Neuron navigator 2

Overview
NameNeuron navigator 2
Smed IDSMED30035965
Length (bp)5705
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Neuron navigator 2 (SMED30035965) t-SNE clustered cells

Violin plots show distribution of expression levels for Neuron navigator 2 (SMED30035965) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Neuron navigator 2 (SMED30035965) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Neuron navigator 2 (SMED30035965) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035965

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30035965h1SMcG0014042 SmedASXL_017070SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30035965h1SMcG0008801 Contig45278newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035965h1SMcG0008801 Contig45278uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30035965h1SMcG0014042 dd_Smed_v4_7701_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035965h1SMcG0014042 dd_Smed_v4_7701_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30035965h1SMcG0014042 dd_Smed_v4_7701_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035965h1SMcG0014042 dd_Smed_v4_7701_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035965h1SMcG0014042 dd_Smed_v4_7701_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30035965h1SMcG0014042 dd_Smed_v4_7701_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30035965h1SMcG0014042 dd_Smed_v4_7701_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035965h1SMcG0014042 Contig53619uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035965h1SMcG0014042 Contig53619newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035965h1SMcG0014042 Contig45278newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035965h1SMcG0014042 Contig45278uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30035965h1SMcG0014042 dd_Smed_v6_7701_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Neuron navigator 2 vs. Ensembl Human
Match: NAV3 (neuron navigator 3 [Source:HGNC Symbol;Acc:HGNC:15998])

HSP 1 Score: 553.518 bits (1425), Expect = 1.231e-169
Identity = 352/882 (39.91%), Postives = 488/882 (55.33%), Query Frame = 3
Query: 2757 EDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGT---NLNNDNHTTVSLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAF-RKKFKHSDVSMSDIE---------GDYYVHHLADNRSRISNDSQNSSKNF-MLDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTAN-KVVQYVSENTSNCASIDMFSHLFKFSSENEISIG-AYVYFNDIIVSPSSVQHITNKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQN-ETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDSQVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQEAANYSTS 5351
            E   S++I KLR EL  +Q+KV TL+S+L  NAH+ +AFE SL N+T RLQ L+ T+E+K+ EL++LR  IE L+ Q     NS  Q      LN  +H    L                  R++   S+++V+  +S  +   IGS          D  S  +       ++    RSSF +AF +KK      S SDIE              H+  D  S     SQ++S      +A +  I  LK +L+E++LKLTD +LEALSSAH L+Q++E +N M+ E+  L+A+N+RL+      + P    + ++    SS+       S  N  + + VS +     + D   H    S +  +SI   Y    D           +   LIGS  +S  + W  LD  IR LFKEY+   D   +LG++ + I  Y +G + +      S N E   + P        L  + N I + L+  + N+  LD+  FDTLIPK +  RY +LL+EH  IIL GPSGTGKTYLANKLA+++I +  ++ +   +A F VDHKS+KEL+ YLA +AEQ   S DNN          P+V+ILDNLHHV SL++IF+ FL+      PY+IGTM Q   S+ NL+ HHNFRWVLCANH EPVKGFLGRYLRRKLI+ E +    ++ L+  ++WI K W H+N FLE+HSSSDVTIGPRLFL CPM +EGS++WF DLWNYSLVPY+LEAVREGLQ +G+R+ WEDP  W+L T+PW S+ +   +    +L++LRPEDVGY+             S ++ +  T+S+ IPQ                            T    DPL+NML+KLQEAANYS++
Sbjct:  459 EKAHSEQIHKLRRELVASQEKVATLTSQLSANAHLVAAFEKSLGNMTGRLQSLTMTAEQKESELIELRETIEMLKAQ-----NSAAQAAIQGALNGPDHPPKDL------------------RIRRQHSSESVSSINSATSHSSIGSG--------NDADSKKKKKKNWVNSRGSELRSSFKQAFGKKKSTKPPSSHSDIEELTDSSLPASPKLPHNAGDCGSASMKPSQSASAICECTEAEAEIILQLKSELREKELKLTDIRLEALSSAHHLDQIREAMNRMQNEIEILKAENDRLKAETGNTAKPTRPPSESSSSTSSSSSRQSLGLSLNNLNITEAVSSDILLDDAGDATGHKDGRSVKIIVSISKGYGRAKD---------QKSQAYLIGSIGVSGKTKWDVLDGVIRRLFKEYVFRIDTSTSLGLSSDCIASYCIGDLIR------SHNLEVPELLPCGY-----LVGDNNIITVNLKGVEENS--LDSFVFDTLIPKPITQRYFNLLMEHHRIILSGPSGTGKTYLANKLAEYVITKSGRKKTEDAIATFNVDHKSSKELQQYLANLAEQC--SADNNGVEL------PVVIILDNLHHVGSLSDIFNGFLNCKYNKCPYIIGTMNQGVSSSPNLELHHNFRWVLCANHTEPVKGFLGRYLRRKLIEIEIERNIRNNDLVKIIDWIPKTWHHLNSFLETHSSSDVTIGPRLFLPCPMDVEGSRVWFMDLWNYSLVPYILEAVREGLQMYGKRTPWEDPSKWVLDTYPWSSATLPQES---PALLQLRPEDVGYE-------------SCTSTKEATTSKHIPQ----------------------------TDTEGDPLMNMLMKLQEAANYSST 1235          
BLAST of Neuron navigator 2 vs. Ensembl Human
Match: NAV3 (neuron navigator 3 [Source:HGNC Symbol;Acc:HGNC:15998])

HSP 1 Score: 559.681 bits (1441), Expect = 5.102e-167
Identity = 356/882 (40.36%), Postives = 490/882 (55.56%), Query Frame = 3
Query: 2757 EDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGT---NLNNDNHTTVSLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAF-RKKFKHSDVSMSDIE---------GDYYVHHLADNRSRISNDSQNSSKNF-MLDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTAN-KVVQYVSENTSNCASIDMFSHLFKFSSENEISIG-AYVYFNDIIVSPSSVQHITNKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQN-ETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDSQVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQEAANYSTS 5351
            E   S++I KLR EL  +Q+KV TL+S+L  NAH+ +AFE SL N+T RLQ L+ T+E+K+ EL++LR  IE L+ Q     NS  Q      LN  +H    L                  R++   S+++V+  +S  +   IGS     S               KK+ KK W RSSF +AF +KK      S SDIE              H+  D  S     SQ++S      +A +  I  LK +L+E++LKLTD +LEALSSAH L+Q++E +N M+ E+  L+A+N+RL+      + P    + ++    SS+       S  N  + + VS +     + D   H    S +  +SI   Y    D           +   LIGS  +S  + W  LD  IR LFKEY+   D   +LG++ + I  Y +G + +      S N E   + P        L  + N I + L+  + N+  LD+  FDTLIPK +  RY +LL+EH  IIL GPSGTGKTYLANKLA+++I +  ++ +   +A F VDHKS+KEL+ YLA +AEQ   S DNN          P+V+ILDNLHHV SL++IF+ FL+      PY+IGTM Q   S+ NL+ HHNFRWVLCANH EPVKGFLGRYLRRKLI+ E +    ++ L+  ++WI K W H+N FLE+HSSSDVTIGPRLFL CPM +EGS++WF DLWNYSLVPY+LEAVREGLQ +G+R+ WEDP  W+L T+PW S+ +   +    +L++LRPEDVGY+             S ++ +  T+S+ IPQ                            T    DPL+NML+KLQEAANYS++
Sbjct: 1050 EKAHSEQIHKLRRELVASQEKVATLTSQLSANAHLVAAFEKSLGNMTGRLQSLTMTAEQKESELIELRETIEMLKAQ-----NSAAQAAIQGALNGPDHPPKDL------------------RIRRQHSSESVSSINSATSHSSIGSGNDADS---------------KKKKKKNWLRSSFKQAFGKKKSTKPPSSHSDIEELTDSSLPASPKLPHNAGDCGSASMKPSQSASAICECTEAEAEIILQLKSELREKELKLTDIRLEALSSAHHLDQIREAMNRMQNEIEILKAENDRLKAETGNTAKPTRPPSESSSSTSSSSSRQSLGLSLNNLNITEAVSSDILLDDAGDATGHKDGRSVKIIVSISKGYGRAKD---------QKSQAYLIGSIGVSGKTKWDVLDGVIRRLFKEYVFRIDTSTSLGLSSDCIASYCIGDLIR------SHNLEVPELLPCGY-----LVGDNNIITVNLKGVEENS--LDSFVFDTLIPKPITQRYFNLLMEHHRIILSGPSGTGKTYLANKLAEYVITKSGRKKTEDAIATFNVDHKSSKELQQYLANLAEQC--SADNNGVEL------PVVIILDNLHHVGSLSDIFNGFLNCKYNKCPYIIGTMNQGVSSSPNLELHHNFRWVLCANHTEPVKGFLGRYLRRKLIEIEIERNIRNNDLVKIIDWIPKTWHHLNSFLETHSSSDVTIGPRLFLPCPMDVEGSRVWFMDLWNYSLVPYILEAVREGLQMYGKRTPWEDPSKWVLDTYPWSSATLPQES---PALLQLRPEDVGYE-------------SCTSTKEATTSKHIPQ----------------------------TDTEGDPLMNMLMKLQEAANYSST 1819          
BLAST of Neuron navigator 2 vs. Ensembl Human
Match: NAV3 (neuron navigator 3 [Source:HGNC Symbol;Acc:HGNC:15998])

