GR FEE+ QKALRM       +  KL G   Y E F  +  L +P++ R+  + NA ++G SV++I+ LTKID WFL+K  +I+     ++E+      LS + L  AK  GFSD QI   +  +EM VR++R  + + P V  IDT++AE+P  TNYLY SY+G++HD+TF+   +MVLG G Y IGSSVEFDWCAV  I+ L++  ++T+++N NPETVSTD+D  D L+FEELSLE VLDI+  E P G I+S+GGQ+PNN+A+ L +  + I GT P  ID+AE+R KFS +LD I + Q  W+ L+  + A+ F + V YPCLVRPSY+LSG+AMNVA++ ++L  +L  A  +++D+PVVI+KF+E AKEI+ DA+A  G ++  A+SEH+ENAG+HSGDATLV PP  +++    +I +I ++IA++ ++SGPFN+Q + K+  +LVIECNLR SRS PFVSK +G +MIA AT+ +M+ P   +  F    P    N + +K PMFS+ RL  AD +L  EM STGEVACFGE+   AFLKA  +   ++PR   NI I +  ++ +   L + + L   GYN+YA+  TA++     I  N V W T  +   +      +  I +   DL+INLP   +        +T  Y  RR AID    L+ N +  K+ V++L
Sbjct:  751 SVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGL-QHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSAEDFQNLDIPAATKLISDKFFDLVINLPNYKTK------YVTENYLIRRAAIDSATPLMINFELVKMLVESL 1440          

HSP 3 Score: 134.806 bits (338), Expect = 3.447e-31
Identity = 107/397 (26.95%), Postives = 181/397 (45.59%), Query Frame = 3
Query: 2865 IMVLGSGVYRIGSSVEFDWCAVECIKELQRMKKKTIMVNCNPETVSTDYD---MCDHXXXXXXXXXXVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKI------PIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGG-KLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNL--LVIECNLRVSRSFPFVSKALGYNM---------------IAAATRAIMSEPFSLECEFLRGEPNKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKA 3974
            ++VLGSG   IG + EFD+   + IK L+    +TI++N N  +V T+ +     D+++F  ++ E V  +   E+PDG+++SMGGQ   N+ + LH + I       + GT    I   E+R  F+  L  IG      + +   E AI   N + YP +VR ++ L G    +A ++  L +   +A A+     V+I + +   KE++ + V       +     E+ +  G+H+GD+ +V P Q ++      + +   ++ +   + G  N+Q     ++L   +IE N R+SRS    SKA GY +               I  AT  I S  F    ++       +  K+P +   R       +G  M S GEV   G    E+  KA
Sbjct:  382 VLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADYVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQ--VLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINARLSRSSALASKATGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDY-------ITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKA 769          

HSP 4 Score: 125.176 bits (313), Expect = 2.671e-28
Identity = 106/367 (28.88%), Postives = 179/367 (48.77%), Query Frame = 2
Query: 1292 EFDYSGAQALKALREEGIQTVLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRXXXXXXXXXXXXXNNPTELLDLASAA--FAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNM--ENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKV-----CNKISSSMXKCW*NNV 2365
            EFD+    A++ALR+ G QTV++N N  TV T    +D+ Y   ++ + V ++ + E P G  ++ GGQ   N  + L     FK+  V++LGT    I   EDR +FS IL+EI  + A   +  +V + ++ A ++GYP ++R ++ L G     A  P EL+    +A   +    V++ K L G KEIE + +     + + VC+   E+++  G+H+G++ +V P  T+S      +R+ + K+ +   + G  N+Q+ +     +  +IE N R SRS    SK  G  +   A K+   M  + L            EP  +Y  +K P +   + TK      C   S+    C+  NV
