GCR328

Overview
NameGCR328
Smed IDSMED30035967
Length (bp)1274
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GCR328 (SMED30035967) t-SNE clustered cells

Violin plots show distribution of expression levels for GCR328 (SMED30035967) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GCR328 (SMED30035967) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GCR328 (SMED30035967) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035967

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30035967h1SMcG0010729 dd_Smed_v4_16861_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035967h1SMcG0010729 dd_Smed_v4_16861_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30035967h1SMcG0010729 dd_Smed_v4_16861_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30035967h1SMcG0010729 dd_Smed_v4_16861_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30035967h1SMcG0010729 dd_Smed_v6_16861_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GCR328 vs. Ensembl Human
Match: NPY2R (neuropeptide Y receptor Y2 [Source:HGNC Symbol;Acc:HGNC:7957])

HSP 1 Score: 85.8853 bits (211), Expect = 1.088e-17
Identity = 69/244 (28.28%), Postives = 119/244 (48.77%), Query Frame = 2
Query:  245 IVLQTIFSLSIC----VGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIVHVDGSNNTNQCKETWFGNQ--LYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLW-KMPKEITNSIRSVDYSNRRKKXXXXXXXXXXXXXXCWLPHHV 955
            I +Q +  L+ C    +G+IGN LVI  V+ F+ MR   N F+ NLA++D+LV T+  PFTL   +   +K  P  C +    Q   V VS ++L  I+ +R   I++ ++ K+  + S L I L       +A  + +     ++ +        C E W G +  +Y  +Y+  S  ILY       L +     T++W K+   ++    +  Y  RR+K + +L+ + ++F + WLP H 
Sbjct:   47 IEVQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILY----VLPLGIISFSYTRIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHA 286          
BLAST of GCR328 vs. Ensembl Human
Match: NPY2R (neuropeptide Y receptor Y2 [Source:HGNC Symbol;Acc:HGNC:7957])

HSP 1 Score: 85.8853 bits (211), Expect = 1.088e-17
Identity = 69/244 (28.28%), Postives = 119/244 (48.77%), Query Frame = 2
Query:  245 IVLQTIFSLSIC----VGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIVHVDGSNNTNQCKETWFGNQ--LYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLW-KMPKEITNSIRSVDYSNRRKKXXXXXXXXXXXXXXCWLPHHV 955
            I +Q +  L+ C    +G+IGN LVI  V+ F+ MR   N F+ NLA++D+LV T+  PFTL   +   +K  P  C +    Q   V VS ++L  I+ +R   I++ ++ K+  + S L I L       +A  + +     ++ +        C E W G +  +Y  +Y+  S  ILY       L +     T++W K+   ++    +  Y  RR+K + +L+ + ++F + WLP H 
Sbjct:   47 IEVQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILY----VLPLGIISFSYTRIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHA 286          
BLAST of GCR328 vs. Ensembl Human
Match: HCRTR2 (hypocretin receptor 2 [Source:HGNC Symbol;Acc:HGNC:4849])

HSP 1 Score: 84.7297 bits (208), Expect = 3.979e-17
Identity = 95/361 (26.32%), Postives = 155/361 (42.94%), Query Frame = 2
Query:  239 YSIVLQTIFSLSICVGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIVHVDGSNNT---NQCKETWFGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLW------------------------KMPKEITNSIRSVDYSN-----RRKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINPFCSLLISTKFRYCVKYIFKYLYSAAKHRGFNRSKNKLPVGKASSQ 1225
            Y  VL   + +   V +IGN LV ++V     MR   N F++NL+++D+LV     P TL   +   + F    C+V   LQ+ +V VSVL+L  I+ +R+Y I  P+ +K   K +R  I ++ I    I +   +      V    +N T     C E W G ++Y K+Y    F + Y+ PL  M++ +  +  KLW                        + P + T S  S   +       R+K + +L+++ L+F IC+LP  +  +           E     Y  F        S ++ Y NS+ NP     +S KFR   K  F        H    R +++L  G+ S++
Sbjct:   53 YEWVLIAGYIIVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETWFFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVIIWIVSCIIMIPQAIVMECSTVFPGLANKTTLFTVCDERW-GGEIYPKMYHICFFLVTYMAPLCLMVLAYLQIFRKLWCRQIPGTSSVVQRKWKPLQPVSQPRGPGQPTKSRMSAVAAEIKQIRARRKTARMLMIVLLVFAICYLPISILNVLKRVFGMFAHTEDRETVYAWFTF------SHWLVYANSAANPIIYNFLSGKFREEFKAAFSCCCLGVHH----RQEDRLTRGRTSTE 402          
BLAST of GCR328 vs. Ensembl Human
Match: HCRTR2 (hypocretin receptor 2 [Source:HGNC Symbol;Acc:HGNC:4849])

HSP 1 Score: 84.7297 bits (208), Expect = 3.979e-17
Identity = 95/361 (26.32%), Postives = 155/361 (42.94%), Query Frame = 2
Query:  239 YSIVLQTIFSLSICVGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIVHVDGSNNT---NQCKETWFGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLW------------------------KMPKEITNSIRSVDYSN-----RRKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINPFCSLLISTKFRYCVKYIFKYLYSAAKHRGFNRSKNKLPVGKASSQ 1225
            Y  VL   + +   V +IGN LV ++V     MR   N F++NL+++D+LV     P TL   +   + F    C+V   LQ+ +V VSVL+L  I+ +R+Y I  P+ +K   K +R  I ++ I    I +   +      V    +N T     C E W G ++Y K+Y    F + Y+ PL  M++ +  +  KLW                        + P + T S  S   +       R+K + +L+++ L+F IC+LP  +  +           E     Y  F        S ++ Y NS+ NP     +S KFR   K  F        H    R +++L  G+ S++
Sbjct:   53 YEWVLIAGYIIVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETWFFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVIIWIVSCIIMIPQAIVMECSTVFPGLANKTTLFTVCDERW-GGEIYPKMYHICFFLVTYMAPLCLMVLAYLQIFRKLWCRQIPGTSSVVQRKWKPLQPVSQPRGPGQPTKSRMSAVAAEIKQIRARRKTARMLMIVLLVFAICYLPISILNVLKRVFGMFAHTEDRETVYAWFTF------SHWLVYANSAANPIIYNFLSGKFREEFKAAFSCCCLGVHH----RQEDRLTRGRTSTE 402          
BLAST of GCR328 vs. Ensembl Human
Match: HRH2 (histamine receptor H2 [Source:HGNC Symbol;Acc:HGNC:5183])

HSP 1 Score: 78.5666 bits (192), Expect = 2.640e-15
Identity = 84/335 (25.07%), Postives = 160/335 (47.76%), Query Frame = 2
Query:  245 IVLQTIFSLSICVGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXX---XXMPLGYASEIVHVDGSNNTNQCKETWFGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLWKMPKEITNSIRSVD----YSNRRKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINPFCSLLISTKFRYCVKYIFKYLYSAAKHRGFNRSKNKLPVGKASSQF 1228
            I +  + ++ I + + GN +V ++V L + +RN  N F+++LAI+D+L+  +  PF+   Q++  + F   FC + + L       S+L+L  IS +R+  +M P++Y ++    R+ I L+ IW++SI    LS+ LG+ S      G++ T++CK     N++Y  +    +F++  LI              +++K+ ++    I  +      + R  K ++ L  +   F+ICW P+    +Y               + DD I E L  I  ++ Y NS++NP     ++  FR   + +F         R  NR+ +K  +   +SQ 
Sbjct:   19 ITITVVLAVLILITVAGNVVVCLAVGLNRRLRNLTNCFIVSLAITDLLLGLLVLPFSAIYQLSCKWSFGKVFCNIYTSLDVMLCTASILNLFMISLDRYCAVMDPLRYPVLVTPVRVAISLVLIWVISITLSFLSIHLGWNSRNETSKGNHTTSKCKVQ--VNEVYGLVDGLVTFYLPLLIMCITYY--------RIFKVARDQAKRINHISSWKAATIREHKATVTLAAVMGAFIICWFPYFTAFVYRGL------------RGDDAINEVLEAIVLWLGYANSALNPILYAALNRDFRTGYQQLFCC-------RLANRNSHKTSLRSNASQL 324          
BLAST of GCR328 vs. Ensembl Celegans
Match: npr-11 (Putative neuropeptide Y receptor 11 [Source:UniProtKB/Swiss-Prot;Acc:Q18179])

HSP 1 Score: 74.3294 bits (181), Expect = 2.961e-14
Identity = 41/122 (33.61%), Postives = 69/122 (56.56%), Query Frame = 2
Query:  200 EKIISFLENNKNPYSIVLQTIFSLSICVGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQ 565
            +++I+  E +   +   +   + L I  G IGNFL I+ V+L   MR   N F+LNLA+SD  V  + AP TL+  + + + FS   C++   LQ   + +S  S+ SI+ +R+ +I+FP +
Sbjct:   25 DQVINGTEYSPKEFGYFITFAYMLIILFGAIGNFLTIIVVILNPAMRTTRNFFILNLALSDFFVCIVTAPTTLYTVLYMFWPFSRTLCKIAGSLQGFNIFLSTFSIASIAVDRYVLIIFPTK 146          
BLAST of GCR328 vs. Ensembl Celegans
Match: npr-12 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:V6CLI1])

HSP 1 Score: 73.1738 bits (178), Expect = 5.862e-14
Identity = 71/307 (23.13%), Postives = 145/307 (47.23%), Query Frame = 2
Query:  260 IFSLSICVGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIVHVDGSNN-----------------TNQCKETWFGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLWKMPK--EITNSIRSVDYSNRRKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINPFCSLLISTKFR 1123
            ++ L    G + NF+V+++ +    +RN  N F++NLA SD+++  + AP TL+  +NL + F  + C+  +G+Q+    VS L+L  I+ +R  + + P+++++      L   ++ I  + +AL   L  +S++   D  ++                   + +E W    + +  YTF    I Y++PL  +   +F + + + K  K     ++ R +   NR ++  ++L +L L + +CW P ++  + N         E I+   + +I   L  IS      ++ +NP    L++  FR
Sbjct:   47 MYGLVCSFGALANFIVLLAFVRTANLRNLRNSFIVNLAFSDLILCVVTAPVTLYTSLNLFWPFGDWSCKFLAGVQAVNTFVSSLTLAFIAMDRVLLTLCPVRWRLAATAPLLCYGVVWIISIIVALPYALAVSSKLAPFDPWSDRATPKMLTYCNRQVPEICAEMQEAWDNAIVSKTTYTFVVLGIQYILPLAALAYAYFQIGSTIQKRSKVSRTVDTTRRMQMQNRNRRALLLLFLLVLTYAVCWAPMNIYHVLNGL-------EIINYSQNMYIFCHLVGIS------STCVNPIVYALVNESFR 340          
BLAST of GCR328 vs. Ensembl Celegans
Match: npr-12 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:V6CLI1])

HSP 1 Score: 73.1738 bits (178), Expect = 5.956e-14
Identity = 72/307 (23.45%), Postives = 145/307 (47.23%), Query Frame = 2
Query:  260 IFSLSICVGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIVHVDGSNN-----------------TNQCKETWFGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLWKMPK--EITNSIRSVDYSNRRKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINPFCSLLISTKFR 1123
            ++ L    G + NF+V+++ +    +RN  N F++NLA SD+++  + AP TL+  +NL + F  + C+  +G+Q+    VS L+L  I+ +R  + + P+++++      L   ++ I  + +AL   L  +S++   D  ++                   + +E W    + +  YTF    I Y++PL  +   +F + + + K  K     ++ R +   NR ++  ++L +L L + +CW P ++  + N   I  YS        + +I   L  IS      ++ +NP    L++  FR
Sbjct:   41 MYGLVCSFGALANFIVLLAFVRTANLRNLRNSFIVNLAFSDLILCVVTAPVTLYTSLNLFWPFGDWSCKFLAGVQAVNTFVSSLTLAFIAMDRVLLTLCPVRWRLAATAPLLCYGVVWIISIIVALPYALAVSSKLAPFDPWSDRATPKMLTYCNRQVPEICAEMQEAWDNAIVSKTTYTFVVLGIQYILPLAALAYAYFQIGSTIQKRSKVSRTVDTTRRMQMQNRNRRALLLLFLLVLTYAVCWAPMNIYHVLNGLEIINYSQ-------NMYIFCHLVGIS------STCVNPIVYALVNESFR 334          
BLAST of GCR328 vs. Ensembl Celegans
Match: npr-10 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:Q6EUU1])

HSP 1 Score: 72.4034 bits (176), Expect = 1.020e-13
Identity = 47/173 (27.17%), Postives = 89/173 (51.45%), Query Frame = 2
Query:  248 VLQTIFSLSICVGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIVHVDGSNNTNQCKETWFGNQLYRKIYTFFSFFI 766
            +L TI+++ + VG+ GN LV+MSV+ F+ +++  N+F+++L++SDI V  ++   T     + V+ F    C +   LQ T +  S L+L +I+ +R+ +I  P +  +  +  +    +     +S+ LS+PL    E++          C E W  +   R +Y    F I
Sbjct:   30 ILATIYTIIVVVGVTGNLLVVMSVMRFKVLQSVRNMFIVSLSVSDIFVAIVSGSVTPITAFSKVWLFGGPLCHLLPLLQGTALSFSTLTLTAIAIDRYILICHPTKEPI--RKDQALKMISFNSAISVGLSVPLFMKQELMQFRNYCG-EYCSENWGPDAYLRSVYGTVVFII 199          
BLAST of GCR328 vs. Ensembl Celegans
Match: npr-10 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:Q6EUU1])

HSP 1 Score: 72.4034 bits (176), Expect = 1.127e-13
Identity = 47/173 (27.17%), Postives = 89/173 (51.45%), Query Frame = 2
Query:  248 VLQTIFSLSICVGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIVHVDGSNNTNQCKETWFGNQLYRKIYTFFSFFI 766
            +L TI+++ + VG+ GN LV+MSV+ F+ +++  N+F+++L++SDI V  ++   T     + V+ F    C +   LQ T +  S L+L +I+ +R+ +I  P +  +  +  +    +     +S+ LS+PL    E++          C E W  +   R +Y    F I
Sbjct:   30 ILATIYTIIVVVGVTGNLLVVMSVMRFKVLQSVRNMFIVSLSVSDIFVAIVSGSVTPITAFSKVWLFGGPLCHLLPLLQGTALSFSTLTLTAIAIDRYILICHPTKEPI--RKDQALKMISFNSAISVGLSVPLFMKQELMQFRNYCG-EYCSENWGPDAYLRSVYGTVVFII 199          
BLAST of GCR328 vs. Ensembl Fly
Match: TkR99D (gene:FBgn0004622 transcript:FBtr0085507)