HSP 1 Score: 558.525 bits (1438), Expect = 4.184e-164
Identity = 352/882 (39.91%), Postives = 488/882 (55.33%), Query Frame = 3
Query: 2757 EDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGT---NLNNDNHTTVSLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAF-RKKFKHSDVSMSDIE---------GDYYVHHLADNRSRISNDSQNSSKNF-MLDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTAN-KVVQYVSENTSNCASIDMFSHLFKFSSENEISIG-AYVYFNDIIVSPSSVQHITNKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQN-ETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDSQVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQEAANYSTS 5351
            E   S++I KLR EL  +Q+KV TL+S+L  NAH+ +AFE SL N+T RLQ L+ T+E+K+ EL++LR  IE L+ Q     NS  Q      LN  +H    L                  R++   S+++V+  +S  +   IGS          D  S  +       ++    RSSF +AF +KK      S SDIE              H+  D  S     SQ++S      +A +  I  LK +L+E++LKLTD +LEALSSAH L+Q++E +N M+ E+  L+A+N+RL+      + P    + ++    SS+       S  N  + + VS +     + D   H    S +  +SI   Y    D           +   LIGS  +S  + W  LD  IR LFKEY+   D   +LG++ + I  Y +G + +      S N E   + P        L  + N I + L+  + N+  LD+  FDTLIPK +  RY +LL+EH  IIL GPSGTGKTYLANKLA+++I +  ++ +   +A F VDHKS+KEL+ YLA +AEQ   S DNN          P+V+ILDNLHHV SL++IF+ FL+      PY+IGTM Q   S+ NL+ HHNFRWVLCANH EPVKGFLGRYLRRKLI+ E +    ++ L+  ++WI K W H+N FLE+HSSSDVTIGPRLFL CPM +EGS++WF DLWNYSLVPY+LEAVREGLQ +G+R+ WEDP  W+L T+PW S+ +   +    +L++LRPEDVGY+             S ++ +  T+S+ IPQ                            T    DPL+NML+KLQEAANYS++
Sbjct: 1564 EKAHSEQIHKLRRELVASQEKVATLTSQLSANAHLVAAFEKSLGNMTGRLQSLTMTAEQKESELIELRETIEMLKAQ-----NSAAQAAIQGALNGPDHPPKDL------------------RIRRQHSSESVSSINSATSHSSIGSG--------NDADSKKKKKKNWVNSRGSELRSSFKQAFGKKKSTKPPSSHSDIEELTDSSLPASPKLPHNAGDCGSASMKPSQSASAICECTEAEAEIILQLKSELREKELKLTDIRLEALSSAHHLDQIREAMNRMQNEIEILKAENDRLKAETGNTAKPTRPPSESSSSTSSSSSRQSLGLSLNNLNITEAVSSDILLDDAGDATGHKDGRSVKIIVSISKGYGRAKD---------QKSQAYLIGSIGVSGKTKWDVLDGVIRRLFKEYVFRIDTSTSLGLSSDCIASYCIGDLIR------SHNLEVPELLPCGY-----LVGDNNIITVNLKGVEENS--LDSFVFDTLIPKPITQRYFNLLMEHHRIILSGPSGTGKTYLANKLAEYVITKSGRKKTEDAIATFNVDHKSSKELQQYLANLAEQC--SADNNGVEL------PVVIILDNLHHVGSLSDIFNGFLNCKYNKCPYIIGTMNQGVSSSPNLELHHNFRWVLCANHTEPVKGFLGRYLRRKLIEIEIERNIRNNDLVKIIDWIPKTWHHLNSFLETHSSSDVTIGPRLFLPCPMDVEGSRVWFMDLWNYSLVPYILEAVREGLQMYGKRTPWEDPSKWVLDTYPWSSATLPQES---PALLQLRPEDVGYE-------------SCTSTKEATTSKHIPQ----------------------------TDTEGDPLMNMLMKLQEAANYSST 2340          

HSP 2 Score: 120.939 bits (302), Expect = 1.971e-26
Identity = 57/139 (41.01%), Postives = 90/139 (64.75%), Query Frame = 3
Query:  171 SEYQASLLNECKEDVENEMKFDSENSISKTQQANALLTIYTEWANHYLEKAGFNNFVNDLQTDLCDGALLADIIIAVTGEKVPNTKPKPKTQIQQMENLNSCLIFLSNIGVVTEGIQSKDINDGNLKAILGLLFNLSRY 587
            +E ++S+L+ C+  +++  +F  +  +    +      IYT+WANHYL K+G    + DLQ D+ DG LLA+II  +  EKV +    P++Q Q +EN++ CL FL+  GV  +G+ +++I +GNLKAILGL F+LSRY
Sbjct:   45 TETESSMLS-CQLALKSTCEFGEKKPLQGKAKEKEDSKIYTDWANHYLAKSGHKRLIKDLQQDIADGVLLAEIIQIIANEKVEDINGCPRSQSQMIENVDVCLSFLAARGVNVQGLSAEEIRNGNLKAILGLFFSLSRY 182          
BLAST of Neuron navigator 2 vs. Ensembl Human
Match: NAV3 (neuron navigator 3 [Source:HGNC Symbol;Acc:HGNC:15998])