Sbjct:  950 EFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPL-----FKN-SVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIA---KDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLV--KEGEILVIECNLRASRSCPFVSKTIGTDMIATATKV---MMNIPLDEKDYFTIDNPREPK-NYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENV 1301          
The following BLAST results are available for this feature:
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CAD7.497e-3458.25carbamoyl-phosphate synthetase 2, aspartate transc... [more]
CAD1.197e-1858.25carbamoyl-phosphate synthetase 2, aspartate transc... [more]
CPS17.745e-3251.04carbamoyl-phosphate synthase 1 [Source:HGNC Symbol... [more]
CPS17.745e-3251.04carbamoyl-phosphate synthase 1 [Source:HGNC Symbol... [more]
CPS17.197e-3251.04carbamoyl-phosphate synthase 1 [Source:HGNC Symbol... [more]
back to top
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pyr-19.574e-3455.15CAD protein Glutamine-dependent carbamoyl-phosphat... [more]
back to top
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
r2.525e-3257.53gene:FBgn0003189 transcript:FBtr0089734[more]
r2.525e-3257.53gene:FBgn0003189 transcript:FBtr0340156[more]
r2.525e-3257.53gene:FBgn0003189 transcript:FBtr0340155[more]
back to top
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cad3.618e-3360.31carbamoyl-phosphate synthetase 2, aspartate transc... [more]
cps12.998e-2752.70carbamoyl-phosphate synthase 1, mitochondrial [Sou... [more]
cps12.905e-2752.70carbamoyl-phosphate synthase 1, mitochondrial [Sou... [more]
cps13.393e-2752.56carbamoyl-phosphate synthase 1, mitochondrial [Sou... [more]
cps13.862e-2752.95carbamoyl-phosphate synthase 1, mitochondrial [Sou... [more]
back to top
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CAD5.169e-10259.82carbamoyl-phosphate synthetase 2, aspartate transc... [more]
CAD7.467e-10559.82carbamoyl-phosphate synthetase 2, aspartate transc... [more]
CAD4.426e-3459.82carbamoyl-phosphate synthetase 2, aspartate transc... [more]
CAD1.344e-3453.54carbamoyl-phosphate synthetase 2, aspartate transc... [more]
ENSXETT00000045303.11.825e-3149.35carbamoyl-phosphate synthase 1 [Source:NCBI gene;A... [more]
back to top
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cad2.479e-2258.03carbamoyl-phosphate synthetase 2, aspartate transc... [more]
Cad7.525e-3458.03carbamoyl-phosphate synthetase 2, aspartate transc... [more]
Cad7.678e-3458.03carbamoyl-phosphate synthetase 2, aspartate transc... [more]
Cad7.437e-3458.03carbamoyl-phosphate synthetase 2, aspartate transc... [more]
Cad5.878e-6761.38carbamoyl-phosphate synthetase 2, aspartate transc... [more]
back to top
BLAST of Carbamoyl-phosphate synthase large chain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q91437|PYR1_SQUAC3.161e-3159.17CAD protein OS=Squalus acanthias OX=7797 GN=CAD PE... [more]
sp|P08955|PYR1_MESAU4.920e-3358.25CAD protein OS=Mesocricetus auratus OX=10036 GN=CA... [more]
sp|P27708|PYR1_HUMAN3.600e-3358.25CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV... [more]