HSP 1 Score: 80.4925 bits (197), Expect = 5.465e-16
Identity = 78/322 (24.22%), Postives = 150/322 (46.58%), Query Frame = 2
Query:  245 IVLQTIFSLSICVGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIVHVDGSNNTNQCKETW----FGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLWKMPKEITNSIRSVDYSNRRKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINPFCSLLISTKFRYCVKYIFKY-LYSAAKHRGFNRSKN 1195
            ++   +F   + V   GN +V+  V+  + MR   N F++NL+I+D +V ++   F  +  ++  + F  F+C++   +   ++  SV +LM+IS +R+  I+ P+Q +M  + +     ++ +    I+  M + Y +E V V G +N   C   W      +     +Y      + Y +P+  M + +  +  +LW        + R V+    ++++  ++I++ LIF ICWLP H   I       I  A         FI E    I  ++   NS  NP     ++++FRY  K +F++ L+       F+R +N
Sbjct:  102 VLWSILFGGMVIVATGGNLIVVWIVMTTKRMRTVTNYFIVNLSIADAMVSSLNVTFNYYYMLDSDWPFGEFYCKLSQFIAMLSICASVFTLMAISIDRYVAIIRPLQPRMSKRCNLAIAAVIWLASTLISCPMMIIYRTEEVPVRGLSNRTVCYPEWPDGPTNHSTMESLYNILIIILTYFLPIVSMTVTYSRVGIELWGSKTIGECTPRQVENVRSKRRVVKMMIVVVLIFAICWLPFHSYFIITSCYPAITEAP--------FIQELYLAI-YWLAMSNSMYNPIIYCWMNSRFRYGFKMVFRWCLFVRVGTEPFSRREN 414          
BLAST of GCR328 vs. Ensembl Fly
Match: TkR99D (gene:FBgn0004622 transcript:FBtr0301656)

HSP 1 Score: 80.4925 bits (197), Expect = 5.639e-16
Identity = 78/322 (24.22%), Postives = 150/322 (46.58%), Query Frame = 2
Query:  245 IVLQTIFSLSICVGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIVHVDGSNNTNQCKETW----FGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLWKMPKEITNSIRSVDYSNRRKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINPFCSLLISTKFRYCVKYIFKY-LYSAAKHRGFNRSKN 1195
            ++   +F   + V   GN +V+  V+  + MR   N F++NL+I+D +V ++   F  +  ++  + F  F+C++   +   ++  SV +LM+IS +R+  I+ P+Q +M  + +     ++ +    I+  M + Y +E V V G +N   C   W      +     +Y      + Y +P+  M + +  +  +LW        + R V+    ++++  ++I++ LIF ICWLP H   I       I  A         FI E    I  ++   NS  NP     ++++FRY  K +F++ L+       F+R +N
Sbjct:  102 VLWSILFGGMVIVATGGNLIVVWIVMTTKRMRTVTNYFIVNLSIADAMVSSLNVTFNYYYMLDSDWPFGEFYCKLSQFIAMLSICASVFTLMAISIDRYVAIIRPLQPRMSKRCNLAIAAVIWLASTLISCPMMIIYRTEEVPVRGLSNRTVCYPEWPDGPTNHSTMESLYNILIIILTYFLPIVSMTVTYSRVGIELWGSKTIGECTPRQVENVRSKRRVVKMMIVVVLIFAICWLPFHSYFIITSCYPAITEAP--------FIQELYLAI-YWLAMSNSMYNPIIYCWMNSRFRYGFKMVFRWCLFVRVGTEPFSRREN 414          
BLAST of GCR328 vs. Ensembl Fly
Match: TkR99D (gene:FBgn0004622 transcript:FBtr0330298)

HSP 1 Score: 80.1073 bits (196), Expect = 8.103e-16
Identity = 78/322 (24.22%), Postives = 150/322 (46.58%), Query Frame = 2
Query:  245 IVLQTIFSLSICVGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIVHVDGSNNTNQCKETW----FGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLWKMPKEITNSIRSVDYSNRRKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINPFCSLLISTKFRYCVKYIFKY-LYSAAKHRGFNRSKN 1195
            ++   +F   + V   GN +V+  V+  + MR   N F++NL+I+D +V ++   F  +  ++  + F  F+C++   +   ++  SV +LM+IS +R+  I+ P+Q +M  + +     ++ +    I+  M + Y +E V V G +N   C   W      +     +Y      + Y +P+  M + +  +  +LW        + R V+    ++++  ++I++ LIF ICWLP H   I       I  A         FI E    I  ++   NS  NP     ++++FRY  K +F++ L+       F+R +N
Sbjct:  102 VLWSILFGGMVIVATGGNLIVVWIVMTTKRMRTVTNYFIVNLSIADAMVSSLNVTFNYYYMLDSDWPFGEFYCKLSQFIAMLSICASVFTLMAISIDRYVAIIRPLQPRMSKRCNLAIAAVIWLASTLISCPMMIIYRTEEVPVRGLSNRTVCYPEWPDGPTNHSTMESLYNILIIILTYFLPIVSMTVTYSRVGIELWGSKTIGECTPRQVENVRSKRRVVKMMIVVVLIFAICWLPFHSYFIITSCYPAITEAP--------FIQELYLAI-YWLAMSNSMYNPIIYCWMNSRFRYGFKMVFRWCLFVRVGTEPFSRREN 414          
BLAST of GCR328 vs. Ensembl Fly
Match: ETHR (gene:FBgn0038874 transcript:FBtr0084054)

HSP 1 Score: 77.411 bits (189), Expect = 4.535e-15
Identity = 81/295 (27.46%), Postives = 138/295 (46.78%), Query Frame = 2
Query:  281 VGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNL---VYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASE---IVHVDGSNNT---NQCKETWFGNQLYRKIYTFF--SFFILYXXXXXXXXXXXXXXXTKLWKMPKEITNSIRSVDYSNRRKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILER---LTPISQFMCYLNSSINPFCSLLISTKFR 1123
            +G++GN +V + ++  + MRN  NIFL NL+I+D+LVL +  P T+  +VN     +      C+    ++ T  H SVL++++ISFER+Y I  P++   +    R  +  +  W ++   + P+ + +E     ++DGS+      Q    W        I  FF   F  L ++       L       L   P +   S+++      RK++ ++L  + L F +C LP  V        + ++   S  +   D  L R   L    + M YLNS++NP    L+STKFR
Sbjct:   23 LGVVGNVMVPIVIVKTKDMRNSTNIFLTNLSIADLLVLLVCTP-TVLVEVNTRPETWVLGHEMCKAVPFVELTVAHASVLTILAISFERYYAICEPLKAGYVCTKGRAILICVLAWGIAALFTSPILWVAEYKLAEYIDGSSVAVCLTQAISDWTLAFFLMTISVFFVVPFVTLVVLYGIIARNLVSNRAAMLRARPTKPELSLKA------RKQVVLMLGAVVLSFFVCLLPFRV--------LTLWIILSTDQTLHDLGLVRYYSLLYFCRIMLYLNSAMNPILYNLMSTKFR 302          
BLAST of GCR328 vs. Ensembl Fly
Match: ETHR (gene:FBgn0038874 transcript:FBtr0339194)

HSP 1 Score: 77.411 bits (189), Expect = 4.535e-15
Identity = 81/295 (27.46%), Postives = 138/295 (46.78%), Query Frame = 2
Query:  281 VGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNL---VYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASE---IVHVDGSNNT---NQCKETWFGNQLYRKIYTFF--SFFILYXXXXXXXXXXXXXXXTKLWKMPKEITNSIRSVDYSNRRKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILER---LTPISQFMCYLNSSINPFCSLLISTKFR 1123
            +G++GN +V + ++  + MRN  NIFL NL+I+D+LVL +  P T+  +VN     +      C+    ++ T  H SVL++++ISFER+Y I  P++   +    R  +  +  W ++   + P+ + +E     ++DGS+      Q    W        I  FF   F  L ++       L       L   P +   S+++      RK++ ++L  + L F +C LP  V        + ++   S  +   D  L R   L    + M YLNS++NP    L+STKFR
Sbjct:   23 LGVVGNVMVPIVIVKTKDMRNSTNIFLTNLSIADLLVLLVCTP-TVLVEVNTRPETWVLGHEMCKAVPFVELTVAHASVLTILAISFERYYAICEPLKAGYVCTKGRAILICVLAWGIAALFTSPILWVAEYKLAEYIDGSSVAVCLTQAISDWTLAFFLMTISVFFVVPFVTLVVLYGIIARNLVSNRAAMLRARPTKPELSLKA------RKQVVLMLGAVVLSFFVCLLPFRV--------LTLWIILSTDQTLHDLGLVRYYSLLYFCRIMLYLNSAMNPILYNLMSTKFR 302          
BLAST of GCR328 vs. Ensembl Zebrafish
Match: grpr (gastrin-releasing peptide receptor [Source:ZFIN;Acc:ZDB-GENE-081015-4])

HSP 1 Score: 88.1965 bits (217), Expect = 1.014e-18
Identity = 88/301 (29.24%), Postives = 155/301 (51.50%), Query Frame = 2
Query:  242 SIVLQTIFSLSICVGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEI--VHVDGSNNT-NQCKETWFGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLWK----MPKEITNSIRSVDYSNRRKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINPFCSLLISTKFR 1123
             I++ T+++L I  G+IGN  +I +  + + MRN  N+F+ +LA+ D+L+L   AP      +   + F    C++   +Q T+V VSV +L +++ +R+  I+ PM  +    + ++ +   SIW+LS+ L++P    S++   H+  +N T   C        L+ KI++  SF ILY+IPLF + + +  +   L +    MP E    IR    S  R +L+  +++   +F ICWLP+HV  +Y       Y    +      FI    +  ++ + + NS +NPF   L+S  FR
Sbjct:   34 GIIIATVYALLITAGLIGNVTLIRTFCIVKSMRNVPNLFMSSLALGDVLLLVTCAPVDASKFLADEWLFGRMGCKLIPFIQLTSVGVSVFTLTALAADRYKAIVKPMDIQSSKASLKVCLRAASIWMLSMVLAIPEAVFSDLHTFHIPQTNETFKTCAPYPHAGDLHPKIHSMASFLILYIIPLFIISVYYIFIARSLIQSANNMPVEGNTHIRRQVES--RMRLAKTVLVFVGLFAICWLPNHVIYLYRS-----YHYTEVDTSMAHFI---ASVCARILAFTNSCVNPFALYLLSKSFR 324          
BLAST of GCR328 vs. Ensembl Zebrafish
Match: kiss1rb (KISS1 receptor b [Source:ZFIN;Acc:ZDB-GENE-060526-54])

HSP 1 Score: 84.3445 bits (207), Expect = 1.961e-17
Identity = 86/298 (28.86%), Postives = 153/298 (51.34%), Query Frame = 2
Query:  263 FSLSICVGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIVHVDGS---NNTNQCKETWFGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLWK---MPKEITNSIRSVDYSNRRKKX-----XXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINPFCSLLISTKFR 1123
            F+L + VG++GN +VI  V+  Q M+   N++++NLA +DIL L    PFT    V   + F  F C++ + LQ  T   + ++L ++S +RFYV ++P+Q               +IW+ S  LS+P+       H + S        C ET F + +++++Y  +SF  +YL+PL  + + +  ++ ++ +    P +  N I S+  S+ R +      S +++++ L+FL+CW P  +       +++ + AE +SR Y    L +L   +  M Y NSSINP     +   FR
Sbjct:   49 FTLIMFVGLVGNLIVIYVVIKNQQMKTVTNLYIVNLATTDILFLVCCVPFTATVYVLPSWIFGDFMCRLVNYLQQVTAQATCITLSAMSVDRFYVTVYPLQSLHHRTPQMALSVCTTIWICSSLLSVPIALYQ---HTESSYWFGPQTYCTET-FPSVIHKRVYLLYSFLAVYLLPLITICMCYTFMLKRMAQATVQPVQGCNQI-SLQTSSERAEAVRSRVSRMVVVMVLLFLLCWGPIQIL-----ILLQAFCAEDVSRSYT---LYKLKIWAHGMSYSNSSINPVIYAFMGANFR 333          
BLAST of GCR328 vs. Ensembl Zebrafish
Match: AL929549.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_1_26:33067396:33103059:1 gene:ENSDARG00000113516.1 transcript:ENSDART00000190287.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL929549.1)

HSP 1 Score: 84.7297 bits (208), Expect = 2.250e-17
Identity = 96/324 (29.63%), Postives = 163/324 (50.31%), Query Frame = 2
Query:  281 VGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLG--------YASEIVHVDGSNNTNQ----CKETWFGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLWKMPKEITNSIRSVDYSNRRKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINPFCSLLISTKFRYCVKYIFKYLYSAAKHRGFNRSKNKLPVGKA 1216
            V ++GN +V   VL  + MR   N+F+LNLAISD+LV     P TL + +   + F    C++   +Q  +V  SV +L++I+ +RF  I++P + K+    S   + ++ IW+L+I++  P G        +   I+  DG  NT Q    C+E W  NQ  RKIYT   F  +YL PL  ++I++  +   L+K         R +  S ++K++  +L+++ L+F++ WLP     + +D+        S+S +    I     P++ ++ + NSS+NP      +  FR   K  FK L   + H G  R+ +    G A
Sbjct:   47 VCMVGNGVVCFIVLRSKNMRTVTNLFILNLAISDLLVGIFCMPTTLVDNIITGWPFGSLVCKLSGMVQGISVSASVFTLVAIAVDRFRCIVYPFKQKLTISTS--TLIIIIIWVLAISIMCPSGVMLQVTKEHRVSILLSDG--NTTQPFYWCRENW-PNQEMRKIYTTVLFANIYLAPLTLIVIMYARIGITLFKTSMPCRYESRQL-VSRKKKRVIKMLLVVALLFILSWLPLWALMMLSDY-------ASLSERQHRVINIYFYPLAHWLAFCNSSVNPIIYGFFNENFRKGFKAAFK-LQLCSGHSGNRRTYSHRLQGNA 356          
BLAST of GCR328 vs. Ensembl Zebrafish
Match: nmbr (neuromedin B receptor [Source:ZFIN;Acc:ZDB-GENE-041014-369])