HSP 1 Score: 553.518 bits (1425), Expect = 2.879e-162
Identity = 352/904 (38.94%), Postives = 491/904 (54.31%), Query Frame = 3
Query: 2757 EDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGT---NLNNDNHTTVSLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAF-RKKFKHSDVSMSDIE---------GDYYVHHLADNRSRISNDSQNSSKNFML-----------------------DASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTAN-KVVQYVSENTSNCASIDMFSHLFKFSSENEISIG-AYVYFNDIIVSPSSVQHITNKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQN-ETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDSQVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQEAANYSTS 5351
            E   S++I KLR EL  +Q+KV TL+S+L  NAH+ +AFE SL N+T RLQ L+ T+E+K+ EL++LR  IE L+ Q     NS  Q      LN  +H    L                  R++   S+++V+  +S  +   IGS          D  S  +       ++    RSSF +AF +KK      S SDIE              H+  D  S     SQ++S + ++                       +A +  I  LK +L+E++LKLTD +LEALSSAH L+Q++E +N M+ E+  L+A+N+RL+      + P    + ++    SS+       S  N  + + VS +     + D   H    S +  +SI   Y    D           +   LIGS  +S  + W  LD  IR LFKEY+   D   +LG++ + I  Y +G + +      S N E   + P        L  + N I + L+  + N+  LD+  FDTLIPK +  RY +LL+EH  IIL GPSGTGKTYLANKLA+++I +  ++ +   +A F VDHKS+KEL+ YLA +AEQ   S DNN          P+V+ILDNLHHV SL++IF+ FL+      PY+IGTM Q   S+ NL+ HHNFRWVLCANH EPVKGFLGRYLRRKLI+ E +    ++ L+  ++WI K W H+N FLE+HSSSDVTIGPRLFL CPM +EGS++WF DLWNYSLVPY+LEAVREGLQ +G+R+ WEDP  W+L T+PW S+ +   +    +L++LRPEDVGY+             S ++ +  T+S+ IPQ                            T    DPL+NML+KLQEAANYS++
Sbjct: 1564 EKAHSEQIHKLRRELVASQEKVATLTSQLSANAHLVAAFEKSLGNMTGRLQSLTMTAEQKESELIELRETIEMLKAQ-----NSAAQAAIQGALNGPDHPPKDL------------------RIRRQHSSESVSSINSATSHSSIGSG--------NDADSKKKKKKNWVNSRGSELRSSFKQAFGKKKSTKPPSSHSDIEELTDSSLPASPKLPHNAGDCGSASMKPSQSASASPLVWPPKKRQNGPVIYKHRSRICECTEAEAEIILQLKSELREKELKLTDIRLEALSSAHHLDQIREAMNRMQNEIEILKAENDRLKAETGNTAKPTRPPSESSSSTSSSSSRQSLGLSLNNLNITEAVSSDILLDDAGDATGHKDGRSVKIIVSISKGYGRAKD---------QKSQAYLIGSIGVSGKTKWDVLDGVIRRLFKEYVFRIDTSTSLGLSSDCIASYCIGDLIR------SHNLEVPELLPCGY-----LVGDNNIITVNLKGVEENS--LDSFVFDTLIPKPITQRYFNLLMEHHRIILSGPSGTGKTYLANKLAEYVITKSGRKKTEDAIATFNVDHKSSKELQQYLANLAEQC--SADNNGVEL------PVVIILDNLHHVGSLSDIFNGFLNCKYNKCPYIIGTMNQGVSSSPNLELHHNFRWVLCANHTEPVKGFLGRYLRRKLIEIEIERNIRNNDLVKIIDWIPKTWHHLNSFLETHSSSDVTIGPRLFLPCPMDVEGSRVWFMDLWNYSLVPYILEAVREGLQMYGKRTPWEDPSKWVLDTYPWSSATLPQES---PALLQLRPEDVGYE-------------SCTSTKEATTSKHIPQ----------------------------TDTEGDPLMNMLMKLQEAANYSST 2362          

HSP 2 Score: 120.939 bits (302), Expect = 2.009e-26
Identity = 57/139 (41.01%), Postives = 90/139 (64.75%), Query Frame = 3
Query:  171 SEYQASLLNECKEDVENEMKFDSENSISKTQQANALLTIYTEWANHYLEKAGFNNFVNDLQTDLCDGALLADIIIAVTGEKVPNTKPKPKTQIQQMENLNSCLIFLSNIGVVTEGIQSKDINDGNLKAILGLLFNLSRY 587
            +E ++S+L+ C+  +++  +F  +  +    +      IYT+WANHYL K+G    + DLQ D+ DG LLA+II  +  EKV +    P++Q Q +EN++ CL FL+  GV  +G+ +++I +GNLKAILGL F+LSRY
Sbjct:   45 TETESSMLS-CQLALKSTCEFGEKKPLQGKAKEKEDSKIYTDWANHYLAKSGHKRLIKDLQQDIADGVLLAEIIQIIANEKVEDINGCPRSQSQMIENVDVCLSFLAARGVNVQGLSAEEIRNGNLKAILGLFFSLSRY 182          
BLAST of Neuron navigator 2 vs. Ensembl Human
Match: NAV2 (neuron navigator 2 [Source:HGNC Symbol;Acc:HGNC:15997])

HSP 1 Score: 528.094 bits (1359), Expect = 2.737e-158
Identity = 296/725 (40.83%), Postives = 428/725 (59.03%), Query Frame = 3
Query: 3222 IGSSLENDPFKKQAKKGWFRSSFGKAFRKKFKHS---------DVSMSDIEGDYYVHHLADNRSR--ISNDSQNSSKNFMLDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTANKVVQYVSENTSNCASIDMF---SHLFKFSSENEISIGAYVYFND-IIVSPSSVQHITNKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDS-QVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQEAANYST 5348
            +GS++E+D  KK+ +K W RSSF +AF KK             +++ S +     + H     S   + N   NS  +  +D+ + T+  L+ +L+++++KLTD +LEALSSAHQL+QL+E +N M+ E+  L+A+N+RL+             +  +G   + +   ISA+   +  +   S N +   S+DM    +       E    +   V F + +     S  H+    LIG   +S  + W  LD  +R LFKEY+   DP + LG+N +S+  Y++G + KRS    + +ET  + P        L  E   I + ++    N+  LD+L F++LIPK +L RYVSLL+EHR IIL GPSGTGKTYLAN+L++++++R  +E++   +A F VDHKS+KELR YL+ +A+Q  S    NN  ++     P+V+ILDNLHHV+SL EIF+  L+      PY+IGTM QA+ S  NLQ HHNFRWVLCANH EPVKGFLGR+LRRKL++ E   +  +  L+  ++WI KVW H+N+FLE+HSSSDVTIGPRLFLSCP+ ++GS++WFTDLWNYS++PYLLEAVREGLQ +GRR+ WEDP  W++ T+PW +S    +  +   L++LRPEDVG+D   +P              +  TS Q+ P                                  DPL+NML++LQEAANYS+
Sbjct:  823 VGSNIESD-SKKKKRKNWLRSSFKQAFGKKKSPKSASSHSDIEEMTDSSLPSSPKLPHNGSTGSTPLLRNSHSNSLISECMDSEAETVMQLRNELRDKEMKLTDIRLEALSSAHQLDQLREAMNRMQSEIEKLKAENDRLK-----------SESQGSGCSRAPSQVSISASPRQSMGLSQHSLNLTESTSLDMLLDDTGECSARKEGGRHVKIVVSFQEEMKWKEDSRPHL---FLIGCIGVSGKTKWDVLDGVVRRLFKEYIIHVDPVSQLGLNSDSVLGYSIGEI-KRS----NTSETPELLPCGY-----LVGENTTISVTVKGLAENS--LDSLVFESLIPKPILQRYVSLLIEHRRIILSGPSGTGKTYLANRLSEYIVLREGRELTDGVIATFNVDHKSSKELRQYLSNLADQCNS---ENNAVDM-----PLVIILDNLHHVSSLGEIFNGLLNCKYHKCPYIIGTMNQATSSTPNLQLHHNFRWVLCANHTEPVKGFLGRFLRRKLMETEISGRVRNMELVKIIDWIPKVWHHLNRFLEAHSSSDVTIGPRLFLSCPIDVDGSRVWFTDLWNYSIIPYLLEAVREGLQLYGRRAPWEDPAKWVMDTYPWAAS---PQQHEWPPLLQLRPEDVGFDGYSMPR-------------EGSTSKQMPPSDAEG-----------------------------DPLMNMLMRLQEAANYSS 1467          
BLAST of Neuron navigator 2 vs. Ensembl Celegans
Match: unc-53 (Adapter protein unc-53 [Source:UniProtKB/Swiss-Prot;Acc:Q7YSI9])