sp|B2RQC6|PYR1_MOUSE5.263e-3358.03CAD protein OS=Mus musculus OX=10090 GN=Cad PE=1 S... [more]
sp|P05990|PYR1_DROME2.531e-3157.53CAD protein OS=Drosophila melanogaster OX=7227 GN=... [more]
back to top
BLAST of Carbamoyl-phosphate synthase large chain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9K7M79.070e-2861.70Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A433TUL01.024e-2661.17Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A2T7NRL61.427e-2761.48Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A0L8FL842.478e-2660.85Uncharacterized protein OS=Octopus bimaculoides OX... [more]
A0A0L8FLC12.691e-2660.85Uncharacterized protein OS=Octopus bimaculoides OX... [more]
back to top
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cad1.959e-3259.55carbamoyl-phosphate synthetase 2, aspartate transc... [more]
cad2.236e-3259.55carbamoyl-phosphate synthetase 2, aspartate transc... [more]
cps16.872e-2852.57carbamoyl-phosphate synthase 1 [Source:NCBI gene;A... [more]
cps16.705e-2852.57carbamoyl-phosphate synthase 1 [Source:NCBI gene;A... [more]
cps16.705e-2852.57carbamoyl-phosphate synthase 1 [Source:NCBI gene;A... [more]
back to top
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000004226.12.955e-5953.16pep scaffold:Pmarinus_7.0:GL477658:179183:185371:1... [more]
ENSPMAT00000004232.12.751e-1171.79pep scaffold:Pmarinus_7.0:GL477658:181762:185386:1... [more]
back to top
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
URA21.870e-3054.49Bifunctional carbamoylphosphate synthetase/asparta... [more]
CPA22.044e-3346.69Large subunit of carbamoyl phosphate synthetase; c... [more]
CPA12.936e-10345.48Small subunit of carbamoyl phosphate synthetase; c... [more]
DAL12.917e-1030.00Allantoinase; converts allantoin to allantoate in ... [more]
TRP32.676e-827.84Indole-3-glycerol-phosphate synthase; forms bifunc... [more]
back to top
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO377035.275e-3257.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO333678.802e-2754.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO437512.351e-13046.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO290831.762e-11364.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO258832.904e-5239.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Carbamoyl-phosphate synthase large chain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cad2.301e-6461.80carbamoyl-phosphate synthetase 2, aspartate transc... [more]
cps14.100e-2752.03carbamoyl-phosphate synthase 1 [Source:NCBI gene;A... [more]
cps14.293e-2752.03carbamoyl-phosphate synthase 1 [Source:NCBI gene;A... [more]
cps14.356e-2752.03carbamoyl-phosphate synthase 1 [Source:NCBI gene;A... [more]
back to top
BLAST of Carbamoyl-phosphate synthase large chain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000012911.11.422e-2999.77SMESG000012911.1[more]
SMESG000066808.13.557e-3153.11SMESG000066808.1[more]