HSP 1 Score: 83.9593 bits (206), Expect = 2.605e-17
Identity = 82/297 (27.61%), Postives = 152/297 (51.18%), Query Frame = 2
Query:  248 VLQTIFSLSICVGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIVHVDGSNNT-NQCKETWFGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLWK----MPKEITNSIRSVDYSNRRKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINPFCSLLISTKFR 1123
            V+ +++ L I VG++GN  ++   +    MR+  NIF+ +LA+ D+L+L    P   F      + F    C++   +Q T+V VSV +L ++S +R   I+ PM  +         +  ++IW++S+ L++P    S++VH+   N T   C      N+++ KI++   F + +LIPL  + + ++ +   L K    MP EI+    S   +  RK+L+ I+++   +F +CW P+HV  +Y  F     +   I       I   +T +++ + + +S +NPF   L+S  FR
Sbjct:   34 VIPSVYILIITVGLLGNITLVKIFITTSAMRSVPNIFISSLAVGDLLLLVTCVPVDAFRYFYEEWIFGTVACKMIPVIQLTSVGVSVFTLTALSADRHKAIVNPMDIQSSSAVFWTCLKAITIWVVSVLLAIPEAVFSQVVHMPDKNTTFTACVPYPLSNEMHPKIHSIMIFLVYFLIPLSIISVYYYHIARTLIKSAHDMPGEISE--HSKRQTETRKRLAKIVLVFVGLFALCWFPNHVLYMYRSF-----NYRQIDSSLSHLI---ITLVARVLSFSSSCVNPFALYLLSESFR 320          
BLAST of GCR328 vs. Ensembl Zebrafish
Match: ghsrb (growth hormone secretagogue receptor b [Source:ZFIN;Acc:ZDB-GENE-090327-1])

HSP 1 Score: 83.9593 bits (206), Expect = 2.767e-17
Identity = 82/299 (27.42%), Postives = 158/299 (52.84%), Query Frame = 2
Query:  281 VGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPF-----FCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIVHVDGSN--NTNQCKETWFG---NQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLWKMPKEITNSIRSVDYSNRRKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINPFCSLLISTKFRYCVKYIFK 1147
            VGI GN L I+ V  ++ MR   N++L ++A+SD+L+  +  P  L+     V+++ P+      C++   +  +  + ++L++ ++S ER++ I FP++ K+I    R+K  +L +W +++  + P+     + H +G+N   TN+CK T +      L   ++    FF L   P+  + +L+ ++  +LW+  +     I S D SN  K+   +L ++ L F++CWLP HV      +++   S+E+ S      I E    +S  + YL+++INP    ++S KFR     +F+
Sbjct:   55 VGIAGNLLTILVVTKYKDMRTTTNLYLCSMALSDLLIF-LCMPLDLYR----VWRYRPWNFGDELCKLFQFVSESCTYSTILNITALSVERYFAICFPLRAKVIVTRGRVKGVILLLWTVALCSAGPIFILVGVEHENGTNAWETNECKATEYAIRSGLLTMMVWVSSVFFFL---PVLCLTVLYSLIGRRLWRRKENPVGPISSRDKSN--KQTVKMLAVVVLAFVLCWLPFHV----GRYLVS-KSSEANSPVISQ-ISEYCNLVSFVLFYLSAAINPILYNIMSKKFRSAACKLFR 337          
BLAST of GCR328 vs. Ensembl Xenopus
Match: ENSXETT00000015562.1 (Xenopus tropicalis orexin receptor type 2-like (LOC101733830), mRNA. [Source:RefSeq mRNA;Acc:NM_001365183])

HSP 1 Score: 95.9005 bits (237), Expect = 5.858e-21
Identity = 95/315 (30.16%), Postives = 162/315 (51.43%), Query Frame = 2
Query:  227 NKNPYSIVLQTIFSLSICVGIIGNFLVIMSVLLFQFMRN-------FANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYAS---EIVHVDGSNNT-NQCKETWFGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLWKMP---KEITNSIRSVDYSNR--RKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINPFCSLLISTKFR 1123
            +K P +I L T++ LS  VGIIGN   IMS+ +    R+            L+NLAI D++V+ I  P T+ N +  V+ +  F C+    +Q+ +V  SVLSL  IS  R+Y +  P+  +  F   ++   ++ +W++S ++ MPL + +   EI  + G       C E W  + ++++ Y F  F  LY +P+ F +++ F+ I KLW      KE  +  +S+  S    RKK++ +++ L  +F + WLP ++  I+ DF I   S E     +    +  L P +Q++   NSS+NP C   +   +R
Sbjct:   48 DKEPITITLTTMYVLSFVVGIIGN---IMSIKVLTGKRSGRTSSLSATRSLLINLAICDLMVVCICMPITVGNLIYKVWVYGDFLCRAVPFIQAVSVSASVLSLTVISVNRYYNVHNPLNARSFFTQKKILCTIVVVWVVSSSICMPLIFMNRRDEIAIIPGLPFVFPICLEIW-PHVMFKQAYNFLLFCALYCLPVLFNMVICFLTIRKLWSSAYNFKECDSRNQSLPVSRLKVRKKIAKMVVALVSLFAVSWLPVYMLDIWIDFNIPQPSQEDTPSPW----ILHLRPFAQWLGLTNSSLNPICYCFVGDLYR 354          
BLAST of GCR328 vs. Ensembl Xenopus
Match: NPY2R (neuropeptide Y receptor Y2 [Source:NCBI gene;Acc:100498351])

HSP 1 Score: 84.7297 bits (208), Expect = 2.443e-17
Identity = 70/249 (28.11%), Postives = 126/249 (50.60%), Query Frame = 2
Query:  245 IVLQTIFSLSICVGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIVHVDGSNNTNQCKETW-FGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLWKMPKEITNSIRSVDYSNRRKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKI 988
            +VL   +S  I +G++GN LVI  V+ F+ MR   N F++NLA+SD++V T+  PFTL   +   +KF    C + +  Q   V VS ++LM I+ +R   I++ ++ K+  K   + I +  +    +A  + +     ++ +        C E W  G+  Y  IY+     I Y++PL  +   +  + TKL      ++    +  Y  RR+K + +L+ + ++F +CWLP H   + +D   K+
Sbjct:   74 VVLILAYSSIILLGVLGNSLVIYVVIKFKTMRTVTNFFIVNLAVSDLMVNTLCLPFTLVYTLLDDWKFGTVLCHLVTYSQGLAVQVSTVTLMVIALDRHRCIVYHLESKISTKICFMIIGITWVCSALLASPLAIFKEYSVIVISSDFQIQACSERWPVGDLNYGTIYSISMLLIQYIVPLAIISYAYIRIWTKL---KNHVSPGGGNDHYHQRRRKTTKMLVAVVVVFAVCWLPFHAFQLASDIDGKV 319          
BLAST of GCR328 vs. Ensembl Xenopus
Match: HCRTR2 (hypocretin (orexin) receptor 2 [Source:NCBI gene;Acc:100495420])

HSP 1 Score: 85.1149 bits (209), Expect = 2.499e-17
Identity = 97/360 (26.94%), Postives = 161/360 (44.72%), Query Frame = 2
Query:  239 YSIVLQTIFSLSICVGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIVHVDGSNNT---NQCKETWFGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLW------------KMPKEITNSIRS----------------VDYSNRRKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINPFCSLLISTKFRYCVKYIFKYLYSAAKHRGFNRSKNKLPVGKASSQ 1225
            Y  VL   + +   + +IGN LV ++V     MR   N F++NL+++D+LV  I  P TL   +   + F    C+V   LQ+ +V VSVL+L  I+ +R+Y I  P+ +K   K ++  I ++ I   +I +   +      V  + +N T     C E W G Q+Y K+Y    F I Y++PL  M++ +  +  KLW            K  K +  SI+S                +   + R+K + +L+++ L+F +C+LP  +  I                 Y  F        S ++ Y NS+ NP     +S KFR      FK  +S       N   ++L  G+AS++
Sbjct:   51 YEWVLIVGYIIVFIIALIGNILVCVAVWKNHHMRTVTNYFIVNLSLADVLVTIICLPATLLVDITETWFFGKTLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRAQQSIVIIWIVSCAIMIPQAIVMECRSVFPELANKTILFTVCDERWEG-QIYSKVYHICFFCITYMVPLCLMILAYLQIFRKLWCRQIPGTSSVVQKKWKPLQCSIQSKGQQSTKSRNNAVAAEIKQIHARRKTARMLMVVLLVFALCYLPISILNILKRVFGMFTHTNDRETVYAWFTF------SHWLVYANSAANPIIYNFLSGKFR----EEFKAAFSCCCRGIHNNQDDRLIRGRASTE 399          
BLAST of GCR328 vs. Ensembl Xenopus
Match: slc11a2 (solute carrier family 11 member 2 [Source:Xenbase;Acc:XB-GENE-487563])

HSP 1 Score: 84.7297 bits (208), Expect = 3.001e-17
Identity = 83/303 (27.39%), Postives = 152/303 (50.17%), Query Frame = 2
Query:  245 IVLQTIFSLSICVGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEI-VHVD--GSNNTNQCKETWFGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLWKMPK----EITNSIRSVDYSN---RRKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINPFCSLLISTKFR 1123
            I   TI  L   + + GN LV+  V   + MR   NIF+ +LA+SD+L+     PFT+   ++  +    F C++   +QST +   +L++  I+ ER   I+ P++ K  + N R    L  +WL++  + +P+ +A  + V  D         C E W  +Q+++KIYT F   IL+L+PL  ML+L+  +  +LW   +     +  +I   + S    ++K+  I++I + ++F +CW P HV  +  ++        +   +YDD  ++ +  I Q + + NS  NP     ++  F+
Sbjct:   80 IAFVTICVLIFVLALFGNSLVLYVVTRSKAMRTVTNIFICSLALSDLLIAFFCIPFTMLQNISSNWLGGAFACKMVPFVQSTAIVTEILTMTCIAVERHQGIVHPLKMKWQYTNRRAFTMLGIVWLIAAVVGIPMWHAQRLEVKYDFLYEKQYVCCLEAW-NSQVHQKIYTTFILVILFLLPLTVMLLLYSKIGYELWIKKRVGDASVLQTIHGSEMSKIARKKKRAIIMMITVVVLFAVCWAPFHVVHMMIEY-------SNFENEYDDVTIKIIFAIVQIIGFFNSICNPIVYAFMNENFK 374          
BLAST of GCR328 vs. Ensembl Xenopus
Match: NPFFR2 (neuropeptide FF receptor 2 [Source:NCBI gene;Acc:100498122])

HSP 1 Score: 80.4925 bits (197), Expect = 6.929e-16
Identity = 88/300 (29.33%), Postives = 150/300 (50.00%), Query Frame = 2
Query:  287 IIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEI-------VHVDGSNNTNQ---CKETWFGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLWKMPKEITNSIRSVD---YSNRRKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINPFCSLLISTKFRYCVKYIFK 1147
            ++GN +V   VL  + MR   N+F+LNLAISD+LV     P TL + +   + F    C++   +Q  +V  SV +L++I+ +RF  I++P + K+    S   + ++ IW+L+IA+  P    S +       V +  SN TN    C+E W  N   RKIYT   F  +YL PL  ++I++  +   L+K    + N          S R++K+  +LI++ L+F++ WLP     +  D+        ++++     I   + P + ++ + NSSINP      +  FR   +  FK
Sbjct:   57 MLGNGVVCFIVLSSKHMRTVTNLFILNLAISDLLVGIFCMPTTLLDNIIAGWPFGSTVCKMSGMVQGISVSASVFTLVAIAVDRFRCIVYPFKQKLTI--STAVVIIVVIWVLAIAIMCPSAVMSHVKEDKNFRVVIGNSNQTNPIYWCREDW-PNPEMRKIYTTVLFSNIYLAPLSLIVIMYARIGITLFKSELNVENKNHQQPRHAVSRRKQKVIKMLIIIALLFILSWLPLWTLMMLTDY-------ANLTQNQYQMINIYIYPFAHWLAFFNSSINPIIYGFFNENFRRGFQAAFK 346          
BLAST of GCR328 vs. Ensembl Mouse
Match: Npy2r (neuropeptide Y receptor Y2 [Source:MGI Symbol;Acc:MGI:108418])

HSP 1 Score: 83.9593 bits (206), Expect = 2.745e-17
Identity = 68/244 (27.87%), Postives = 119/244 (48.77%), Query Frame = 2
Query:  245 IVLQTIFSLSIC----VGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIVHVDGSNNTNQCKETWFGNQ--LYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLW-KMPKEITNSIRSVDYSNRRKKXXXXXXXXXXXXXXCWLPHHV 955
            + +Q I  L+ C    +G++GN LVI  V+ F+ MR   N F+ NLA++D+LV T+  PFTL   +   +K  P  C +    Q   V VS ++L  I+ +R   I++ ++ K+  + S L I L       +A  + +     ++ +        C E W G +  +Y  +Y+  +  ILY       L +     T++W K+   ++    S  Y  RR K++ +L+ + ++F + WLP H 
Sbjct:   47 VEVQVILILAYCSIILLGVVGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSVYGTVYSLSTLLILY----VLPLGIISFSYTRIWSKLRNHVSPGAASDHYHQRRHKMTKMLVCVVVVFAVSWLPLHA 286          
BLAST of GCR328 vs. Ensembl Mouse
Match: Npy2r (neuropeptide Y receptor Y2 [Source:MGI Symbol;Acc:MGI:108418])

HSP 1 Score: 83.9593 bits (206), Expect = 2.745e-17
Identity = 68/244 (27.87%), Postives = 119/244 (48.77%), Query Frame = 2
Query:  245 IVLQTIFSLSIC----VGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIVHVDGSNNTNQCKETWFGNQ--LYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLW-KMPKEITNSIRSVDYSNRRKKXXXXXXXXXXXXXXCWLPHHV 955
            + +Q I  L+ C    +G++GN LVI  V+ F+ MR   N F+ NLA++D+LV T+  PFTL   +   +K  P  C +    Q   V VS ++L  I+ +R   I++ ++ K+  + S L I L       +A  + +     ++ +        C E W G +  +Y  +Y+  +  ILY       L +     T++W K+   ++    S  Y  RR K++ +L+ + ++F + WLP H 
Sbjct:   47 VEVQVILILAYCSIILLGVVGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSVYGTVYSLSTLLILY----VLPLGIISFSYTRIWSKLRNHVSPGAASDHYHQRRHKMTKMLVCVVVVFAVSWLPLHA 286          
BLAST of GCR328 vs. Ensembl Mouse
Match: Npy2r (neuropeptide Y receptor Y2 [Source:MGI Symbol;Acc:MGI:108418])

HSP 1 Score: 83.9593 bits (206), Expect = 2.745e-17
Identity = 68/244 (27.87%), Postives = 119/244 (48.77%), Query Frame = 2
Query:  245 IVLQTIFSLSIC----VGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIVHVDGSNNTNQCKETWFGNQ--LYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLW-KMPKEITNSIRSVDYSNRRKKXXXXXXXXXXXXXXCWLPHHV 955
            + +Q I  L+ C    +G++GN LVI  V+ F+ MR   N F+ NLA++D+LV T+  PFTL   +   +K  P  C +    Q   V VS ++L  I+ +R   I++ ++ K+  + S L I L       +A  + +     ++ +        C E W G +  +Y  +Y+  +  ILY       L +     T++W K+   ++    S  Y  RR K++ +L+ + ++F + WLP H 
Sbjct:   47 VEVQVILILAYCSIILLGVVGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSVYGTVYSLSTLLILY----VLPLGIISFSYTRIWSKLRNHVSPGAASDHYHQRRHKMTKMLVCVVVVFAVSWLPLHA 286          
BLAST of GCR328 vs. Ensembl Mouse
Match: Npffr2 (neuropeptide FF receptor 2 [Source:MGI Symbol;Acc:MGI:1860130])