HSP 1 Score: 218.779 bits (556), Expect = 8.334e-57
Identity = 218/785 (27.77%), Postives = 357/785 (45.48%), Query Frame = 3
Query: 2709 GSSLSLASNESRRSMSEDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGTNLNNDNHTTVSLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAFRKKFKHSD-VSMSDIEGDYYVHHLADNRSRISNDSQNSSKNFMLDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMV-RIESDPNEETNYNTGDEDSSAINDISATSTANKVVQYVSENTSNCASIDMFSHLFKFSSENEISIGAYVYFNDIIVSPSSVQHITNKVLIGSCHISES-STWSQLDSHIRCLFKEYLSFNDPFANLGINP-ESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKEL---RTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNR--PYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQ-EKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWI 5033
            GS LSLAS  +  S++E K    IR +  +LE  +  V +L+ + +    +   FE  L  +T+ + +    S  K  E ++ R  I  LR      + SN   +N                     AH     G +    S ++VA + S  +     S +   SL S           F K  KK W RSS  K  +KK K+ D   M  I G                 SQ +  N       + IE LKQ+L+ERD  L + +L+ L  A +++ L+E +N ++ E       N++L+K V ++ + P                    A+S A+  V Y  E+  + A     +      S    SI   V   DI    SS+ +   ++++G   +  S S W  +D  I  LF+ YLS  D    LGI+  +SI  Y +G + +R I +     T  IT + +    D+      I++ +     +   +D+L  D L+PK ++ + V  +L  R ++L G +G GK+ LA  LA ++ IR +Q  S  ++   ++   + +EL      L  I    +S      C          +VILDN+   N +A +   F +  +QN   P+V+ T+ +  +    LQ HHNF+  + +N +E   GF+ RYLRR+ ++ E++   +    L   +++     Q +N F+E  +S DVT+GPR  L+CP++++GS+ WF  LWN + +PYL    R+G +TFGR +++EDP D + + WPW 
Sbjct:  907 GSQLSLASTTAYGSLNE-KYEHAIRDMARDLECYKNTVDSLTKKQENYGALFDLFEQKLRKLTQHIDR----SNLKPEEAIRFRQDIAHLR------DISNHLASN--------------------SAHANEGAGELLRQPSLESVASHRSSMSSSSKSSKQEKISLSS-----------FGKN-KKSWIRSSLSKFTKKKNKNYDEAHMPSISG-----------------SQGTLDNI------DVIE-LKQELKERDSALYEVRLDNLDRAREVDVLRETVNKLKTE-------NKQLKKEVDKLTNGPATR-----------------ASSRASIPVIYDDEHVYDAACSSTSASQSSKRSSGCNSIKVTVNV-DIAGEISSIVNPDKEIIVGYLAMPTSQSCWKDIDVSILGLFEVYLSRIDVEHQLGIDARDSILGYQIGEL-RRVIGD----STTMITSHPT----DILTSSTTIRMFMHGAAQSR--VDSLVLDMLLPKQMILQLVKSILTERRLVLAGATGIGKSKLAKTLAAYVSIRTNQ--SEDSIVNISIPENNKEELLQVERRLEKILRSKES------C----------IVILDNIPK-NRIAFVVSVFANVPLQNNEGPFVVCTVNR--YQIPELQIHHNFKMSVMSNRLE---GFILRYLRRRAVEDEYRLTVQMPSELFKIIDFFPIALQAVNNFIEKTNSVDVTVGPRACLNCPLTVDGSREWFIRLWNENFIPYLERVARDGKKTFGRCTSFEDPTDIVSEKWPWF 1564          

HSP 2 Score: 67.3958 bits (163), Expect = 1.292e-10
Identity = 36/106 (33.96%), Postives = 55/106 (51.89%), Query Frame = 3
Query:  276 LLTIYTEWANHYLEKAGFNNFVNDLQTDLCDGALLADII--IAVTGEKVPNTKPKPKTQIQQMENLNSCLIFLSNIGVVTEGIQSKDINDGNLKAILGLLFNLSRY 587
            L+ IYT+WAN +L K   +  + D+  D  D  L++ +I  I    E  P    +       ++ L +CL +L N+G+    +   DI+ GNL A+L LLF LS Y
Sbjct:    8 LIPIYTDWANRHLSKGSLSKSIRDISNDFRDYRLVSQLINVIVPINEFSPAFTKRLAKITSNLDGLETCLDYLKNLGLDCSKLTKTDIDSGNLGAVLQLLFLLSTY 113          
BLAST of Neuron navigator 2 vs. Ensembl Celegans
Match: unc-53 (Adapter protein unc-53 [Source:UniProtKB/Swiss-Prot;Acc:Q7YSI9])

HSP 1 Score: 216.853 bits (551), Expect = 3.332e-56
Identity = 218/784 (27.81%), Postives = 357/784 (45.54%), Query Frame = 3
Query: 2709 GSSLSLASNESRRSMSEDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGTNLNNDNHTTVSLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAFRKKFKHSD-VSMSDIEGDYYVHHLADNRSRISNDSQNSSKNFMLDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMV-RIESDPNEETNYNTGDEDSSAINDISATSTANKVVQYVSENTSNCASIDMFSHLFKFSSENEISIGAYVYFNDIIVSPSSVQHITNKVLIGSCHISES-STWSQLDSHIRCLFKEYLSFNDPFANLGINP-ESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKEL---RTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNR--PYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQ-EKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPW 5030
            GS LSLAS  +  S++E K    IR +  +LE  +  V +L+ + +    +   FE  L  +T+ + +    S  K  E ++ R  I  LR      + SN   +N                     AH     G +    S ++VA + S  +     S +   SL S           F K  KK W RSS  K  +KK K+ D   M  I G                 SQ +  N       + IE LKQ+L+ERD  L + +L+ L  A +++ L+E +N ++ E       N++L+K V ++ + P                    A+S A+  V Y  E+  + A     +      S    SI   V   DI    SS+ +   ++++G   +  S S W  +D  I  LF+ YLS  D    LGI+  +SI  Y +G + +R I +     T  IT + +    D+      I++ +     +   +D+L  D L+PK ++ + V  +L  R ++L G +G GK+ LA  LA ++ IR +Q  S  ++   ++   + +EL      L  I    +S      C          +VILDN+   N +A +   F +  +QN   P+V+ T+ +  +    LQ HHNF+  + +N +E   GF+ RYLRR+ ++ E++   +    L   +++     Q +N F+E  +S DVT+GPR  L+CP++++GS+ WF  LWN + +PYL    R+G +TFGR +++EDP D + + WPW
Sbjct:  836 GSQLSLASTTAYGSLNE-KYEHAIRDMARDLECYKNTVDSLTKKQENYGALFDLFEQKLRKLTQHIDR----SNLKPEEAIRFRQDIAHLR------DISNHLASN--------------------SAHANEGAGELLRQPSLESVASHRSSMSSSSKSSKQEKISLSS-----------FGKN-KKSWIRSSLSKFTKKKNKNYDEAHMPSISG-----------------SQGTLDNI------DVIE-LKQELKERDSALYEVRLDNLDRAREVDVLRETVNKLKTE-------NKQLKKEVDKLTNGPATR-----------------ASSRASIPVIYDDEHVYDAACSSTSASQSSKRSSGCNSIKVTVNV-DIAGEISSIVNPDKEIIVGYLAMPTSQSCWKDIDVSILGLFEVYLSRIDVEHQLGIDARDSILGYQIGEL-RRVIGD----STTMITSHPT----DILTSSTTIRMFMHGAAQSR--VDSLVLDMLLPKQMILQLVKSILTERRLVLAGATGIGKSKLAKTLAAYVSIRTNQ--SEDSIVNISIPENNKEELLQVERRLEKILRSKES------C----------IVILDNIPK-NRIAFVVSVFANVPLQNNEGPFVVCTVNR--YQIPELQIHHNFKMSVMSNRLE---GFILRYLRRRAVEDEYRLTVQMPSELFKIIDFFPIALQAVNNFIEKTNSVDVTVGPRACLNCPLTVDGSREWFIRLWNENFIPYLERVARDGKKTFGRCTSFEDPTDIVSEKWPW 1492          