SMESG000066808.13.447e-3153.11SMESG000066808.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035969 ID=SMED30035969|Name=Carbamoyl-phosphate synthase large chain|organism=Schmidtea mediterranea sexual|type=transcript|length=5007bp
AAATAATATTCATTNTTTCAAATTTTCACGTAGAATGAAAGGTGCTTTAA
TTTTATCTGATGAAACGGTGTATATTGGAAACTTGTTTGGAGCAATCAAA
CAAGGAAAGGGAGAAGTTGTATTTCAAACTGGCATGGTTGGGTATACTGA
ATCATTGAGCGATCCATCGTATCATTCTCAGTTGTTAGTCTTAACTTATC
CCATAATAGGCAGCTATGGAGTAAGTGATGACAAAATGTTAGATCAATGG
GGATTACCAAAGTCTTTTGAGTCTGCAAAAATTCACGCAACTGGACTGAT
TGTCAATGAATACAGTTTGGAGTATTCAAATTGGACAGCCCAGGTCACTT
TGTCGCAATGGTTAGAAAAACACGGAGTTATTGGTATTTCTGGCATTGAC
ACTCGTCATTTAACAAAGAAATTACGAGAATGTGGTTCTATAACAGGAGT
CATAGTCCCAATAAAAGACAAGTTACTTATTAACCCACTGAATAATCCAG
AATTATTTATTGATCCAAATGAAAGAAATTTAGTGGAAGAAGTATCGATA
AATGAAATCCGTCATTATAATAAAAATGGAAATATTCATGTTTGTATCAT
TGATTGTGGTGTGAAAAATAATCAAATTCGATGTTTCTGTAAATATGGTG
CTCGAGTGACTGTCATGCCATATAATGCTACAGTGAATGCTGATGAATAC
GACGCGTTGTTTATTAGCAATGGTCCAGGAGACCCAGTAAAATGCACCGA
AACAATTGAAACTATTAAAAACTGGATAACATCCGAAAAACCCTTTATGG
GAATTTGTCTTGGGCATCAATTGCTAGCACTGGCAATCGGGTGTAAAACT
CACAAGATGAAATACGGAAATAGAGGACATAATCAGCCGTGCACTCATTT
GCAAACTAAACGTTGTTTCATGACGTCCCAAAATCACGGATTCGCCGTTT
CTGCATCATCGATTCCCGATGAGTGGAGAGAATTGTTTTACAACGAGAAT
GACAAGAGCAATGAAGGAATTATCCATAAAAAATTACCGTTCATGTCTGT
TCAATTCCATCCGGAACATATGAGCGGTCCAACGGACATGGAATTGTTAT
TCCAGGTGTTTATCGAGCATGTCACTGCCGTCAAATCAAATACCGCAACT
GTCAGCCTCGATCAAAGATTAACCAATCGATTAACCTACCAACACACCCA
GCACGAGTTGACATTGACAGCACTTTTGGAAAATAAACCCAAAAAAATCC
TCATTCTTGGTTCAGGTGGTTTATCGATTGGCCAGGCGGGGGAATTCGAT
TATTCTGGTGCCCAAGCTTTGAAAGCTCTCAGAGAGGAAGGCATTCAGAC
CGTACTAGTCAATCCAAACATCGCCACTGTCCAAACGACAATGGGAGTTG
CCGATAAAAGCTATCTGCTGCCAATTACAAAAGATTACGTGACGGAAGTG
ATTAAAATGGAGCGTCCCGATGGGGTTTATTTGACATTCGGCGGACAAAC
GGCTCTCAATTGCGGAATCGAATTGGAAGAAAGCGGGGTTTTCAAGGATT
ACAAAGTTTCAGTTTTGGGCACTTCAATCGAAACGATTAAAATGACAGAA
GATCGACAGAGATTTTCGGAAATTCTCGAAGAAATCAAAGAAGAAGTCGC
GCCAAGTCTAGCAGCTTATACAGTTAAAGAATGCATTGATGCTGCTGAAC
AGCTTGGTTATCCTGTAATGATTCGTGCTGCATTCGCGCTAGGAGGCCTG
GGATCTGGATTCGCTAATAATCCCACTGAATTACTTGATCTCGCATCGGC
TGCATTTGCTCACACTTCCCAAGTGTTAGTCGACAAATCTCTCCGCGGAT
GGAAGGAAATTGAATACGAGGTTGTTCGGGATGTATATGATAATTGTATA
ACTGTGTGTAATATGGAAAATGTTGACCCTTTGGGAATACATACTGGTGA
ATCGGTTGTGGTTGCCCCGAGCCAAACATTATCAAATTACGAATATTATA
TGCTGAGAAAATGTGCTTTGAAAGTTGTTAGATATTTGGGCGTTGTTGGT
GAATGCAATATCCAATATGCACTTGATCCAAATTCTCATAAATATTACAT
AATTGAAGTAAATGCGAGATTATCGAGAAGTTCAGCATTAGCCAGTAAAG
CTACTGGGTATCCATTGGCTTACGTAGCAGCCAAATTGGGATTGGGAATG
TCTCTGGTGTCGTTAAGGAATTCAGTCACTACTGTCACTACAGCCTGTTT
TGAACCGAGCATCGATTATTGTGTAGTGAAAATTCCTCGATGGGATCTAA
ACAAATTCACAAAAGTGTGCAATAAAATTAGCAGTTCTATGAANAAGTGT
TGGTGAAATAATGTCTGTTGGAAGAGGATTTGAAGAAGCATTTCAAAAAG
CATTGAGAATGGTTGATGAGAAATTGAAAGGGTTTGATCCGTATGTAGAA
AAATTTACAGAAAGTGGTTTGTCCAGTCCGACAGATAGGCGGATGTTAGT
TTTGGCTAATGCTTTGAAACAAGGTGTCAGCGTTAAAGAGATTTACGATC
TCACTAAAATAGATTACTGGTTTCTTTATAAATTCGCGAAAATAATAAAA
TGTTTGAATGAACTAGAAGAGCCTAGAACATACCTTTCGAAGGATATACT
GTTGAATGCAAAATTGCTAGGGTTCAGTGACACTCAAATTGCCGAAGCTG