HSP 1 Score: 77.7962 bits (190), Expect = 4.388e-15
Identity = 78/304 (25.66%), Postives = 145/304 (47.70%), Query Frame = 2
Query:  287 IIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNS--RXXXXXXXXXXXXXXXXMPLGYASEI---VHVDGSNNTNQ---CKETWFGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLWKMPKEITNSIRSVDY--SNRRKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINPFCSLLISTKFRYCVKYIFKYLYSAAK 1168
            ++GN +V   V+  + M    N F+LNLAISD+LV     P TL + +   + F    C++   +Q  +V  SV +L++I+ +RF  +++P + K+  K +   + I       +    ++ L    E    V +   N T+    C+E W  +++ R+IYT   F  +YL PL  ++I++  +   L+K     T   R V +  S +++K+  +L+ + L+F++ WLP     + +D+         +S      I   + P + ++ + NSS+NP      +  FR   +  F+     AK
Sbjct:   60 MVGNTVVCFIVIRNRHMHTVTNFFILNLAISDLLVGIFCMPITLLDNIIAGWPFGSSMCKISGLVQGISVAASVFTLVAIAVDRFRCVVYPFKPKLTVKTAFVTIVIIWGLAIAIMTPSAIMLHVQEEKYYRVRLSSHNKTSTVYWCREDWPRHEM-RRIYTTVLFATIYLAPLSLIVIMYARIGASLFKTAAHCTGKQRPVQWHVSKKKQKVIKMLLTVALLFILSWLPLWTLMMLSDY-------TDLSPNKLRIINIYIYPFAHWLAFCNSSVNPIIYGFFNENFRNGFQDAFQICQKKAK 355          
BLAST of GCR328 vs. Ensembl Mouse
Match: Hcrtr2 (hypocretin (orexin) receptor 2 [Source:MGI Symbol;Acc:MGI:2680765])

HSP 1 Score: 77.7962 bits (190), Expect = 4.595e-15
Identity = 91/361 (25.21%), Postives = 153/361 (42.38%), Query Frame = 2
Query:  239 YSIVLQTIFSLSICVGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIVHVDGSNNT---NQCKETWFGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLWKMPKEITNSIRSVDYSNR-----------------------------RKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINPFCSLLISTKFRYCVKYIFKYLYSAAKHRGFNRSKNKLPVGKASSQ 1225
            Y  VL   + +   V +IGN LV ++V     MR   N F++NL+++D+LV     P TL   +   + F    C+V   LQ+ +V VSVL+L  I+ +R+Y I  P+ +K   K +R  I ++ I    I +   +      +    +N T     C E W G ++Y K+Y    F + Y+ PL  M++ +  +  KLW      T+S+    +  +                             R+K + +L+++ L+F IC+LP  +  +           E     Y  F        S ++ Y NS+ NP     +S KFR   K  F         +G     ++L  G+ S++
Sbjct:   53 YEWVLIAGYIIVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETWFFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVVIWIVSCIIMIPQAIVMECSSMLPGLANKTTLFTVCDEHW-GGEVYPKMYHICFFLVTYMAPLCLMILAYLQIFRKLWCRQIPGTSSVVQRKWKQQQPVSQPRGSGQQSKARISAVAAEIKQIRARRKTARMLMVVLLVFAICYLPISILNVLKRVFGMFTHTEDRETVYAWFTF------SHWLVYANSAANPIIYNFLSGKFREEFKAAFSCCLGVHHRQG-----DRLARGRTSTE 401          
BLAST of GCR328 vs. UniProt/SwissProt
Match: sp|C3ZQF9|QRFPR_BRAFL (QRFP-like peptide receptor OS=Branchiostoma floridae OX=7739 GN=QRFPR PE=3 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.875e-17
Identity = 77/284 (27.11%), Postives = 146/284 (51.41%), Query Frame = 2
Query:  284 GIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGY---ASEIVHVDGSNNTNQCKETWFGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLW-KMPKEITNSIRSVDYSNRRKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINPFCSLLISTKFR 1123
             ++GN LV++ V   + MR   NIF+ +LA SD+L+  +  P TL   +   +    F C++   +Q+  V  S+L+L  I+ ER+Y I+ P++ K +   +R  I L  +W++S+ ++ P+ +   A EI           C+E W+G Q  +  YT F+  +L++IPL  M  L+  +  +LW + P  +T +    +   R+++   +L+++ L+F +CWLP+H   + N+             + ++   + L  I Q + + NS  NP    +++  F+
Sbjct:   61 ALLGNTLVVVVVWKNKVMRTTMNIFICSLAASDLLITIVCIPVTLMQNMLQNWIMGDFMCKLVPFIQTIAVASSILTLTGIAIERYYAIIHPLKVKYLLSKTRAGIILALVWVVSVGVATPMLFVHKAEEIHDFLYEQRFVTCQEKWWG-QTQQTSYTIFNLVVLFIIPLLTMTSLYIRIAHRLWVQQPVGVTGNFAHGNSVRRKRQAVKMLVVVVLLFAVCWLPYHTVTVMNEL---------TGLRLEEKSAKLLIAIVQLIAFSNSFNNPVVYAILNENFK 334          
BLAST of GCR328 vs. UniProt/SwissProt
Match: sp|P79113|NPY2R_BOVIN (Neuropeptide Y receptor type 2 OS=Bos taurus OX=9913 GN=NPY2R PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 3.206e-17
Identity = 76/275 (27.64%), Postives = 131/275 (47.64%), Query Frame = 2
Query:  155 NKFIPG-TELFAKCITEKIISFLENNKNPYSIVLQTIFSLSIC----VGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIVHVDGSNNTNQCKETWFGNQ--LYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLW-KMPKEITNSIRSVDYSNRRKKXXXXXXXXXXXXXXCWLPHHV 955
            ++F PG T L  +   +     +++ K    I +Q +  L+ C    +G+IGN LVI  V+ F+ MR   N F+ NLA++D+LV T+  PFTL   +   +K  P  C +    Q   V VS ++L  I+ +R   I++ ++ K+  + S L I L       +A  + +     ++ +        C E W G +  +Y  IY+  S  ILY       L +     T++W K+   ++       Y  RR+K + +L+ + ++F + WLP H 
Sbjct:   22 DQFGPGHTTLPGELAPDSEPELIDSTK---LIEVQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKQISFLIIGLAWGVSALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKGIYGTIYSLSSLLILY----VLPLGIISFSYTRIWSKLKNHVSPGAAHDHYHQRRQKTTKMLVCVVVVFAVSWLPLHA 289          
BLAST of GCR328 vs. UniProt/SwissProt
Match: sp|Q5IS62|NPY2R_PANTR (Neuropeptide Y receptor type 2 OS=Pan troglodytes OX=9598 GN=NPY2R PE=2 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 5.225e-17
Identity = 69/244 (28.28%), Postives = 119/244 (48.77%), Query Frame = 2
Query:  245 IVLQTIFSLSIC----VGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIVHVDGSNNTNQCKETWFGNQ--LYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLW-KMPKEITNSIRSVDYSNRRKKXXXXXXXXXXXXXXCWLPHHV 955
            I +Q +  L+ C    +G+IGN LVI  V+ F+ MR   N F+ NLA++D+LV T+  PFTL   +   +K  P  C +    Q   V VS ++L  I+ +R   I++ ++ K+  + S L I L       +A  + +     ++ +        C E W G +  +Y  +Y+  S  ILY       L +     T++W K+   ++    +  Y  RR+K + +L+ + ++F + WLP H 
Sbjct:   47 IEVQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILY----VLPLGIISFSYTRIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHA 286          
BLAST of GCR328 vs. UniProt/SwissProt
Match: sp|P49146|NPY2R_HUMAN (Neuropeptide Y receptor type 2 OS=Homo sapiens OX=9606 GN=NPY2R PE=1 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 5.225e-17
Identity = 69/244 (28.28%), Postives = 119/244 (48.77%), Query Frame = 2
Query:  245 IVLQTIFSLSIC----VGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIVHVDGSNNTNQCKETWFGNQ--LYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLW-KMPKEITNSIRSVDYSNRRKKXXXXXXXXXXXXXXCWLPHHV 955
            I +Q +  L+ C    +G+IGN LVI  V+ F+ MR   N F+ NLA++D+LV T+  PFTL   +   +K  P  C +    Q   V VS ++L  I+ +R   I++ ++ K+  + S L I L       +A  + +     ++ +        C E W G +  +Y  +Y+  S  ILY       L +     T++W K+   ++    +  Y  RR+K + +L+ + ++F + WLP H 
Sbjct:   47 IEVQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILY----VLPLGIISFSYTRIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHA 286          
BLAST of GCR328 vs. UniProt/SwissProt
Match: sp|Q9Z2D5|NPY2R_CAVPO (Neuropeptide Y receptor type 2 OS=Cavia porcellus OX=10141 GN=NPY2R PE=3 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 9.390e-17
Identity = 65/230 (28.26%), Postives = 113/230 (49.13%), Query Frame = 2
Query:  275 ICVGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIVHVDGSNNTNQCKETWFGNQ--LYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLW-KMPKEITNSIRSVDYSNRRKKXXXXXXXXXXXXXXCWLPHHV 955
            I +G++GN LVI  V+ F+ MR   N F+ NLA++D+LV T+  PFTL   +   +K  P  C +    Q   V VS ++L  I+ +R   I++ +  K+  +NS L I L       +A  + +     ++ +        C E W G +  +Y  +Y+  S  ILY       L +  +   ++W K+   ++    +  Y  RR+K + +L+ + ++F + WLP H 
Sbjct:   62 ILLGVVGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTVTLTVIALDRHRCIVYHLDSKISKQNSFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILY----VLPLGIISVSYVRIWSKLKNHVSPGAANDHYHQRRQKTTKMLVFVVVVFAVSWLPLHA 287          
BLAST of GCR328 vs. TrEMBL
Match: A0A193KUV8 (GCR328 OS=Schmidtea mediterranea OX=79327 GN=gcr328 PE=2 SV=1)