HSP 2 Score: 67.0106 bits (162), Expect = 1.464e-10
Identity = 36/106 (33.96%), Postives = 55/106 (51.89%), Query Frame = 3
Query:  276 LLTIYTEWANHYLEKAGFNNFVNDLQTDLCDGALLADII--IAVTGEKVPNTKPKPKTQIQQMENLNSCLIFLSNIGVVTEGIQSKDINDGNLKAILGLLFNLSRY 587
            L+ IYT+WAN +L K   +  + D+  D  D  L++ +I  I    E  P    +       ++ L +CL +L N+G+    +   DI+ GNL A+L LLF LS Y
Sbjct:    8 LIPIYTDWANRHLSKGSLSKSIRDISNDFRDYRLVSQLINVIVPINEFSPAFTKRLAKITSNLDGLETCLDYLKNLGLDCSKLTKTDIDSGNLGAVLQLLFLLSTY 113          
BLAST of Neuron navigator 2 vs. Ensembl Celegans
Match: unc-53 (Adapter protein unc-53 [Source:UniProtKB/Swiss-Prot;Acc:Q7YSI9])

HSP 1 Score: 216.083 bits (549), Expect = 3.643e-56
Identity = 218/785 (27.77%), Postives = 357/785 (45.48%), Query Frame = 3
Query: 2709 GSSLSLASNESRRSMSEDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGTNLNNDNHTTVSLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAFRKKFKHSD-VSMSDIEGDYYVHHLADNRSRISNDSQNSSKNFMLDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMV-RIESDPNEETNYNTGDEDSSAINDISATSTANKVVQYVSENTSNCASIDMFSHLFKFSSENEISIGAYVYFNDIIVSPSSVQHITNKVLIGSCHISES-STWSQLDSHIRCLFKEYLSFNDPFANLGINP-ESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKEL---RTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNR--PYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQ-EKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWI 5033
            GS LSLAS  +  S++E K    IR +  +LE  +  V +L+ + +    +   FE  L  +T+ + +    S  K  E ++ R  I  LR      + SN   +N                     AH     G +    S ++VA + S  +     S +   SL S           F K  KK W RSS  K  +KK K+ D   M  I G                 SQ +  N       + IE LKQ+L+ERD  L + +L+ L  A +++ L+E +N ++ E       N++L+K V ++ + P                    A+S A+  V Y  E+  + A     +      S    SI   V   DI    SS+ +   ++++G   +  S S W  +D  I  LF+ YLS  D    LGI+  +SI  Y +G + +R I +     T  IT + +    D+      I++ +     +   +D+L  D L+PK ++ + V  +L  R ++L G +G GK+ LA  LA ++ IR +Q  S  ++   ++   + +EL      L  I    +S      C          +VILDN+   N +A +   F +  +QN   P+V+ T+ +  +    LQ HHNF+  + +N +E   GF+ RYLRR+ ++ E++   +    L   +++     Q +N F+E  +S DVT+GPR  L+CP++++GS+ WF  LWN + +PYL    R+G +TFGR +++EDP D + + WPW 
Sbjct:  640 GSQLSLASTTAYGSLNE-KYEHAIRDMARDLECYKNTVDSLTKKQENYGALFDLFEQKLRKLTQHIDR----SNLKPEEAIRFRQDIAHLR------DISNHLASN--------------------SAHANEGAGELLRQPSLESVASHRSSMSSSSKSSKQEKISLSS-----------FGKN-KKSWIRSSLSKFTKKKNKNYDEAHMPSISG-----------------SQGTLDNI------DVIE-LKQELKERDSALYEVRLDNLDRAREVDVLRETVNKLKTE-------NKQLKKEVDKLTNGPATR-----------------ASSRASIPVIYDDEHVYDAACSSTSASQSSKRSSGCNSIKVTVNV-DIAGEISSIVNPDKEIIVGYLAMPTSQSCWKDIDVSILGLFEVYLSRIDVEHQLGIDARDSILGYQIGEL-RRVIGD----STTMITSHPT----DILTSSTTIRMFMHGAAQSR--VDSLVLDMLLPKQMILQLVKSILTERRLVLAGATGIGKSKLAKTLAAYVSIRTNQ--SEDSIVNISIPENNKEELLQVERRLEKILRSKES------C----------IVILDNIPK-NRIAFVVSVFANVPLQNNEGPFVVCTVNR--YQIPELQIHHNFKMSVMSNRLE---GFILRYLRRRAVEDEYRLTVQMPSELFKIIDFFPIALQAVNNFIEKTNSVDVTVGPRACLNCPLTVDGSREWFIRLWNENFIPYLERVARDGKKTFGRCTSFEDPTDIVSEKWPWF 1297          
BLAST of Neuron navigator 2 vs. Ensembl Celegans
Match: unc-53 (Adapter protein unc-53 [Source:UniProtKB/Swiss-Prot;Acc:Q7YSI9])

HSP 1 Score: 216.468 bits (550), Expect = 4.426e-56
Identity = 218/785 (27.77%), Postives = 357/785 (45.48%), Query Frame = 3
Query: 2709 GSSLSLASNESRRSMSEDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGTNLNNDNHTTVSLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAFRKKFKHSD-VSMSDIEGDYYVHHLADNRSRISNDSQNSSKNFMLDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMV-RIESDPNEETNYNTGDEDSSAINDISATSTANKVVQYVSENTSNCASIDMFSHLFKFSSENEISIGAYVYFNDIIVSPSSVQHITNKVLIGSCHISES-STWSQLDSHIRCLFKEYLSFNDPFANLGINP-ESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKEL---RTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNR--PYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQ-EKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWI 5033
            GS LSLAS  +  S++E K    IR +  +LE  +  V +L+ + +    +   FE  L  +T+ + +    S  K  E ++ R  I  LR      + SN   +N                     AH     G +    S ++VA + S  +     S +   SL S           F K  KK W RSS  K  +KK K+ D   M  I G                 SQ +  N       + IE LKQ+L+ERD  L + +L+ L  A +++ L+E +N ++ E       N++L+K V ++ + P                    A+S A+  V Y  E+  + A     +      S    SI   V   DI    SS+ +   ++++G   +  S S W  +D  I  LF+ YLS  D    LGI+  +SI  Y +G + +R I +     T  IT + +    D+      I++ +     +   +D+L  D L+PK ++ + V  +L  R ++L G +G GK+ LA  LA ++ IR +Q  S  ++   ++   + +EL      L  I    +S      C          +VILDN+   N +A +   F +  +QN   P+V+ T+ +  +    LQ HHNF+  + +N +E   GF+ RYLRR+ ++ E++   +    L   +++     Q +N F+E  +S DVT+GPR  L+CP++++GS+ WF  LWN + +PYL    R+G +TFGR +++EDP D + + WPW 
Sbjct:  877 GSQLSLASTTAYGSLNE-KYEHAIRDMARDLECYKNTVDSLTKKQENYGALFDLFEQKLRKLTQHIDR----SNLKPEEAIRFRQDIAHLR------DISNHLASN--------------------SAHANEGAGELLRQPSLESVASHRSSMSSSSKSSKQEKISLSS-----------FGKN-KKSWIRSSLSKFTKKKNKNYDEAHMPSISG-----------------SQGTLDNI------DVIE-LKQELKERDSALYEVRLDNLDRAREVDVLRETVNKLKTE-------NKQLKKEVDKLTNGPATR-----------------ASSRASIPVIYDDEHVYDAACSSTSASQSSKRSSGCNSIKVTVNV-DIAGEISSIVNPDKEIIVGYLAMPTSQSCWKDIDVSILGLFEVYLSRIDVEHQLGIDARDSILGYQIGEL-RRVIGD----STTMITSHPT----DILTSSTTIRMFMHGAAQSR--VDSLVLDMLLPKQMILQLVKSILTERRLVLAGATGIGKSKLAKTLAAYVSIRTNQ--SEDSIVNISIPENNKEELLQVERRLEKILRSKES------C----------IVILDNIPK-NRIAFVVSVFANVPLQNNEGPFVVCTVNR--YQIPELQIHHNFKMSVMSNRLE---GFILRYLRRRAVEDEYRLTVQMPSELFKIIDFFPIALQAVNNFIEKTNSVDVTVGPRACLNCPLTVDGSREWFIRLWNENFIPYLERVARDGKKTFGRCTSFEDPTDIVSEKWPWF 1534          