TAAAATCAACAGAAATGGCTGTCAGACAATTACGAATAGAATTAGGAGTT
CGACCGATTGTTCATCAAATTGACACCGTATCCGCTGAATGGCCGTGTTA
CACAAATTACCTTTATCTTTCTTACAGTGGAATTGATCACGATATAACGT
TCGAAGGCGGATATATAATGGTTTTAGGATCCGGAGTATATAGAATTGGT
TCAAGTGTTGAATTCGATTGGTGTGCTGTCGAATGTATTAAAGAATTACA
AAGGATGAAGAAGAAAACAATTATGGTCAATTGCAACCCTGAAACTGTTT
CTACCGACTATGATATGTGTGACCATTTGTTTTTTGAAGAGTTGAGTTTG
GAATCGGTTTTGGACATTTTCCACATCGAACAACCAGATGGAGTTATTGT
CAGCATGGGCGGACAGTTGCCGAACAACATTGCAATGGGCTTACATCGGG
AAAAAATTCCGATTTTCGGCACCAGCCCCATTTGTATTGATAATGCTGAA
AATCGATTCAAATTCTCAAGAATGCTTGATTCAATTGGTATTTGCCAACC
TAAATGGAAAGAGTTAACGGATTCAGAGTCAGCAATAAATTTCTGTAACG
ATGTACAGTATCCCTGCTTAGTTAGACCGAGTTATGTATTATCCGGAGCA
GCAATGAATGTAGCGTTTTCCGAATCTGATCTCACTGAGTATCTTACTCA
GGCTGTTGCAGTTAATAAAGATCATCCGGTGGTTATCAGCAAGTTCATTG
AAGATGCTAAAGAAATCGATGTCGATGCGGTGGCATACGGTGGTAAATTG
TTAAGATGGGCAGTTTCGGAACATGTTGAAAATGCCGGAATTCACTCAGG
TGATGCAACTTTAGTTACTCCCCCTCAAGATATGAATGAAAAAACACTAC
AAAAAATCGGTCAGATTATTACAGAGATTGCTCAAGAATTGAAAGTCAGC
GGACCTTTTAATATGCAACTTATAGCTAAAGATGATAACTTATTGGTTAT
CGAGTGCAATCTTCGTGTCAGTCGATCATTTCCATTCGTATCTAAAGCAC
TTGGATACAATATGATAGCTGCAGCAACAAGAGCTATCATGTCGGAGCCG
TTTTCTTTAGAATGTGAATTTCTAAGAGGAGAACCAAATAAAGTAGCAGT
GAAAGTACCGATGTTCTCATTTGCAAGATTACCAGGTGCCGATGTTCTGT
TAGGAGTTGAGATGTATAGCACTGGTGAAGTTGCTTGTTTCGGCGAAGAC
AGAAACGAAGCGTTTTTGAAGGCCCAGTTAGCTCAAGGAATAAAAATACC
AAGACCAGGAGGAAATATTTTCATCTCTATTGGTAGTTACAAACACAAGA
AAGAATTGCTTGAATCTGTTCGACAGTTGTTTAGTCTTGGTTATAATTTG
TATGCTAGCTTGGGAACTGCAGATTTCTATATTGAATCCGGAATAAGTGT
CAATGCAGTGGATTGGGATACTGGCAATCAGGCATCTTCGGATTCCAAGA
AAAAAACCTTTAGTGATTATATAATTGAAGATAAAATGGATTTGTTGATA
AATCTTCCCAAAAGAAATTCTGGTTTGCGTCGTGCCTCCTGTATGATCAC
TAATGGATACAAAAATCGCCGATTGGCCATAGATTACGGAATTGGTTTGT
TAACTAATGTCAAGTGTACAAAATTGTTTGTACAAGCCCTTAGGAAAGCA
ATTTATAAAAAAAAAATCTGTGTAGCTAGCCCGACAATAGATTGTATTAC
ATCTCAGAAAATTTATCGATTTCCCGGACTTGTTGACATTCATGTCCATA
CTAGAGATCCTGGTCAAGTTCACAAAGAAGATTGGAGTACGGTTACAAAG
GCTGCAATTGCTGGAGGGATCACAACTATATTTGCAATGCCGAATACTGC
ACCACCGATAACTAATTTGGAGTCCTTTGAACTGGCTAAAAAGCGCGCAA
GCTCATTGGCTCATTGTGATTATGGTTTATATGTCGGGGCGTCAAATGAT
AACTGGGAATCATTAGCAGAACTAGCTCCCGAAGCCATTGGATTGAAAAT
GTATTTGAATCCTACATTTTCCACATTACAAATGAACAATTTTTCAACCT
GGGCCAAACATTTTAAACATTTCCCAGAAAATCGCCCCATCTGTTGTCAC
GCGGAAGGAGAAACTATGGCAGCTGTTATTCTCCTTGCACAATTGCACAA
TCGGCATGTCCATATATGCCACGTATCCCGTAAACAGGAAATAGAGTTGA
TAAGGCTTGCGAAATCCCAAGGTTTAAAGGTGACATGCGAAGTGTCACCT
CATCATT
back to top

protein sequence of SMED30035969-orf-1

>SMED30035969-orf-1 ID=SMED30035969-orf-1|Name=SMED30035969-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=882bp
MSVGRGFEEAFQKALRMVDEKLKGFDPYVEKFTESGLSSPTDRRMLVLAN
ALKQGVSVKEIYDLTKIDYWFLYKFAKIIKCLNELEEPRTYLSKDILLNA
KLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNY
LYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMK
KKTIMVNCNPETVSTDYDMCDHLFFEELSLESVLDIFHIEQPDGVIVSMG
GQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWK
ELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLTEYLTQAVA
VNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDAT
LVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECN
LRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRGEPNKVAVKVP
MFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPG
GNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAV
DWDTGNQASSDSKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGY
KNRRLAIDYGIGLLTNVKCTKLFVQALRKAIYKKKICVASPTIDCITSQK
IYRFPGLVDIHVHTRDPGQVHKEDWSTVTKAAIAGGITTIFAMPNTAPPI
TNLESFELAKKRASSLAHCDYGLYVGASNDNWESLAELAPEAIGLKMYLN
PTFSTLQMNNFSTWAKHFKHFPENRPICCHAEGETMAAVILLAQLHNRHV
HICHVSRKQEIELIRLAKSQGLKVTCEVSPHH
back to top

protein sequence of SMED30035969-orf-2

>SMED30035969-orf-2 ID=SMED30035969-orf-2|Name=SMED30035969-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=785bp
NNIHXFKFSRRMKGALILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTE
SLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLI
VNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGV
IVPIKDKLLINPLNNPELFIDPNERNLVEEVSINEIRHYNKNGNIHVCII
DCGVKNNQIRCFCKYGARVTVMPYNATVNADEYDALFISNGPGDPVKCTE
TIETIKNWITSEKPFMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHL
QTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSV
QFHPEHMSGPTDMELLFQVFIEHVTAVKSNTATVSLDQRLTNRLTYQHTQ
HELTLTALLENKPKKILILGSGGLSIGQAGEFDYSGAQALKALREEGIQT
VLVNPNIATVQTTMGVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQT
ALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVA
PSLAAYTVKECIDAAEQLGYPVMIRAAFALGGLGSGFANNPTELLDLASA
AFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGE
SVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYI
IEVNARLSRSSALASKATGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACF
EPSIDYCVVKIPRWDLNKFTKVCNKISSSMXKCW*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0004088carbamoyl-phosphate synthase (glutamine-hydrolyzing) activity
GO:0005524ATP binding
GO:0003824catalytic activity
GO:0046872metal ion binding
GO:0016787hydrolase activity
GO:0004070aspartate carbamoyltransferase activity
GO:0016597amino acid binding
GO:0016743carboxyl- or carbamoyltransferase activity
GO:0016810hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
GO:0016812hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amides
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR006274CarbamoylP_synth_ssu
IPR036480CarbP_synth_ssu_N_sf
IPR035686CPSase_GATase1
IPR011607MGS-like_dom
IPR006680Amidohydro-rel
IPR032466Metal_Hydrolase
IPR005483CbamoylP_synth_lsu_CPSase_dom
IPR002474CarbamoylP_synth_ssu_N
IPR013816ATP_grasp_subdomain_2
IPR013815ATP_grasp_subdomain_1
IPR029062Class_I_gatase-like
IPR005479CbamoylP_synth_lsu-like_ATP-bd
IPR017926GATASE
IPR016185PreATP-grasp_dom_sf
IPR011761ATP-grasp
IPR005480CarbamoylP_synth_lsu_oligo
Vocabulary: biological process
TermDefinition
GO:0006541glutamine metabolic process
GO:0006807nitrogen compound metabolic process
GO:0006207'de novo' pyrimidine nucleobase biosynthetic process
GO:0006520cellular amino acid metabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00099CPSGATASEcoord: 155..169