HSP 1 Score: 707.983 bits (1826), Expect = 0.000e+0
Identity = 398/398 (100.00%), Postives = 398/398 (100.00%), Query Frame = 2
Query:   62 MFEHSTKPNEIYKLDGNTNDVDTLSFDHCLKNKFIPGTELFAKCITEKIISFLENNKNPYSIVLQTIFSLSICVGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIVHVDGSNNTNQCKETWFGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLWKMPKEITNSIRSVDYSNRRKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINPFCSLLISTKFRYCVKYIFKYLYSAAKHRGFNRSKNKLPVGKASSQFIARVRSINS 1255
            MFEHSTKPNEIYKLDGNTNDVDTLSFDHCLKNKFIPGTELFAKCITEKIISFLENNKNPYSIVLQTIFSLSICVGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRLKIWLLSIWLLSIALSMPLGYASEIVHVDGSNNTNQCKETWFGNQLYRKIYTFFSFFILYLIPLFFMLILHFILITKLWKMPKEITNSIRSVDYSNRRKKLSIILIMLCLIFLICWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINPFCSLLISTKFRYCVKYIFKYLYSAAKHRGFNRSKNKLPVGKASSQFIARVRSINS
Sbjct:    1 MFEHSTKPNEIYKLDGNTNDVDTLSFDHCLKNKFIPGTELFAKCITEKIISFLENNKNPYSIVLQTIFSLSICVGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRLKIWLLSIWLLSIALSMPLGYASEIVHVDGSNNTNQCKETWFGNQLYRKIYTFFSFFILYLIPLFFMLILHFILITKLWKMPKEITNSIRSVDYSNRRKKLSIILIMLCLIFLICWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINPFCSLLISTKFRYCVKYIFKYLYSAAKHRGFNRSKNKLPVGKASSQFIARVRSINS 398          
BLAST of GCR328 vs. TrEMBL
Match: V4AXU1 (G_PROTEIN_RECEP_F1_2 domain-containing protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_65549 PE=3 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 1.857e-29
Identity = 93/310 (30.00%), Postives = 163/310 (52.58%), Query Frame = 2
Query:  218 LENNKNPYSIVLQTIFSLSICVGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIV--HVDGSNNTNQCKETWFGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLWKMPKEI------TNSIRSVDYSNRRKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINPFCSLLISTKFR 1123
            L  +K P++IVL  I+++ +  G++GN  VI+ V+  Q MR   N+F LNL I D+LV+ I  P TL N +   + +    C+V   LQ T V VS+ S++ IS  R++ I  P++ K++F   ++ I +  IW++S +   PL + + +      G      C+E W   +  ++IY+     +L+++PL  M  ++ ++ T LW   K +      T  +++     +R+K    LI L +IF +CWLP++V  I+ DF        + S  + + ++  + P+ Q +   NS+INP C    +  FR
Sbjct:    2 LYRHKEPFNIVLLVIYAIVMIAGLLGNIFVIVVVVRQQHMRTLTNVFFLNLTIGDLLVVCICIPITLGNYLYRDWIYGLVLCKVTPFLQGTAVSVSIFSMLVISINRYFAIHVPLKAKLVFSRQKVAILITLIWIISFSAICPLLFVNNVTTYGAPGIFEARACEEHWQTPE-SKQIYSLVMLVVLFVMPLSVMGAMYAMVSTVLWNADKRLFPNGTKTGKMQADRLVRQRRKTVRTLICLVIIFGVCWLPYYVVNIWLDF--------NTSSPWANTVINYVYPLVQLLALSNSTINPMCYCFFTNGFR 302          
BLAST of GCR328 vs. TrEMBL
Match: A0A193KUH9 (GCR448 OS=Schmidtea mediterranea OX=79327 GN=gcr448 PE=2 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 6.983e-29
Identity = 104/319 (32.60%), Postives = 182/319 (57.05%), Query Frame = 2
Query:  224 NNKNPYSIVLQ-TIFSL--------SICVGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQY-KMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIVHVDGSNNTNQCKETWFGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLWKMPKE--ITNSIRSVDYSNR----RKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINPFCSLLISTKFRYCV 1132
            N+K+ Y+I  + +IF L           VGI GN L+++ +   + MR  +N+FL NLAISD+ +  I  P +L   +   + F   FC++Q  LQ T + VS+LSL+ ++ ER YV +  M++   +++     ++++ IW ++ ++S+PL +++E+    G +    C ETW+G   +++ YT   F +LY  PL  M+IL+++++TK+    K+   T +  + +Y  R    R ++S +   L  +F ICWLP+H+  IY DF I     E+ ++ Y  +++    PI Q++ Y NS+INP  ++ IS KFR+ V
Sbjct:   33 NSKDSYAITFEISIFKLINLLFYIILFTVGIFGNLLILVCIFSLKHMRTISNMFLANLAISDLFIFLICQPLSLTTIIYSSWVFGEKFCKLQGLLQGTNLGVSILSLLGLNIER-YVAVRKMRFGNQLYRRKLCIMYIIGIWCIAGSISLPLAFSTEL--KKGIDKKQYCLETWWGTIFWKQFYTIMLFLVLYAFPLLSMIILYYLILTKVKNSMKQQTFTTNHSTRNYVTRLRTQRTRISKVSTALVCLFTICWLPYHIVNIYADFQIL---NENQTKVY--YLINYGYPIVQWLVYSNSAINPLSTIFISQKFRFAV 343          
BLAST of GCR328 vs. TrEMBL
Match: K1QZG6 (Orexin receptor type 2 OS=Crassostrea gigas OX=29159 GN=CGI_10014191 PE=3 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 2.596e-24
Identity = 104/322 (32.30%), Postives = 172/322 (53.42%), Query Frame = 2
Query:  176 ELFAKCITEKIISFLENNKNPYSIVLQTIFSLSICVGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEI--VHVDGSNNTNQCKETWF---GNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLWK-MPKEITNSIRSVDYSNRRKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINPFCSLLISTKFR 1123
            E FA+ + E+    L+  K P +I L  ++S+   VG+ GN  VI++V  ++ MR   N+FL+NLAISD+LV+    P TL   V   Y +    C++ S LQ + + VS LSL++IS  RF  I  P++ K+IF   R+   +++IW +S A+ +PL   + I  + +    +   C E W    G +LY  I  F S F++ LI + F      ++   LW+   K IT + R +    +R++   +LI + +IF +CWLP++   I+ +F I   S           + E++ P+ Q +   NS+INP C  ++S+ F+
Sbjct:   44 EKFAETMREE----LKGYKEPRTIALMFLYSIVFIVGLFGNIFVIVTVFHYKHMRTLTNVFLVNLAISDLLVVLFCIPITLGTYVYKDYVYGIGMCKLTSFLQGSAISVSSLSLLTISINRFIAIHRPLRAKIIFSKRRVYFVIVAIWCISFAVFVPLLVVNNIKNIGIPPFFSKRICNEHWDIPNGKELY-NILVFISIFLIPLIAMVFAYTKISLV---LWRNNDKPITQTRRVIL---QRRRTVKLLICVVVIFSVCWLPYNFTNIWLEFNITTASV---------VVSEQIYPLFQLLGISNSAINPICYCMMSSGFQ 345          
BLAST of GCR328 vs. TrEMBL
Match: A0A210QVM6 (Pyroglutamylated RFamide peptide receptor OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT00575 PE=3 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 3.804e-24
Identity = 94/308 (30.52%), Postives = 165/308 (53.57%), Query Frame = 2
Query:  224 NNKNPYSIVLQTIFSLSICVGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIV--HVDGSNNTNQCKETWFGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLWK------MPKEITNSIRSVDYSNRRKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINPFCSLLISTKFR 1123
              + P +I+L  ++S +   G++GN  VI  V+ +Q MR   N+FL++L + D+LV+ I  P TL + V   Y F  F C++   LQ T V VS LSL+SIS  R++ I  P++ K++F  +++ + L  +WL+S+   +P      +V   + G    + C E W+ + + ++IY+ F FF+L+ IPL  ML+ +  +   LW+      M   ITN  ++     +R++   +L+ + +IF+ CW P++   I+ DF         +  +   F+ + + PI   +   NS++NP C   +S  FR
Sbjct:   74 GRREPMTIILMVLYSAAFISGLLGNIFVIAVVIQYQHMRTLTNVFLVSLTVGDLLVVLICIPMTLGSYVYSDYIFGTFMCKLTPFLQGTAVAVSSLSLLSISINRYFAIHSPLKAKVLFSKNKIYLLLFLVWLVSLCSFIPQLVVCTVVTSGLQGVYEMHVCLELWY-SPVTKQIYSMFIFFVLFFIPLVAMLVTYTRIGYTLWRTEARRFMENSITNKSQAERILRQRRRTVKMLVAVVMIFVFCWFPYYAVMIWLDF-------NMVLSERTQFVNDYIYPIVLLLGLSNSTVNPVCYCFMSNGFR 373          
BLAST of GCR328 vs. Ensembl Cavefish
Match: npffr1 (neuropeptide FF receptor 1 [Source:ZFIN;Acc:ZDB-GENE-030131-8106])

HSP 1 Score: 93.9745 bits (232), Expect = 1.234e-20
Identity = 95/345 (27.54%), Postives = 165/345 (47.83%), Query Frame = 2
Query:  173 TELFAKCITEKIISFLEN--------NKNPYSIVLQTIFSLSICVGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNS--RXXXXXXXXXXXXXXXXMPLGYASEIVH--VDGSNNT---NQCKETWFGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLWKMPKEITNSIRSVDYSNR--RKKXXXXXXXXXXXX--XXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINPFCSLLISTKFRYCVKYIFKY 1150
            T L+ +CIT      L N        +  P + V    + L   + ++GN LV + VL  + MR   NIF+LNLAISD+LV     P TL + +   + F    C++   +Q  +V  SV +L++I+ ERF  I++P Q K+  + +   +        ++    ++ L  + +  H  VD  N T     C E W  +Q  RKIYT   F  +YL P+  ++I++  +  KL+K P  I ++ ++ D   R  R+K+ ++ ++L +     + WLP  +  +  D+        ++S    + I   + P + ++ + NSSINP      +  FR   +  FK+
Sbjct:   14 TILYTECITINDTDILLNYTFSSYYQHSPPVATVFILAYILIFFLCMVGNLLVCLIVLKNKQMRTVTNIFILNLAISDLLVGIFCLPITLADNLVTGWPFDEVTCKMSGLIQGASVSASVFTLVAIAVERFRCIVYPFQQKLTLRQAIITIAFIWALAIIIMCPSAVTLTVSHDAFHFMVDRDNATYPLYTCWEAW-PDQSMRKIYTMVLFSHIYLAPVTLIVIMYTRIALKLFKSPASIRDA-QAEDEGRRVYRRKIRVVNMLLIVALLFTVSWLPLWIIILLTDY-------GNMSSSQLNVIAVYIFPFAHWLAFFNSSINPIVYGYFNENFRRGFQAAFKF 349          
BLAST of GCR328 vs. Ensembl Cavefish
Match: npffr1 (neuropeptide FF receptor 1 [Source:ZFIN;Acc:ZDB-GENE-030131-8106])

HSP 1 Score: 90.5077 bits (223), Expect = 1.598e-19
Identity = 97/341 (28.45%), Postives = 164/341 (48.09%), Query Frame = 2
Query:  173 TELFAKCITEKIISFLEN--------NKNPYSIVLQTIFSLSICVGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXX--XXMPLGYASEIVH--VDGSNNT---NQCKETWFGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLWKMPKEITNSIRSVDYSNRRKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINPFCSLLISTKFRYCVKYIFKY 1150
            T L+ +CIT      L N        +  P + V    + L   + ++GN LV + VL  + MR   NIF+LNLAISD+LV     P TL + +   + F    C++   +Q  +V  SV +L++I+ ERF  I++P Q K+  + + + I  +    + I    ++ L  + +  H  VD  N T     C E W  +Q  RKIYT   F  +YL P+  ++I++  +  KL+K P       R V    R+ ++  +L+++ L+F + WLP  +  +  D+        ++S    + I   + P + ++ + NSSINP      +  FR   +  FK+
Sbjct:    4 TILYTECITINDTDILLNYTFSSYYQHSPPVATVFILAYILIFFLCMVGNLLVCLIVLKNKQMRTVTNIFILNLAISDLLVGIFCLPITLADNLVTGWPFDEVTCKMSGLIQGASVSASVFTLVAIAVERFRCIVYPFQQKLTLRQAIITIAFIWALAIIIMCPSAVTLTVSHDAFHFMVDRDNATYPLYTCWEAW-PDQSMRKIYTMVLFSHIYLAPVTLIVIMYTRIALKLFKSPG------RRV--YRRKIRVVNMLLIVALLFTVSWLPLWIIILLTDY-------GNMSSSQLNVIAVYIFPFAHWLAFFNSSINPIVYGYFNENFRRGFQAAFKF 328          
BLAST of GCR328 vs. Ensembl Cavefish
Match: npffr2b (neuropeptide FF receptor 2-like [Source:NCBI gene;Acc:103031865])

HSP 1 Score: 90.5077 bits (223), Expect = 2.665e-19
Identity = 90/324 (27.78%), Postives = 163/324 (50.31%), Query Frame = 2
Query:  281 VGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXX----XXMPLGYASEIVHVDGSNNTNQ----CKETWFGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLWK----MPKEITNSIRSVDYSNRRKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINPFCSLLISTKFRYCVKYIFKYLYSAAKHRGFNRSKNKLPVGKA 1216
            V ++GN LV   VL  + MR   N+F+LNLAISD+LV     P TL + +   + F    C++   +Q  +V  SV +L+ I+ +RF  I++P + K+    S + I ++ +  +SI     + + +   S +  + G +N  +    C+E W   ++ RKIYT   F  +YL PL  ++I++  +   L+K    +P       R    S ++K++  +L+++ L+F++ WLP     + +D+        S+S      I   + P++ ++ + NSS+NP      +  FR   + +FK  + +A+ RG  RS +    G A
Sbjct:   61 VCMVGNGLVCFIVLRSKSMRTVTNLFILNLAISDLLVGIFCMPTTLVDNIITGWPFGSLVCKLSGMVQGISVSASVFTLVVIAVDRFRCIVYPFKQKLTISTSTVIIVIIWVLAISIMCPSGVMLQVTKESRVSILLGESNATRPFYWCRENWPSQEM-RKIYTTVLFANIYLAPLTLIVIMYARIGITLFKTAVPVPTRGGYEGRGHTVSRKKKRVIKMLLVVALLFILSWLPLWTLMMLSDY-------ASLSEYQHRVINIYVYPLAHWLAFCNSSVNPIIYGFFNENFRRGFQIVFKLQFCSAQ-RGKRRSYSHRVQGNA 375          
BLAST of GCR328 vs. Ensembl Cavefish
Match: nmbr (neuromedin B receptor [Source:NCBI gene;Acc:103031806])

HSP 1 Score: 85.1149 bits (209), Expect = 9.313e-18
Identity = 92/335 (27.46%), Postives = 168/335 (50.15%), Query Frame = 2
Query:  140 DHCLKNKFIPGTELFAKCITEKIISFLENNKNPYSIVLQTIFSLSICVGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIVHVDGSNNT-NQCKETWFGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLWK----MPKEIT-NSIRSVDYSNRRKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILER-LTPISQFMCYLNSSINPFCSLLISTKFR 1123
            D  L   F  GT  ++    E +    E        V+ +++ L I VG++GN  ++   +    MR+  NIF+ +LA+ D+L+L    P   F      + F    C++   +Q T+V VSV +L ++S +R   I+ PM  +         +  +SIW++S+ L++P    S++VH+   N T   C    F N+++ KI++   F + +LIPL  + + ++ +   L K    MP E++ +S R ++    RK+L+ I+++   +F +CW P+HV  +Y  F           R+ D  +L   +T +++ + + +S +NPF   L+S  FR
Sbjct:    2 DDTLNASFSNGTPDYSNFTDEGVSDGRETIHFIIRYVIPSVYILIITVGLLGNITLVKIFITTSAMRSVPNIFISSLAVGDLLLLVTCVPVDAFRYFFEEWIFGTVACKLIPVIQLTSVGVSVFTLTALSADRHKAIVNPMDIQTSSAVFWTCLKAISIWVISVLLAVPEAIFSQVVHITDRNVTFPACMPYPFSNEMHPKIHSIMIFLVYFLIPLGIISVYYYHIARTLIKSAHDMPGEVSEHSKRQME---TRKRLAKIVLVFVGLFALCWFPNHVLYMYRSFHY---------RQIDTSLLHLIITLLARVLSFSSSCVNPFALYLLSESFR 324          
BLAST of GCR328 vs. Ensembl Cavefish
Match: npffr2b (neuropeptide FF receptor 2-like [Source:NCBI gene;Acc:103031865])

HSP 1 Score: 83.9593 bits (206), Expect = 3.986e-17
Identity = 89/339 (26.25%), Postives = 162/339 (47.79%), Query Frame = 2
Query:  281 VGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXX----XXMPLGYASEIVHVDGSNNTNQ----CKETWFGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLWKMPKEITNSI-------------------RSVDYSNRRKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINPFCSLLISTKFRYCVKYIFKYLYSAAKHRGFNRSKNKLPVGKA 1216
            V ++GN LV   VL  + MR   N+F+LNLAISD+LV     P TL + +   + F    C++   +Q  +V  SV +L+ I+ +RF  I++P + K+    S + I ++ +  +SI     + + +   S +  + G +N  +    C+E W   ++ RKIYT   F  +YL PL  ++I++  +   L+K    +                       R    S ++K++  +L+++ L+F++ WLP     + +D+        S+S      I   + P++ ++ + NSS+NP      +  FR   + +FK  + +A+ RG  RS +    G A
Sbjct:   67 VCMVGNGLVCFIVLRSKSMRTVTNLFILNLAISDLLVGIFCMPTTLVDNIITGWPFGSLVCKLSGMVQGISVSASVFTLVVIAVDRFRCIVYPFKQKLTISTSTVIIVIIWVLAISIMCPSGVMLQVTKESRVSILLGESNATRPFYWCRENWPSQEM-RKIYTTVLFANIYLAPLTLIVIMYARIGITLFKTAVPVPTRAGGSDSGTGSGSGKEGGYEGRGHTVSRKKKRVIKMLLVVALLFILSWLPLWTLMMLSDY-------ASLSEYQHRVINIYVYPLAHWLAFCNSSVNPIIYGFFNENFRRGFQIVFKLQFCSAQ-RGKRRSYSHRVQGNA 396          
BLAST of GCR328 vs. Ensembl Sea Lamprey
Match: npffr1l3 (neuropeptide FF receptor 1 like 3 [Source:ZFIN;Acc:ZDB-GENE-070424-44])