HSP 2 Score: 67.0106 bits (162), Expect = 1.412e-10
Identity = 36/106 (33.96%), Postives = 55/106 (51.89%), Query Frame = 3
Query:  276 LLTIYTEWANHYLEKAGFNNFVNDLQTDLCDGALLADII--IAVTGEKVPNTKPKPKTQIQQMENLNSCLIFLSNIGVVTEGIQSKDINDGNLKAILGLLFNLSRY 587
            L+ IYT+WAN +L K   +  + D+  D  D  L++ +I  I    E  P    +       ++ L +CL +L N+G+    +   DI+ GNL A+L LLF LS Y
Sbjct:    8 LIPIYTDWANRHLSKGSLSKSIRDISNDFRDYRLVSQLINVIVPINEFSPAFTKRLAKITSNLDGLETCLDYLKNLGLDCSKLTKTDIDSGNLGAVLQLLFLLSTY 113          
BLAST of Neuron navigator 2 vs. Ensembl Celegans
Match: unc-53 (Adapter protein unc-53 [Source:UniProtKB/Swiss-Prot;Acc:Q7YSI9])

HSP 1 Score: 215.312 bits (547), Expect = 4.822e-56
Identity = 218/785 (27.77%), Postives = 357/785 (45.48%), Query Frame = 3
Query: 2709 GSSLSLASNESRRSMSEDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGTNLNNDNHTTVSLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAFRKKFKHSD-VSMSDIEGDYYVHHLADNRSRISNDSQNSSKNFMLDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMV-RIESDPNEETNYNTGDEDSSAINDISATSTANKVVQYVSENTSNCASIDMFSHLFKFSSENEISIGAYVYFNDIIVSPSSVQHITNKVLIGSCHISES-STWSQLDSHIRCLFKEYLSFNDPFANLGINP-ESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKEL---RTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNR--PYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQ-EKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWI 5033
            GS LSLAS  +  S++E K    IR +  +LE  +  V +L+ + +    +   FE  L  +T+ + +    S  K  E ++ R  I  LR      + SN   +N                     AH     G +    S ++VA + S  +     S +   SL S           F K  KK W RSS  K  +KK K+ D   M  I G                 SQ +  N       + IE LKQ+L+ERD  L + +L+ L  A +++ L+E +N ++ E       N++L+K V ++ + P                    A+S A+  V Y  E+  + A     +      S    SI   V   DI    SS+ +   ++++G   +  S S W  +D  I  LF+ YLS  D    LGI+  +SI  Y +G + +R I +     T  IT + +    D+      I++ +     +   +D+L  D L+PK ++ + V  +L  R ++L G +G GK+ LA  LA ++ IR +Q  S  ++   ++   + +EL      L  I    +S      C          +VILDN+   N +A +   F +  +QN   P+V+ T+ +  +    LQ HHNF+  + +N +E   GF+ RYLRR+ ++ E++   +    L   +++     Q +N F+E  +S DVT+GPR  L+CP++++GS+ WF  LWN + +PYL    R+G +TFGR +++EDP D + + WPW 
Sbjct:  528 GSQLSLASTTAYGSLNE-KYEHAIRDMARDLECYKNTVDSLTKKQENYGALFDLFEQKLRKLTQHIDR----SNLKPEEAIRFRQDIAHLR------DISNHLASN--------------------SAHANEGAGELLRQPSLESVASHRSSMSSSSKSSKQEKISLSS-----------FGKN-KKSWIRSSLSKFTKKKNKNYDEAHMPSISG-----------------SQGTLDNI------DVIE-LKQELKERDSALYEVRLDNLDRAREVDVLRETVNKLKTE-------NKQLKKEVDKLTNGPATR-----------------ASSRASIPVIYDDEHVYDAACSSTSASQSSKRSSGCNSIKVTVNV-DIAGEISSIVNPDKEIIVGYLAMPTSQSCWKDIDVSILGLFEVYLSRIDVEHQLGIDARDSILGYQIGEL-RRVIGD----STTMITSHPT----DILTSSTTIRMFMHGAAQSR--VDSLVLDMLLPKQMILQLVKSILTERRLVLAGATGIGKSKLAKTLAAYVSIRTNQ--SEDSIVNISIPENNKEELLQVERRLEKILRSKES------C----------IVILDNIPK-NRIAFVVSVFANVPLQNNEGPFVVCTVNR--YQIPELQIHHNFKMSVMSNRLE---GFILRYLRRRAVEDEYRLTVQMPSELFKIIDFFPIALQAVNNFIEKTNSVDVTVGPRACLNCPLTVDGSREWFIRLWNENFIPYLERVARDGKKTFGRCTSFEDPTDIVSEKWPWF 1185          
BLAST of Neuron navigator 2 vs. Ensembl Fly
Match: sick (gene:FBgn0263873 transcript:FBtr0329844)

HSP 1 Score: 395.586 bits (1015), Expect = 1.178e-113
Identity = 214/492 (43.50%), Postives = 279/492 (56.71%), Query Frame = 3
Query: 3876 NKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNR-PYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSN-WEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDSQVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQEAANYS 5345
            N+ +I   +IS  +TW  LD  +R  FK+Y++  DP  NLG+N +SI  Y LG  ++       +     + P   I           + I L+        + +LAFD+LIP++++HRY+SLL EHR +ILCGPSGTGK+YLA +LA+ L+ R  +   S  +A F VDHKS+K+LR YL  IAEQ+  +   N    L     P V+ILDNLHH ++L ++F   LS+   N+ P +IGTM+QA+ + TNLQ HHNFRWVL ANHMEPVKGFLGR+LRR+L Q E Q +     L A + W+  VWQHIN+FLE HSSSDVTIGPRLFL+CPM ++ SQ+WFTD+WNY L PYL+EAVREG+Q +GRR   W DP  +I  ++PW                       G DS  PL    A    L         Q           QD                         PLLNML++LQEAANYS
Sbjct:  912 NEFVIACTYISGKTTWQNLDYVVRKTFKDYVARIDPGTNLGLNTDSITSYHLGEAKR-----GPEMGFPELLPCGYI-----VGSVRTLYICLQG-------VGSLAFDSLIPRSIVHRYISLLTEHRRLILCGPSGTGKSYLARRLAEFLVARSARGNPSEAIATFNVDHKSSKDLRQYLGHIAEQAAIA---NGVSEL-----PSVIILDNLHHASALGDVFSCLLSAGPANKLPCIIGTMSQATCNTTNLQLHHNFRWVLTANHMEPVKGFLGRFLRRRLFQLELQTQHPQPELAAVLAWLPSVWQHINRFLEVHSSSDVTIGPRLFLACPMDLKDSQVWFTDIWNYHLSPYLVEAVREGVQLYGRRGGAWNDPSAFIRNSYPW---------------------PYGPDSVPPLRQINAEDVGLEGVALTNGDQ-----------QD-------------------------PLLNMLMRLQEAANYS 1321          