score: 62.32
coord: 119..133
score: 49.42
coord: 186..202
score: 69.57
coord: 228..239
score: 64.13
coord: 203..220
score: 54.47
NoneNo IPR availablePRINTSPR00096GATASEcoord: 186..197
score: 62.32
coord: 158..167
score: 61.43
coord: 271..284
score: 49.4
NoneNo IPR availablePRINTSPR00097ANTSNTHASEIIcoord: 158..167
score: 56.0
coord: 186..197
score: 57.88
coord: 271..284
score: 40.78
NoneNo IPR availableGENE3DG3DSA:3.30.470.20coord: 447..706
e-value: 1.5E-108
score: 364.2
NoneNo IPR availableGENE3DG3DSA:3.40.50.20coord: 330..444
e-value: 2.6E-46
score: 157.9
NoneNo IPR availablePANTHERPTHR11405CARBAMOYLTRANSFERASE FAMILY MEMBERcoord: 2..706
NoneNo IPR availablePANTHERPTHR11405:SF38CARBAMOYL-PHOSPHATE SYNTHASE [AMMONIA], MITOCHONDRIALcoord: 2..706
NoneNo IPR availableSUPERFAMILYSSF56059Glutathione synthetase ATP-binding domain-likecoord: 456..706
IPR005483Carbamoyl-phosphate synthase large subunit, CPSase domainPRINTSPR00098CPSASEcoord: 530..549
score: 69.88
coord: 565..582
score: 75.88
coord: 376..386
score: 61.2
coord: 496..508
score: 65.67
coord: 347..361
score: 82.76
coord: 622..651
score: 81.79
IPR002474Carbamoyl-phosphate synthase small subunit, N-terminal domainSMARTSM01097CPSase_sm_chain_2coord: 4..74
e-value: 5.1E-10
score: 26.9
IPR002474Carbamoyl-phosphate synthase small subunit, N-terminal domainPFAMPF00988CPSase_sm_chaincoord: 9..73
e-value: 2.0E-18
score: 66.4
IPR029062Class I glutamine amidotransferase-likeGENE3DG3DSA:3.40.50.880coord: 95..300
e-value: 4.7E-64
score: 218.0
IPR029062Class I glutamine amidotransferase-likeSUPERFAMILYSSF52317Class I glutamine amidotransferase-likecoord: 90..298
IPR006274Carbamoyl-phosphate synthase, small subunitTIGRFAMTIGR01368TIGR01368coord: 9..297
e-value: 3.8E-102
score: 339.9
IPR005479Carbamoyl-phosphate synthetase large subunit-like, ATP-binding domainPFAMPF02786CPSase_L_D2coord: 456..657
e-value: 3.9E-78
score: 261.8
IPR005479Carbamoyl-phosphate synthetase large subunit-like, ATP-binding domainPROSITEPS00867CPSASE_2coord: 622..629
IPR005479Carbamoyl-phosphate synthetase large subunit-like, ATP-binding domainPROSITEPS00866CPSASE_1coord: 492..506
IPR017926Glutamine amidotransferasePFAMPF00117GATasecoord: 121..294
e-value: 9.9E-48
score: 162.4
IPR017926Glutamine amidotransferasePROSITEPS51273GATASE_TYPE_1coord: 118..302
score: 27.309
IPR036480Carbamoyl-phosphate synthase small subunit, N-terminal domain superfamilyGENE3DG3DSA:3.50.30.20coord: 4..84
e-value: 1.2E-21
score: 78.6
IPR036480Carbamoyl-phosphate synthase small subunit, N-terminal domain superfamilySUPERFAMILYSSF52021Carbamoyl phosphate synthetase, small subunit N-terminal domaincoord: 9..78
IPR011761ATP-grasp foldPROSITEPS50975ATP_GRASPcoord: 461..653
score: 38.697
IPR035686Carbamoyl-phosphate synthase small subunit, GATase1 domainCDDcd01744GATase1_CPSasecoord: 119..293
e-value: 2.28928E-102
score: 308.656
IPR016185Pre-ATP-grasp domain superfamilySUPERFAMILYSSF52440PreATP-grasp domaincoord: 332..455