HSP 1 Score: 80.1073 bits (196), Expect = 8.254e-17
Identity = 86/308 (27.92%), Postives = 151/308 (49.03%), Query Frame = 2
Query:  287 IIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEI------VHVDGSNNT---NQCKETWFGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLWKM------------PKEITNSIRSVDYSNRRKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINPFCSLLISTKFRYCVKYIFK 1147
            +IGN LV   VL  + MR   N+F+LNLA+SD+LV     P TL + +   + F    C++   +Q T+V  SV +L++I+ +RF  I++P + K+   ++   I ++    LSI     L   +E+      V+ DGSN+T   +QC E W   ++ RK YT   F  +YL PL  +L+++  +  +L  +            P        +   + RR K+  +LI++ ++F++ WLP     +  D+        ++S     F+   + P++ ++ + NSS+NP      +  FR   +  FK
Sbjct:   64 MIGNGLVCYVVLQSRRMRTVTNLFILNLAVSDLLVGIFCMPITLVDNLITGWPFGVVVCKMSGLVQGTSVSASVFTLVAIAVDRFRCIVYPFKRKLRISHALFTILVIWALALSIMCPSALMLTAEVSRGHYMVYSDGSNDTHPLHQCWEAWPDPRM-RKAYTTVLFANVYLAPLALILLMYARIGFRLCSLSASAAAAASAAAPSRGGGGG-ATGVTRRRVKVIKMLIIVAMLFMLSWLPLWTVMMLVDY-------ANLSPWDLAFLNMYVYPVAHWLAFFNSSVNPIVYGYFNENFRRGFQAAFK 362          
BLAST of GCR328 vs. Ensembl Sea Lamprey
Match: prlh2r (prolactin releasing hormone 2 receptor [Source:ZFIN;Acc:ZDB-GENE-120411-41])

HSP 1 Score: 71.2478 bits (173), Expect = 5.132e-14
Identity = 74/304 (24.34%), Postives = 142/304 (46.71%), Query Frame = 2
Query:  263 FSLSICVGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTL---FNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPL-GYASEIVHVDGSNNTNQCKETWFGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLWK--MPKEITNSIRSVDYSNRRKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYL----NSSINPFCSLLISTKFRYCVKYIF 1144
            ++  + VG++GNFL++  +   + M N  N+ + NLA SD+L+  +  P TL   F+    V  F  F C     +Q  +V+VSV +L  I+ +R+ V ++P++ ++        +  + +   ++A       Y  E            C+E W G +  R  Y + +  + Y +PL  + + +F +  KL    +P  +T +   +D + RR+K   +L+++   F +CWLP H+     D  I++     I + Y + +        Q +C+     ++  NPF    +  +FR  +K +F
Sbjct:   28 YTAVVVVGVLGNFLLVYVICRVKKMHNVTNLLIGNLAFSDLLMCAMCVPLTLAYVFDARGWV--FGSFMCYFVFLMQPVSVYVSVFTLTVIAVDRYIVTVYPLRRRITIPTCGYLLAAIWVTACALAAPALAHTYYCEF----PEQRMTICEEFWIGTERERLAYAYSTLVLTYGLPLLVISLSYFKISVKLKNRVVPGTVTQNQAEMDRA-RRRKTFRLLVLVVTAFSVCWLPLHIFNFLRDVDIRL-----IDKYYFNLV--------QLLCHWFAMSSACYNPFIYAWLHDRFRSELKKMF 311          
BLAST of GCR328 vs. Ensembl Sea Lamprey
Match: kiss1rb (KISS1 receptor b [Source:ZFIN;Acc:ZDB-GENE-060526-54])

HSP 1 Score: 68.9366 bits (167), Expect = 3.862e-13
Identity = 79/306 (25.82%), Postives = 150/306 (49.02%), Query Frame = 2
Query:  260 IFSLSICVGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIVHVDGSNNTNQCKETWFGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLWK---MPKEITNSIRSVDYSNR--RKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINPFCSLLISTKFRYCVKYIFKYLYSA 1162
            +F+L + VG++GN LVI  +   + MR   N F++NLA +DI+ L    PFT        + F  F C+  + LQ  TV  + ++L ++S +R YV ++P++              + IW+ S+ +S+P+    +    +       C +  F +  +   +  +SF ++Y++PL  + + + I+I K+ +    P++    ++ +   N   R K++ +++++ L+F++CW P  +  ++  F    Y   +IS     +   +L   +  M Y NSSINPF    +   FR   K  F  L+ A
Sbjct:   42 LFALIMLVGLVGNSLVIFVITKNRQMRTVTNFFIVNLAGTDIIFLVCCVPFTATLYPLPSWVFGDFMCKFVNYLQQVTVQATCMTLTAMSVDRCYVTVYPIRSLQHRTPCLAACISIGIWIGSLVMSLPMALYHKTDTKEWYGPKTYCFDA-FPSVPHEHAFVLYSFVLVYMLPLVTISVCYSIMIKKIGRPAVEPQDDNVQLQMLTERNEATRAKVTRMVVVVVLVFMLCWGPIQLFILFQSF----YPHFAIS-----YTTYKLKTWANCMSYANSSINPFVYCFMGDSFRKTFKKAFPCLFKA 337          
BLAST of GCR328 vs. Ensembl Sea Lamprey
Match: si:dkey-202l22.3 (prolactin releasing hormone receptor [Source:HGNC Symbol;Acc:HGNC:4464])

HSP 1 Score: 67.781 bits (164), Expect = 9.122e-13
Identity = 67/238 (28.15%), Postives = 116/238 (48.74%), Query Frame = 2
Query:  260 IFSLSICVGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTL---FNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIVHVDGSNNTNQ-CKETWFGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKL-WKMPKE----ITNSIRSVDYSNRRKKXXXXXXXXXXXXXXCWLP 946
            +++L   VG+ GN L+I+ +   + + N  N  L NLA+SD+LV     P +    F     VY      C + + LQ  TVHVSVLSL +I+ +R+ V+ +P++ ++  ++  L    + I   ++A    L      V++D      Q C+E W G +  R  Y+     + YL+PL  +   +  +   L  ++P        N+ R+  +  +R+K   +L+M    F +CWLP
Sbjct:   73 LYALLTLVGVSGNLLLILVIARTKRLHNATNFLLGNLALSDLLVCLTCVPISAAFAFEPRGWVY--GALLCYLVALLQPATVHVSVLSLTAIALDRYVVVAYPIRRRVAVRSCALTAGFIWIASAALACPAAL----NTVYIDFRTEEPQVCEELWTGLEDQRLAYSCAMMIVSYLLPLLAVSASYCAISLTLRGRVPPGGAHCTVNARRT--WHQKRRKTFRLLVMSVGTFALCWLP 302          
BLAST of GCR328 vs. Ensembl Sea Lamprey
Match: galr2a (galanin receptor 2a [Source:ZFIN;Acc:ZDB-GENE-130603-37])

HSP 1 Score: 63.929 bits (154), Expect = 1.407e-11
Identity = 78/320 (24.38%), Postives = 140/320 (43.75%), Query Frame = 2
Query:  221 ENNKNPYSIVLQTIFSLSICVGIIGNFLVIMSVLLFQFMRNFAN----IFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMP-LGYASEIVHVDGSNNTNQCKETWFGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLWKMPKEITNSIRSVDYSNR-RKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLT----PISQFMCYLNSSINPFCSLLISTKFRYCVKYIFKY 1150
                +P S+ +  +F L   +G  GN LVI+ VLL    R  +N    IF+LNL+++D+  +    PF         + F  F C+    +   T+  S  +L ++S +R+  I +P++ + +    +    + +IW L++  + P L Y   +       N + C   W      RK+    +F   YL+P+  + + +   +  LW       + +  +  S R ++K++ +++++  +F  CWLPHHV  +Y  F                F L   T     +S  M Y NS +NP    L+S  FR   +  F +
Sbjct:   18 PQGLSPESVTVPVVFLLIFLLGAFGNSLVII-VLLCSGQRGSSNTTTNIFILNLSVADLCFILFCVPFQATIYTLDGWIFGSFLCKAVHFIIFLTMFASSFTLAAVSVDRYLAIRYPLRSRELRTPRKAAAVIAAIWGLALVFAGPYLSYYQAVTF----QNMSMCMPVWAKEP--RKLMDMVTFVCGYLVPVSVLGLAYAFTLKYLWTA----VDPLEEMSESKRAKRKVTTMILIVAGLFCACWLPHHVLILYFWF--------------GHFPLTHATYAFRLLSHCMSYANSCLNPLVYALVSKHFRKGFRKAFAF 312          
BLAST of GCR328 vs. Ensembl Nematostella
Match: EDO44418 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVN5])

HSP 1 Score: 88.9669 bits (219), Expect = 5.716e-20
Identity = 72/232 (31.03%), Postives = 125/232 (53.88%), Query Frame = 2
Query:  275 ICVGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIVHVDGSNNTNQCKETW---FGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLWKMPKEITNSIRSVDYSNR--RKKXXXXXXXXXXXXXXCWLPHHV 955
            I + ++GN +VI +V   + M++  N+F+ NLA SD+L+  +  P  +       + F    C++   LQS +V  SVL+L++I+ +RF  I+FP + +M FK ++         ++ +  S+ LG  + +++    +N NQC E W   F  +   + YT   F +LY +P+  M +L+ I++ KLW+  + I   I S    N   RKK+  +LI + ++F   WLP HV
Sbjct:    7 IALSLVGNTVVIFTVCRNRHMKSVTNLFIANLAASDLLITFLGMPHQITELYTTEWMFGTVLCKLVVYLQSVSVGSSVLTLLAITKDRFVAIIFPFRPRMSFKTAK--------TIIMLIWSLSLGIMAPLIYATKVHN-NQCTEDWTPAFDAKTAPRDYTVVLFVMLYAVPMLTMAVLYAIIVRKLWRR-RRIGEVIPSASSKNEVSRKKVIKMLITVIMLFTFSWLPLHV 228          
BLAST of GCR328 vs. Ensembl Nematostella
Match: EDO50021 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF31])

HSP 1 Score: 83.1889 bits (204), Expect = 5.239e-18
Identity = 91/288 (31.60%), Postives = 150/288 (52.08%), Query Frame = 2
Query:  275 ICV-GIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIVHVDGSN-NTNQCKETWFGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLWKMPKEITNSIRSVDYSNRRKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPI---SQFMCYLNSSINPFCSLLISTKFR 1123
            IC+ G +GN LV+++    + MRN  N F+ NLA++D  V  I  P +L       + F  + C+    LQ  TV  SV +L++I+ +RF VI+FP + K  F+ SR  I +++IWLLS A++ P+   SE+    G   N   C E W  +Q  RK Y    F +L+L+P+  + +++  +I KL  +      ++R+       KKL  +L+++ + F +CW+P+HV  +Y D             K D    E +  +   SQ++ Y NS +NP   +L +  +R
Sbjct:    6 ICIIGALGNLLVMLATRKRR-MRNVTNQFIANLALADFTVCVITIPISLVYTNLGHWPFRSWLCKTMPYLQGITVSASVGTLVAIASDRFIVIVFPTKRK--FRISRTWITVVAIWLLSAAVAFPVHLYSEVTREMGDGLNVTSCIEVW-PSQDGRKTYALLLFLVLFLLPMTAISLMYAAIIYKLRTLHPTQEVTMRT------HKKLVRMLVVVIVTFAVCWIPYHVTFLYLD-------------KSDYITTEAMNAMVLFSQWLMYTNSCLNPIIYILYNANYR 270          
BLAST of GCR328 vs. Ensembl Nematostella
Match: EDO40944 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5Q4])

HSP 1 Score: 82.4185 bits (202), Expect = 8.146e-18
Identity = 72/284 (25.35%), Postives = 146/284 (51.41%), Query Frame = 2
Query:  281 VGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTL-FNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLG-YASEIVHVDGSNNTNQCKETWFGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLWK-MPKEITNSIRSVDYSNRRKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINPFCSLLISTKFR 1123
            +  +GN LV + +L  + M+   N F+LNLAI+D+ +  I  PF +   ++N V+ +  F C++   LQ+ ++  SV +L ++S  R++ I+ P++ ++   NS+       I  + +   +P+  Y+  + H DGS +   C+E W G+   RK+YT   F   Y++PL  +   +  +  +L K   ++ +  +R V ++   +K+  +L ++ ++F +  LP ++  ++ DF           ++YD F    L      + + NS+ NP C  +++  +R
Sbjct:    6 ISAVGNSLVCIVILRRRRMKTVTNYFVLNLAIADLALTCICIPFDIPVQEMNYVWPYGGFMCKILYPLQTLSLFASVFTLTAVSLTRYWAIVHPLRQQLSVSNSK-----RIIVAIWVISIIPVSPYSYVLSHEDGSLS---CEENW-GDTSMRKVYTAVLFMFQYVLPLTVIAGAYIGIGIELRKRQTRDRSGGLRDV-HAEETRKVLRMLKVVTVVFAVFVLPTNIMWLWLDF-------GHAEQEYDRF--WDLVAFCNIVTFANSAANPICYTVLNETYR 270          
BLAST of GCR328 vs. Ensembl Nematostella
Match: EDO46903 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNS8])

HSP 1 Score: 78.9518 bits (193), Expect = 1.637e-16
Identity = 83/281 (29.54%), Postives = 134/281 (47.69%), Query Frame = 2
Query:  275 ICVGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIVHVDGSNNTNQCKETWFGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLW-KMPKEITNSIRSVDYS-------NRRKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINPF 1093
            + +G +GN L+ +++L  +  R  +  F+LNLA +D+ V  I+ P  +   ++  + F  F C+V   LQ+T + VSV +L+S+S ER   IM+P++ +  F  +R    +  IWL SI L  P  Y   +           C E+W G + Y K YT   F +LYL+PL  +   +  +  KL+  + K  T  I +V+          R   +  I     + F +C LP HV  +++DF        S S  +   ++      +  M Y NS INPF
Sbjct:   18 MTIGAVGNTLIFVAILARK-KRKISEYFILNLATTDLAVSLISIPLDIVESLSGHWPFGEFLCKVVYPLQTTLMSVSVFTLLSMSLERHRAIMYPLKPR--FHRTRALSVIAFIWLGSIGLVAPYSYVLSL-------KETFCTESWPGLK-YVKAYTMTVFLVLYLVPLMVISAAYIHVGQKLYNDIEKLKTVLISAVNGKQILRTRLQRNVHIVKIFTAAVVAFAVCLLPTHVVWLWHDF-----GQGSRSNAFSTILV-----FANIMNYTNSCINPF 277          
BLAST of GCR328 vs. Ensembl Nematostella
Match: EDO39719 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9A0])