HSP 2 Score: 125.176 bits (313), Expect = 3.929e-28
Identity = 104/304 (34.21%), Postives = 145/304 (47.70%), Query Frame = 3
Query: 2853 AHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGTNLNNDNHTTVSLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSIN-NIGLIG-------SSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAFRKKFKHSDVSMSD-------------IEGDYYVHH----------LADNRS-RISNDSQNSSKNFM--------LDA----SSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIES 3632
            AH+ +AFE SL N+T RL +L+ T+ERKD EL  +R  IE LR+Q             L   +  ++ +       V       +LG+   ++   N     +IN N G +        S++S  SL S   G S   D  K   KKGW RSSF KAF +  K S  S                  G   +H+          LA   +  + N  Q+S    +        +DA      + +E+LK+QL+E+DL LTD +LEALSSA QLE LKE++N MR EM +L+ +NERLQK+V   S
Sbjct:  447 AHVVTAFEQSLSNMTNRLHQLTATAERKDGELTDMRQTIELLRKQSIQ--------AGLTTAHMQSMGVQTQGQGQVQGQALGQALGQPGSDQKPPNSGSQRAINANNGSMPLGMQRQHSTDSMCSLNSISSGCSAAQDKNKANKKKGWLRSSFTKAFSRNAKISKTSRHVGHHHHHNHSQQELASGKLPLHNGHGEPLGLASLATQPAPPLPNSKQSSPAKTVTLIDNAKPIDAIDQEDQHVVEDLKKQLREKDLVLTDIRLEALSSASQLESLKEMMNKMRAEMMSLKHNNERLQKLVTTRS 742          
BLAST of Neuron navigator 2 vs. Ensembl Fly
Match: sick (gene:FBgn0263873 transcript:FBtr0329839)

HSP 1 Score: 395.586 bits (1015), Expect = 1.178e-113
Identity = 214/492 (43.50%), Postives = 279/492 (56.71%), Query Frame = 3
Query: 3876 NKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNR-PYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSN-WEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDSQVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQEAANYS 5345
            N+ +I   +IS  +TW  LD  +R  FK+Y++  DP  NLG+N +SI  Y LG  ++       +     + P   I           + I L+        + +LAFD+LIP++++HRY+SLL EHR +ILCGPSGTGK+YLA +LA+ L+ R  +   S  +A F VDHKS+K+LR YL  IAEQ+  +   N    L     P V+ILDNLHH ++L ++F   LS+   N+ P +IGTM+QA+ + TNLQ HHNFRWVL ANHMEPVKGFLGR+LRR+L Q E Q +     L A + W+  VWQHIN+FLE HSSSDVTIGPRLFL+CPM ++ SQ+WFTD+WNY L PYL+EAVREG+Q +GRR   W DP  +I  ++PW                       G DS  PL    A    L         Q           QD                         PLLNML++LQEAANYS
Sbjct:  912 NEFVIACTYISGKTTWQNLDYVVRKTFKDYVARIDPGTNLGLNTDSITSYHLGEAKR-----GPEMGFPELLPCGYI-----VGSVRTLYICLQG-------VGSLAFDSLIPRSIVHRYISLLTEHRRLILCGPSGTGKSYLARRLAEFLVARSARGNPSEAIATFNVDHKSSKDLRQYLGHIAEQAAIA---NGVSEL-----PSVIILDNLHHASALGDVFSCLLSAGPANKLPCIIGTMSQATCNTTNLQLHHNFRWVLTANHMEPVKGFLGRFLRRRLFQLELQTQHPQPELAAVLAWLPSVWQHINRFLEVHSSSDVTIGPRLFLACPMDLKDSQVWFTDIWNYHLSPYLVEAVREGVQLYGRRGGAWNDPSAFIRNSYPW---------------------PYGPDSVPPLRQINAEDVGLEGVALTNGDQ-----------QD-------------------------PLLNMLMRLQEAANYS 1321          

HSP 2 Score: 125.176 bits (313), Expect = 3.929e-28
Identity = 104/304 (34.21%), Postives = 145/304 (47.70%), Query Frame = 3
Query: 2853 AHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGTNLNNDNHTTVSLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSIN-NIGLIG-------SSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAFRKKFKHSDVSMSD-------------IEGDYYVHH----------LADNRS-RISNDSQNSSKNFM--------LDA----SSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIES 3632
            AH+ +AFE SL N+T RL +L+ T+ERKD EL  +R  IE LR+Q             L   +  ++ +       V       +LG+   ++   N     +IN N G +        S++S  SL S   G S   D  K   KKGW RSSF KAF +  K S  S                  G   +H+          LA   +  + N  Q+S    +        +DA      + +E+LK+QL+E+DL LTD +LEALSSA QLE LKE++N MR EM +L+ +NERLQK+V   S
Sbjct:  447 AHVVTAFEQSLSNMTNRLHQLTATAERKDGELTDMRQTIELLRKQSIQ--------AGLTTAHMQSMGVQTQGQGQVQGQALGQALGQPGSDQKPPNSGSQRAINANNGSMPLGMQRQHSTDSMCSLNSISSGCSAAQDKNKANKKKGWLRSSFTKAFSRNAKISKTSRHVGHHHHHNHSQQELASGKLPLHNGHGEPLGLASLATQPAPPLPNSKQSSPAKTVTLIDNAKPIDAIDQEDQHVVEDLKKQLREKDLVLTDIRLEALSSASQLESLKEMMNKMRAEMMSLKHNNERLQKLVTTRS 742          
BLAST of Neuron navigator 2 vs. Ensembl Fly
Match: sick (gene:FBgn0263873 transcript:FBtr0332236)

HSP 1 Score: 394.045 bits (1011), Expect = 5.431e-113
Identity = 212/492 (43.09%), Postives = 277/492 (56.30%), Query Frame = 3
Query: 3876 NKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNR-PYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSN-WEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDSQVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQEAANYS 5345
            N+ +I   +IS  +TW  LD  +R  FK+Y++  DP  NLG+N +SI  Y LG  ++       +     + P   I           + I L+        + +LAFD+LIP++++HRY+SLL EHR +ILCGPSGTGK+YLA +LA+ L+ R  +   S  +A F VDHKS+K+LR YL  IAEQ+  +   N    L     P V+ILDNLHH ++L ++F   LS+   N+ P +IGTM+QA+ + TNLQ HHNFRWVL ANHMEPVKGFLGR+LRR+L Q E Q +     L A + W+  VWQHIN+FLE HSSSDVTIGPRLFL+CPM ++ SQ+WFTD+WNY L PYL+EAVREG+Q +GRR   W DP  +I  ++PW                       G DS  PL    A    L         Q  P                                    LLNML++LQEAANYS
Sbjct:  935 NEFVIACTYISGKTTWQNLDYVVRKTFKDYVARIDPGTNLGLNTDSITSYHLGEAKR-----GPEMGFPELLPCGYI-----VGSVRTLYICLQG-------VGSLAFDSLIPRSIVHRYISLLTEHRRLILCGPSGTGKSYLARRLAEFLVARSARGNPSEAIATFNVDHKSSKDLRQYLGHIAEQAAIA---NGVSEL-----PSVIILDNLHHASALGDVFSCLLSAGPANKLPCIIGTMSQATCNTTNLQLHHNFRWVLTANHMEPVKGFLGRFLRRRLFQLELQTQHPQPELAAVLAWLPSVWQHINRFLEVHSSSDVTIGPRLFLACPMDLKDSQVWFTDIWNYHLSPYLVEAVREGVQLYGRRGGAWNDPSAFIRNSYPW---------------------PYGPDSVPPLRQINAEDVGLEGVALTNGDQQDP------------------------------------LLNMLMRLQEAANYS 1344          

HSP 2 Score: 159.073 bits (401), Expect = 1.708e-38
Identity = 126/354 (35.59%), Postives = 181/354 (51.13%), Query Frame = 3
Query: 2706 NGSSLSLASNESR-RSMSEDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGTNLNNDNHTTVSLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSIN-NIGLIG-------SSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAFRKKFKHSDVSMSD-------------IEGDYYVHH----------LADNRS-RISNDSQNSSKNFM--------LDA----SSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIES 3632
            +GS+ SL S  S     +E++Q+ EIR+L+ EL+ A+ +V++LSS+L TNAH+ +AFE SL N+T RL +L+ T+ERKD EL  +R  IE LR+Q             L   +  ++ +       V       +LG+   ++   N     +IN N G +        S++S  SL S   G S   D  K   KKGW RSSF KAF +  K S  S                  G   +H+          LA   +  + N  Q+S    +        +DA      + +E+LK+QL+E+DL LTD +LEALSSA QLE LKE++N MR EM +L+ +NERLQK+V   S
Sbjct:  420 HGSAASLLSGGSSLYGNAEERQAHEIRRLKRELQDARDQVLSLSSQLSTNAHVVTAFEQSLSNMTNRLHQLTATAERKDGELTDMRQTIELLRKQSIQ--------AGLTTAHMQSMGVQTQGQGQVQGQALGQALGQPGSDQKPPNSGSQRAINANNGSMPLGMQRQHSTDSMCSLNSISSGCSAAQDKNKANKKKGWLRSSFTKAFSRNAKISKTSRHVGHHHHHNHSQQELASGKLPLHNGHGEPLGLASLATQPAPPLPNSKQSSPAKTVTLIDNAKPIDAIDQEDQHVVEDLKKQLREKDLVLTDIRLEALSSASQLESLKEMMNKMRAEMMSLKHNNERLQKLVTTRS 765          
BLAST of Neuron navigator 2 vs. Ensembl Fly
Match: sick (gene:FBgn0263873 transcript:FBtr0329843)