HSP 1 Score: 78.9518 bits (193), Expect = 1.693e-16
Identity = 89/294 (30.27%), Postives = 148/294 (50.34%), Query Frame = 2
Query:  281 VGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFT---LFNQVNLVYKFSP---FFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIVHVDGSNNTNQCKETW---FGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLW--KMPKE--ITNSIRSVDYSNRRKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINPFCSLLISTKFR 1123
            V I+GNFLV+ +V   Q M+   N  ++N+AI+D+L + +  P T   ++      +++S    +FCQV    Q   V VSVL+L +I+ +RF+ I  PM  K +F     +  ++ IWL++  L+ P+ YA  I    G      C E W   F      ++YT F F + Y +P   M +++ ++  +LW  K+P E  I  S ++++    RKK+  +LI + + F++CWLP  V     D     YS   IS    +FIL        F+   +S+++P    + S  +R
Sbjct:    5 VAIVGNFLVVHTVWTNQRMQTATNYLIVNMAIADLLYMVLVIPPTFIVIYGSYEWPFRYSGRAIYFCQVVHFGQYLLVPVSVLTLATIATDRFFAITMPM--KRLFTKKVYRSLMVVIWLVAAGLAAPILYAYRIKEFSG---MLYCDEDWSPAFDTTRASRVYTIFLFAVAYCVPFVVMSVMYSVICRQLWMRKIPGEQDIEKSKKALE---SRKKVVKMLITVVVCFVLCWLPVQVATFLWD-----YSGVEISVDL-NFIL-------MFLMRSHSAVSPCIYAIFSQNYR 277          
BLAST of GCR328 vs. Ensembl Medaka
Match: npffr2b (neuropeptide FF receptor 2-like [Source:NCBI gene;Acc:101174760])

HSP 1 Score: 80.8777 bits (198), Expect = 3.204e-16
Identity = 94/347 (27.09%), Postives = 169/347 (48.70%), Query Frame = 2
Query:  227 NKNPYSIVLQTIFSLSICVGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIVH-------VDGSNNTNQ---CKETWFGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLWKMPKEITNSIRSVDYSNRRKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINPFCSLLISTKFRYCVKYIFKYLYSA---AKHRGFN---RSKNKLPVGKAS 1219
            +K   + V    + L   V ++GN +V   VL  + MR   N+F+LNLAISD+LV     P TL + +   + F    C++   +Q  +V  SV +L++I+ +RF  I++P + K+    S+  + ++ IW+L++ +  P G   ++         VD  + T     C+E W  +Q  RKIYT   F  +YL PL  ++I++  +   L+K       +I     S  +K++ ++L+++ L+F++ WLP     + +D+      A     +Y   I   + P + ++ + NSS+NP      +  FR   +  FK+   +    + + F+   R    LPV  AS
Sbjct:   39 HKPSVAAVFTVSYLLIFVVCMVGNGVVCFIVLRSKNMRTVTNLFILNLAISDLLVGIFCMPTTLLDNIITGWPFGSIVCKLSGMVQGISVSASVFTLVAIAVDRFRCIVYPFRQKLTIGTSK--MIIVIIWVLALFIMCPSGVMLQVTEEPTVRIVVDHRSKTRPFYWCRENW-PSQEMRKIYTTVLFANIYLAPLNLIVIMYARIGFTLFK------TTIPPTRGSGSKKRVIMMLVIVALLFVLSWLPLWTLMMLSDY------ARLTEHQY-RVINIYVYPFAHWLAFFNSSVNPIIYGFFNENFRRGFQAAFKFQLCSIDIVRQKTFSHRIRGNAVLPVQPAS 369          
BLAST of GCR328 vs. Ensembl Medaka
Match: npffr1l2 (neuropeptide FF receptor 1 like 2 [Source:ZFIN;Acc:ZDB-GENE-060526-110])

HSP 1 Score: 78.9518 bits (193), Expect = 1.210e-15
Identity = 80/284 (28.17%), Postives = 142/284 (50.00%), Query Frame = 2
Query:  287 IIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIV---HVDGSNNTNQ------CKETWFGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKL-----WKMPKEITNSIRSVD--YSNRRKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINP 1090
            ++GN LV + VL  + MR   N+F+LNLAISD+LV     P TL + +   + FS   C++   +Q  +V  SV +L++I+ ERF  I++P+Q K+    +++ I  + +  + I     +    E V   ++  +N+ NQ      C E  F N   RKIYT   F  +YL+PL  + +++  +  KL          ++ N  R      S ++ K+  +L+++ L+F++ WLP     +  D+         + R   D +   + P + ++ + NSS+NP
Sbjct:   47 MVGNILVCLIVLENRCMRTVTNLFILNLAISDLLVGIFCIPTTLVDNLITGWPFSNTVCKMSGFVQGVSVSASVFTLVAIAVERFRCIVYPLQPKLTLLVAKVAIVSIWVLAVVILCPAAVALTVEKVPFHYMVHNNDFNQTLPLYTCYEN-FANPQMRKIYTAVLFAHIYLLPLAVITLMYISIGVKLCSSVVANREPQLANIRRHGQQMVSQKKIKVVKMLVVVTLLFMVSWLPLWTLMMMTDY-------GGLDRDQLDLLTSYIFPFAHWLAFSNSSVNP 322          
BLAST of GCR328 vs. Ensembl Medaka
Match: npffr1l2 (neuropeptide FF receptor 1 like 2 [Source:ZFIN;Acc:ZDB-GENE-060526-110])

HSP 1 Score: 79.337 bits (194), Expect = 1.292e-15
Identity = 80/284 (28.17%), Postives = 142/284 (50.00%), Query Frame = 2
Query:  287 IIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIV---HVDGSNNTNQ------CKETWFGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKL-----WKMPKEITNSIRSVD--YSNRRKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINP 1090
            ++GN LV + VL  + MR   N+F+LNLAISD+LV     P TL + +   + FS   C++   +Q  +V  SV +L++I+ ERF  I++P+Q K+    +++ I  + +  + I     +    E V   ++  +N+ NQ      C E  F N   RKIYT   F  +YL+PL  + +++  +  KL          ++ N  R      S ++ K+  +L+++ L+F++ WLP     +  D+         + R   D +   + P + ++ + NSS+NP
Sbjct:   65 MVGNILVCLIVLENRCMRTVTNLFILNLAISDLLVGIFCIPTTLVDNLITGWPFSNTVCKMSGFVQGVSVSASVFTLVAIAVERFRCIVYPLQPKLTLLVAKVAIVSIWVLAVVILCPAAVALTVEKVPFHYMVHNNDFNQTLPLYTCYEN-FANPQMRKIYTAVLFAHIYLLPLAVITLMYISIGVKLCSSVVANREPQLANIRRHGQQMVSQKKIKVVKMLVVVTLLFMVSWLPLWTLMMMTDY-------GGLDRDQLDLLTSYIFPFAHWLAFSNSSVNP 340          
BLAST of GCR328 vs. Ensembl Medaka
Match: npy7r (PRELI domain-containing protein 1, mitochondrial [Source:NCBI gene;Acc:101174272])

HSP 1 Score: 78.5666 bits (192), Expect = 1.377e-15
Identity = 77/247 (31.17%), Postives = 127/247 (51.42%), Query Frame = 2
Query:  245 IVLQTIFSLSICVGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIVHVDGSN-NTNQCKETW-FGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLW-KMPKEITNSIRSVDYSNRRKKXXXXXXXXXXXXXXCWLPHHVRCIYNDF 976
            I L T +SL I +G++GN LVI  ++ ++ MR   N F+ NLA++D+LV T+  PFTL   +   +KF    C +    Q+ +VHVS+L+L  I+ ER+  I+F +  ++ + +S L +         +A  + +        +   N     C E W  G      IY+ F   + Y+IPL  +   +      +W K+   I+ S R+ D  NRRKK + +L ++ ++F  CWLP HV  + +D 
Sbjct:   45 ITLITAYSLIILLGLLGNSLVIYMIIRYRNMRTVTNFFIANLALADLLVNTLCLPFTLVYTLLDEWKFGAVLCHMVPFAQALSVHVSILTLTVIALERYRCIVFHLGRRLTWHSSLLIMAFTWTVSAVLAAPLAIFREYRQEEIPSINLRIAVCSEKWPHGTSRDGVIYSLFMLLLQYIIPLAVISYAYIC----IWVKLKNHISPSSRN-DNINRRKKTTKMLALVVVVFATCWLPFHVFQLASDL 286          
BLAST of GCR328 vs. Ensembl Medaka
Match: npffr1l2 (neuropeptide FF receptor 1 like 2 [Source:ZFIN;Acc:ZDB-GENE-060526-110])

HSP 1 Score: 78.5666 bits (192), Expect = 1.939e-15
Identity = 80/284 (28.17%), Postives = 142/284 (50.00%), Query Frame = 2
Query:  287 IIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIV---HVDGSNNTNQ------CKETWFGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKL-----WKMPKEITNSIRSVD--YSNRRKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINP 1090
            ++GN LV + VL  + MR   N+F+LNLAISD+LV     P TL + +   + FS   C++   +Q  +V  SV +L++I+ ERF  I++P+Q K+    +++ I  + +  + I     +    E V   ++  +N+ NQ      C E  F N   RKIYT   F  +YL+PL  + +++  +  KL          ++ N  R      S ++ K+  +L+++ L+F++ WLP     +  D+         + R   D +   + P + ++ + NSS+NP
Sbjct:   65 MVGNILVCLIVLENRCMRTVTNLFILNLAISDLLVGIFCIPTTLVDNLITGWPFSNTVCKMSGFVQGVSVSASVFTLVAIAVERFRCIVYPLQPKLTLLVAKVAIVSIWVLAVVILCPAAVALTVEKVPFHYMVHNNDFNQTLPLYTCYEN-FANPQMRKIYTAVLFAHIYLLPLAVITLMYISIGVKLCSSVVANREPQLANIRRHGQQMVSQKKIKVVKMLVVVTLLFMVSWLPLWTLMMMTDY-------GGLDRDQLDLLTSYIFPFAHWLAFSNSSVNP 340          
BLAST of GCR328 vs. Planmine SMEST
Match: SMESG000039924.1 (SMESG000039924.1)

HSP 1 Score: 707.983 bits (1826), Expect = 0.000e+0
Identity = 398/398 (100.00%), Postives = 398/398 (100.00%), Query Frame = 2
Query:   62 MFEHSTKPNEIYKLDGNTNDVDTLSFDHCLKNKFIPGTELFAKCITEKIISFLENNKNPYSIVLQTIFSLSICVGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIVHVDGSNNTNQCKETWFGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLWKMPKEITNSIRSVDYSNRRKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINPFCSLLISTKFRYCVKYIFKYLYSAAKHRGFNRSKNKLPVGKASSQFIARVRSINS 1255
            MFEHSTKPNEIYKLDGNTNDVDTLSFDHCLKNKFIPGTELFAKCITEKIISFLENNKNPYSIVLQTIFSLSICVGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRLKIWLLSIWLLSIALSMPLGYASEIVHVDGSNNTNQCKETWFGNQLYRKIYTFFSFFILYLIPLFFMLILHFILITKLWKMPKEITNSIRSVDYSNRRKKLSIILIMLCLIFLICWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINPFCSLLISTKFRYCVKYIFKYLYSAAKHRGFNRSKNKLPVGKASSQFIARVRSINS
Sbjct:    1 MFEHSTKPNEIYKLDGNTNDVDTLSFDHCLKNKFIPGTELFAKCITEKIISFLENNKNPYSIVLQTIFSLSICVGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRLKIWLLSIWLLSIALSMPLGYASEIVHVDGSNNTNQCKETWFGNQLYRKIYTFFSFFILYLIPLFFMLILHFILITKLWKMPKEITNSIRSVDYSNRRKKLSIILIMLCLIFLICWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINPFCSLLISTKFRYCVKYIFKYLYSAAKHRGFNRSKNKLPVGKASSQFIARVRSINS 398          
BLAST of GCR328 vs. Planmine SMEST
Match: SMESG000009621.1 (SMESG000009621.1)

HSP 1 Score: 126.331 bits (316), Expect = 1.942e-32
Identity = 104/319 (32.60%), Postives = 182/319 (57.05%), Query Frame = 2
Query:  224 NNKNPYSIVLQ-TIFSL--------SICVGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQY-KMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIVHVDGSNNTNQCKETWFGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLWKMPKE--ITNSIRSVDYSNR----RKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINPFCSLLISTKFRYCV 1132
            N+K+ Y+I  + +IF L           VGI GN L+++ +   + MR  +N+FL NLAISD+ +  I  P +L   +   + F   FC++Q  LQ T + VS+LSL+ ++ ER YV +  M++   +++     ++++ IW ++ ++S+PL +++E+    G +    C ETW+G   +++ YT   F +LY  PL  M+IL+++++TK+    K+   T +  + +Y  R    R ++S +   L  +F ICWLP+H+  IY DF I     E+ ++ Y  +++    PI Q++ Y NS+INP  ++ IS KFR+ V
Sbjct:   33 NSKDSYAITFEISIFKLINLLFYIILFTVGIFGNLLILVCIFSLKHMRTISNMFLANLAISDLFIFLICQPLSLTTIIYSSWVFGEKFCKLQGLLQGTNLGVSILSLLGLNIER-YVAVRKMRFGNQLYRRKLCIMYIIGIWCIAGSISLPLAFSTEL--KKGIDKKQYCLETWWGTIFWKQFYTIMLFLVLYAFPLLSMIILYYLILTKVKNSMKQQTFTTNHSTRNYVTRLRTQRTRISKVSTALVCLFTICWLPYHIVNIYADFQIL---NENQTKVY--YLINYGYPIVQWLVYSNSAINPLSTIFISQKFRFAV 343          
BLAST of GCR328 vs. Planmine SMEST
Match: SMESG000062880.1 (SMESG000062880.1)

HSP 1 Score: 102.834 bits (255), Expect = 9.887e-24
Identity = 103/333 (30.93%), Postives = 172/333 (51.65%), Query Frame = 2
Query:  284 GIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIVHVDGS--NNTNQCKETWFGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLWKMPKEIT----------------------------NSIRSVDYSNRRKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYD-DFILERLTPISQFMCYLNSSINPFCSLLISTKFRYCVKYIFKYLYSAAKHRGFNRS 1189
            G  GN  VI+ V LF+ MR  +++FLLNLA SD+LV  I  PFT+ + +N  + F    C++    Q T+V VS+L+L S+  ER+ VI+     +  F    L  W++ IW+ S  ++ PL  A E+   + +    T  C ETW G    +K++T   F + YL+PL FMLIL+  +   L +    +                             NSI+ ++  N R+++S +L++L L+F I WLP+HV     DFI       ++    D  ++   + P++Q + Y+N++INP C+L+IS KFR  +  + K  ++++ +    ++
Sbjct:   84 GSTGNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFIKPTRYCMETWSGKNNRKKVFTTIIFILFYLLPLIFMLILYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGIN--NTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLNQMRKCQFASSSNSKLTKT 414          
BLAST of GCR328 vs. Planmine SMEST
Match: SMESG000016672.1 (SMESG000016672.1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.262e-17
Identity = 76/241 (31.54%), Postives = 130/241 (53.94%), Query Frame = 2
Query:  239 YSIVLQTIFSLSICVGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVY-KFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIVHVDGSNNTNQCKETWFGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLW-KMPKEITNSIRSVDYSNRRKKXXXXXXXXXXXXXXCWLPHHV 955
            Y ++   +FS+   VGI GN+  I  +L+    RN  NIFL NL+++DIL+  I +P TL +   L Y  F    C+V   +Q  +V +S L+ + IS +RF V+ FPM+ ++   N      +   W++SI LS+PL   +EI  ++   N + C+E W  N+ +  IYTF      Y +P+ F+   +  +  KLW + P  ++   R+   +N +K++  ++I++   + +  LP HV
Sbjct:   16 YKVLFSILFSIVFIVGIGGNY-CICWILIKDINRNATNIFLFNLSLADILMCLICSPVTLVSDGLLFYWPFGSLLCKVVPFIQGISVFLSGLTHVVISSDRFVVVFFPMKTRL--SNECSWGLIGLTWIISIILSLPLVIVNEISTIN--QNRDLCEENW-KNKDHGLIYTFVVLICQYFLPVAFITSTYIAIAVKLWIRKPPGVSFPGRNEQVNNSKKRMVKMVIIVASFYSLSQLPRHV 250          
BLAST of GCR328 vs. Planmine SMEST
Match: SMESG000059151.1 (SMESG000059151.1)

HSP 1 Score: 80.1073 bits (196), Expect = 2.972e-16
Identity = 86/286 (30.07%), Postives = 151/286 (52.80%), Query Frame = 2
Query:  263 FSLSICVGIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRXXXXXXXXXXXXXXXXMPLGYASEIVHVDGSNNTNQCKETWFGNQLYRKIYTFFSFFILYXXXXXXXXXXXXXXXTKLWKMPKEI----TNSIRSVDYS-NRRKKXXXXXXXXXXXXXXCWLPHHVRCIYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYL----NSSINPF 1093
            +S+   +G++GN  VI  V+  + MR   NIF+ NLA+SDI++  IA PFT        +      C+V       +V+VS L+  +I+ +RF++I+ P   +M  KNS     +  IW+++I +S+PL    +    D  +NT++C+E W  +   R+++TF SF + +++P   + + +F +   L +  K      T SIR  +    R++K + +LI +  IF+ICW+P +   +  D         S++ KY D  L+   PI  F+C++    ++  NPF
Sbjct:   25 YSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRM--KNSLCGFIICVIWIIAILISLPLA-VYQTKRNDLQSNTSKCQEVWPIDS-SREVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSIRGKEGEIKRKRKTNKMLIAMVTIFVICWIPLNSLWMATDM--------SMNFKY-DLRLQFFFPIGFFICHMIAMSSAVYNPF 297          
The following BLAST results are available for this feature:
BLAST of GCR328 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NPY2R1.088e-1728.28neuropeptide Y receptor Y2 [Source:HGNC Symbol;Acc... [more]
NPY2R1.088e-1728.28neuropeptide Y receptor Y2 [Source:HGNC Symbol;Acc... [more]
HCRTR23.979e-1726.32hypocretin receptor 2 [Source:HGNC Symbol;Acc:HGNC... [more]
HCRTR23.979e-1726.32hypocretin receptor 2 [Source:HGNC Symbol;Acc:HGNC... [more]
HRH22.640e-1525.07histamine receptor H2 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of GCR328 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npr-112.961e-1433.61Putative neuropeptide Y receptor 11 [Source:UniPr... [more]
npr-125.862e-1423.13NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
npr-125.956e-1423.45NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
npr-101.020e-1327.17NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
npr-101.127e-1327.17NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
back to top
BLAST of GCR328 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TkR99D5.465e-1624.22gene:FBgn0004622 transcript:FBtr0085507[more]
TkR99D5.639e-1624.22gene:FBgn0004622 transcript:FBtr0301656[more]
TkR99D8.103e-1624.22gene:FBgn0004622 transcript:FBtr0330298[more]
ETHR4.535e-1527.46gene:FBgn0038874 transcript:FBtr0084054[more]
ETHR4.535e-1527.46gene:FBgn0038874 transcript:FBtr0339194[more]
back to top
BLAST of GCR328 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grpr1.014e-1829.24gastrin-releasing peptide receptor [Source:ZFIN;Ac... [more]
kiss1rb1.961e-1728.86KISS1 receptor b [Source:ZFIN;Acc:ZDB-GENE-060526-... [more]
AL929549.12.250e-1729.63pep chromosome:GRCz11:CHR_ALT_CTG5_1_26:33067396:3... [more]
nmbr2.605e-1727.61neuromedin B receptor [Source:ZFIN;Acc:ZDB-GENE-04... [more]
ghsrb2.767e-1727.42growth hormone secretagogue receptor b [Source:ZFI... [more]
back to top
BLAST of GCR328 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000015562.15.858e-2130.16Xenopus tropicalis orexin receptor type 2-like (LO... [more]
NPY2R2.443e-1728.11neuropeptide Y receptor Y2 [Source:NCBI gene;Acc:1... [more]
HCRTR22.499e-1726.94hypocretin (orexin) receptor 2 [Source:NCBI gene;A... [more]
slc11a23.001e-1727.39solute carrier family 11 member 2 [Source:Xenbase;... [more]
NPFFR26.929e-1629.33neuropeptide FF receptor 2 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of GCR328 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Npy2r2.745e-1727.87neuropeptide Y receptor Y2 [Source:MGI Symbol;Acc:... [more]
Npy2r2.745e-1727.87neuropeptide Y receptor Y2 [Source:MGI Symbol;Acc:... [more]
Npy2r2.745e-1727.87neuropeptide Y receptor Y2 [Source:MGI Symbol;Acc:... [more]
Npffr24.388e-1525.66neuropeptide FF receptor 2 [Source:MGI Symbol;Acc:... [more]
Hcrtr24.595e-1525.21hypocretin (orexin) receptor 2 [Source:MGI Symbol;... [more]
back to top
BLAST of GCR328 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|C3ZQF9|QRFPR_BRAFL1.875e-1727.11QRFP-like peptide receptor OS=Branchiostoma florid... [more]
sp|P79113|NPY2R_BOVIN3.206e-1727.64Neuropeptide Y receptor type 2 OS=Bos taurus OX=99... [more]
sp|Q5IS62|NPY2R_PANTR5.225e-1728.28Neuropeptide Y receptor type 2 OS=Pan troglodytes ... [more]
sp|P49146|NPY2R_HUMAN5.225e-1728.28Neuropeptide Y receptor type 2 OS=Homo sapiens OX=... [more]
sp|Q9Z2D5|NPY2R_CAVPO9.390e-1728.26Neuropeptide Y receptor type 2 OS=Cavia porcellus ... [more]
back to top
BLAST of GCR328 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUV80.000e+0100.00GCR328 OS=Schmidtea mediterranea OX=79327 GN=gcr32... [more]
V4AXU11.857e-2930.00G_PROTEIN_RECEP_F1_2 domain-containing protein (Fr... [more]
A0A193KUH96.983e-2932.60GCR448 OS=Schmidtea mediterranea OX=79327 GN=gcr44... [more]
K1QZG62.596e-2432.30Orexin receptor type 2 OS=Crassostrea gigas OX=291... [more]
A0A210QVM63.804e-2430.52Pyroglutamylated RFamide peptide receptor OS=Mizuh... [more]
back to top
BLAST of GCR328 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npffr11.234e-2027.54neuropeptide FF receptor 1 [Source:ZFIN;Acc:ZDB-GE... [more]
npffr11.598e-1928.45neuropeptide FF receptor 1 [Source:ZFIN;Acc:ZDB-GE... [more]
npffr2b2.665e-1927.78neuropeptide FF receptor 2-like [Source:NCBI gene;... [more]
nmbr9.313e-1827.46neuromedin B receptor [Source:NCBI gene;Acc:103031... [more]
npffr2b3.986e-1726.25neuropeptide FF receptor 2-like [Source:NCBI gene;... [more]
back to top
BLAST of GCR328 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npffr1l38.254e-1727.92neuropeptide FF receptor 1 like 3 [Source:ZFIN;Acc... [more]
prlh2r5.132e-1424.34prolactin releasing hormone 2 receptor [Source:ZFI... [more]
kiss1rb3.862e-1325.82KISS1 receptor b [Source:ZFIN;Acc:ZDB-GENE-060526-... [more]
si:dkey-202l22.39.122e-1328.15prolactin releasing hormone receptor [Source:HGNC ... [more]
galr2a1.407e-1124.38galanin receptor 2a [Source:ZFIN;Acc:ZDB-GENE-1306... [more]
back to top
BLAST of GCR328 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR328 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO444185.716e-2031.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO500215.239e-1831.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409448.146e-1825.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO469031.637e-1629.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO397191.693e-1630.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GCR328 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npffr2b3.204e-1627.09neuropeptide FF receptor 2-like [Source:NCBI gene;... [more]
npffr1l21.210e-1528.17neuropeptide FF receptor 1 like 2 [Source:ZFIN;Acc... [more]
npffr1l21.292e-1528.17neuropeptide FF receptor 1 like 2 [Source:ZFIN;Acc... [more]
npy7r1.377e-1531.17PRELI domain-containing protein 1, mitochondrial [... [more]
npffr1l21.939e-1528.17neuropeptide FF receptor 1 like 2 [Source:ZFIN;Acc... [more]
back to top
BLAST of GCR328 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000039924.10.000e+0100.00SMESG000039924.1[more]
SMESG000009621.11.942e-3232.60SMESG000009621.1[more]
SMESG000062880.19.887e-2430.93SMESG000062880.1[more]
SMESG000016672.11.262e-1731.54SMESG000016672.1[more]
SMESG000059151.12.972e-1630.07SMESG000059151.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035967 ID=SMED30035967|Name=GCR328|organism=Schmidtea mediterranea sexual|type=transcript|length=1274bp
TTCCATACTAAATTAAAACAATTAGGAATTCAGTCAAAAACTTGTATGGT
ACCCACGAAAAATGTTTGAGCATTCGACAAAGCCCAATGAAATTTACAAA
TTAGACGGAAATACCAACGACGTAGACACTTTGTCCTTTGATCATTGTTT
GAAAAATAAATTTATTCCTGGGACGGAATTATTTGCAAAATGTATAACGG
AGAAAATCATCTCCTTTCTTGAAAACAACAAAAATCCCTATTCGATAGTT
TTGCAAACGATTTTCTCTTTGTCGATTTGTGTTGGAATAATCGGGAATTT
TTTGGTCATCATGAGTGTTTTGTTGTTTCAATTTATGAGAAATTTCGCCA
ACATATTTCTCCTTAATTTGGCAATCAGCGACATTCTCGTTTTGACAATA
GCGGCCCCATTTACTTTGTTCAATCAAGTGAATCTCGTTTATAAATTCAG
TCCATTTTTCTGTCAAGTGCAGTCAGGCTTGCAGTCTACAACGGTTCACG
TAAGCGTTTTATCTCTGATGAGCATTAGCTTTGAAAGATTTTACGTCATT
ATGTTTCCGATGCAATACAAAATGATTTTCAAAAATTCCCGACTGAAAAT
TTGGCTCTTGTCAATTTGGCTGTTGAGTATTGCTCTTAGTATGCCATTGG
GATATGCCAGTGAAATTGTTCATGTTGACGGTTCAAACAACACAAACCAA
TGCAAAGAAACTTGGTTTGGTAATCAACTGTACCGAAAGATTTATACGTT
TTTCTCGTTTTTTATTCTCTATCTAATTCCACTATTTTTCATGTTGATTC
TTCATTTCATTCTTATAACAAAACTTTGGAAAATGCCGAAAGAAATTACA
AATTCCATTCGAAGCGTCGATTATTCTAACCGACGCAAAAAGCTGTCCAT
TATTCTTATAATGCTCTGTTTGATATTTCTCATTTGTTGGCTACCACATC
ACGTTCGTTGTATCTATAATGACTTTATTATCAAGATTTATTCAGCGGAG
AGTATCAGCCGCAAATATGATGACTTCATCCTGGAGAGGTTGACCCCGAT
TTCACAATTCATGTGTTACCTCAACTCATCTATCAACCCTTTCTGTTCAT
TACTTATTTCAACGAAATTTAGGTATTGTGTTAAATACATTTTTAAATAT
CTATATTCTGCCGCAAAGCACAGGGGCTTTAATAGAAGTAAAAACAAATT
ACCGGTTGGGAAAGCTTCTTCACAATTTATTGCTCGAGTCCGCAGCATAA
ACAGTTAACTACTTGTCACTGTAC
back to top

protein sequence of SMED30035967-orf-1

>SMED30035967-orf-1 ID=SMED30035967-orf-1|Name=SMED30035967-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=399bp
MFEHSTKPNEIYKLDGNTNDVDTLSFDHCLKNKFIPGTELFAKCITEKII
SFLENNKNPYSIVLQTIFSLSICVGIIGNFLVIMSVLLFQFMRNFANIFL
LNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVL
SLMSISFERFYVIMFPMQYKMIFKNSRLKIWLLSIWLLSIALSMPLGYAS
EIVHVDGSNNTNQCKETWFGNQLYRKIYTFFSFFILYLIPLFFMLILHFI
LITKLWKMPKEITNSIRSVDYSNRRKKLSIILIMLCLIFLICWLPHHVRC
IYNDFIIKIYSAESISRKYDDFILERLTPISQFMCYLNSSINPFCSLLIS
TKFRYCVKYIFKYLYSAAKHRGFNRSKNKLPVGKASSQFIARVRSINS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 328..354
score: 24.32
coord: 229..252
score: 18.27
coord: 63..87
score: 27.53
coord: 278..302
score: 24.41
coord: 177..198
score: 22.82
coord: 96..117
score: 35.99
coord: 141..163
score: 26.08
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 78..345
e-value: 1.5E-42
score: 145.8
IPR000276G protein-coupled receptor, rhodopsin-likePROSITEPS00237G_PROTEIN_RECEP_F1_1coord: 147..163
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 45..396
e-value: 8.9E-66
score: 223.8
NoneNo IPR availablePANTHERPTHR45695FAMILY NOT NAMEDcoord: 54..362
NoneNo IPR availableCDDcd149937tmA_CCKR-likecoord: 62..354
e-value: 1.33602E-59
score: 193.585
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 58..370
NoneNo IPR availableTMHMMTMhelixcoord: 230..252
NoneNo IPR availableTMHMMTMhelixcoord: 178..200
NoneNo IPR availableTMHMMTMhelixcoord: 278..297
NoneNo IPR availableTMHMMTMhelixcoord: 98..120
NoneNo IPR availableTMHMMTMhelixcoord: 135..157
NoneNo IPR availableTMHMMTMhelixcoord: 67..89
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 78..346
score: 39.369