HSP 1 Score: 397.512 bits (1020), Expect = 5.623e-112
Identity = 212/492 (43.09%), Postives = 277/492 (56.30%), Query Frame = 3
Query: 3876 NKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNR-PYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSN-WEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDSQVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQEAANYS 5345
            N+ +I   +IS  +TW  LD  +R  FK+Y++  DP  NLG+N +SI  Y LG  ++       +     + P   I           + I L+        + +LAFD+LIP++++HRY+SLL EHR +ILCGPSGTGK+YLA +LA+ L+ R  +   S  +A F VDHKS+K+LR YL  IAEQ+  +   N    L     P V+ILDNLHH ++L ++F   LS+   N+ P +IGTM+QA+ + TNLQ HHNFRWVL ANHMEPVKGFLGR+LRR+L Q E Q +     L A + W+  VWQHIN+FLE HSSSDVTIGPRLFL+CPM ++ SQ+WFTD+WNY L PYL+EAVREG+Q +GRR   W DP  +I  ++PW                       G DS  PL    A    L         Q  P                                    LLNML++LQEAANYS
Sbjct: 1584 NEFVIACTYISGKTTWQNLDYVVRKTFKDYVARIDPGTNLGLNTDSITSYHLGEAKR-----GPEMGFPELLPCGYI-----VGSVRTLYICLQG-------VGSLAFDSLIPRSIVHRYISLLTEHRRLILCGPSGTGKSYLARRLAEFLVARSARGNPSEAIATFNVDHKSSKDLRQYLGHIAEQAAIA---NGVSEL-----PSVIILDNLHHASALGDVFSCLLSAGPANKLPCIIGTMSQATCNTTNLQLHHNFRWVLTANHMEPVKGFLGRFLRRRLFQLELQTQHPQPELAAVLAWLPSVWQHINRFLEVHSSSDVTIGPRLFLACPMDLKDSQVWFTDIWNYHLSPYLVEAVREGVQLYGRRGGAWNDPSAFIRNSYPW---------------------PYGPDSVPPLRQINAEDVGLEGVALTNGDQQDP------------------------------------LLNMLMRLQEAANYS 1993          

HSP 2 Score: 160.999 bits (406), Expect = 5.476e-39
Identity = 130/372 (34.95%), Postives = 184/372 (49.46%), Query Frame = 3
Query: 2706 NGSSLSLASNESR-RSMSEDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGTNLNNDNHTTVSLGRSISATVSPAHFQN------------------SLGRVKGNESNKNVAEYDSIN-NIGLIG-------SSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAFRKKFKHSDVSMSD-------------IEGDYYVHH----------LADNRS-RISNDSQNSSKNFM--------LDA----SSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIES 3632
            +GS+ SL S  S     +E++Q+ EIR+L+ EL+ A+ +V++LSS+L TNAH+ +AFE SL N+T RL +L+ T+ERKD EL  +R  IE LR+Q                          SI A ++ AH Q+                  +LG+   ++   N     +IN N G +        S++S  SL S   G S   D  K   KKGW RSSF KAF +  K S  S                  G   +H+          LA   +  + N  Q+S    +        +DA      + +E+LK+QL+E+DL LTD +LEALSSA QLE LKE++N MR EM +L+ +NERLQK+V   S
Sbjct: 1069 HGSAASLLSGGSSLYGNAEERQAHEIRRLKRELQDARDQVLSLSSQLSTNAHVVTAFEQSLSNMTNRLHQLTATAERKDGELTDMRQTIELLRKQ--------------------------SIQAGLTTAHMQSMGVQTQGQGQVQGQALGQALGQPGSDQKPPNSGSQRAINANNGSMPLGMQRQHSTDSMCSLNSISSGCSAAQDKNKANKKKGWLRSSFTKAFSRNAKISKTSRHVGHHHHHNHSQQELASGKLPLHNGHGEPLGLASLATQPAPPLPNSKQSSPAKTVTLIDNAKPIDAIDQEDQHVVEDLKKQLREKDLVLTDIRLEALSSASQLESLKEMMNKMRAEMMSLKHNNERLQKLVTTRS 1414          
BLAST of Neuron navigator 2 vs. Ensembl Fly
Match: sick (gene:FBgn0263873 transcript:FBtr0329840)

HSP 1 Score: 397.512 bits (1020), Expect = 5.623e-112
Identity = 212/492 (43.09%), Postives = 277/492 (56.30%), Query Frame = 3
Query: 3876 NKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNR-PYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSN-WEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDSQVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQEAANYS 5345
            N+ +I   +IS  +TW  LD  +R  FK+Y++  DP  NLG+N +SI  Y LG  ++       +     + P   I           + I L+        + +LAFD+LIP++++HRY+SLL EHR +ILCGPSGTGK+YLA +LA+ L+ R  +   S  +A F VDHKS+K+LR YL  IAEQ+  +   N    L     P V+ILDNLHH ++L ++F   LS+   N+ P +IGTM+QA+ + TNLQ HHNFRWVL ANHMEPVKGFLGR+LRR+L Q E Q +     L A + W+  VWQHIN+FLE HSSSDVTIGPRLFL+CPM ++ SQ+WFTD+WNY L PYL+EAVREG+Q +GRR   W DP  +I  ++PW                       G DS  PL    A    L         Q  P                                    LLNML++LQEAANYS
Sbjct: 1584 NEFVIACTYISGKTTWQNLDYVVRKTFKDYVARIDPGTNLGLNTDSITSYHLGEAKR-----GPEMGFPELLPCGYI-----VGSVRTLYICLQG-------VGSLAFDSLIPRSIVHRYISLLTEHRRLILCGPSGTGKSYLARRLAEFLVARSARGNPSEAIATFNVDHKSSKDLRQYLGHIAEQAAIA---NGVSEL-----PSVIILDNLHHASALGDVFSCLLSAGPANKLPCIIGTMSQATCNTTNLQLHHNFRWVLTANHMEPVKGFLGRFLRRRLFQLELQTQHPQPELAAVLAWLPSVWQHINRFLEVHSSSDVTIGPRLFLACPMDLKDSQVWFTDIWNYHLSPYLVEAVREGVQLYGRRGGAWNDPSAFIRNSYPW---------------------PYGPDSVPPLRQINAEDVGLEGVALTNGDQQDP------------------------------------LLNMLMRLQEAANYS 1993          

HSP 2 Score: 160.999 bits (406), Expect = 5.476e-39
Identity = 130/372 (34.95%), Postives = 184/372 (49.46%), Query Frame = 3
Query: 2706 NGSSLSLASNESR-RSMSEDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGTNLNNDNHTTVSLGRSISATVSPAHFQN------------------SLGRVKGNESNKNVAEYDSIN-NIGLIG-------SSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAFRKKFKHSDVSMSD-------------IEGDYYVHH----------LADNRS-RISNDSQNSSKNFM--------LDA----SSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIES 3632
            +GS+ SL S  S     +E++Q+ EIR+L+ EL+ A+ +V++LSS+L TNAH+ +AFE SL N+T RL +L+ T+ERKD EL  +R  IE LR+Q                          SI A ++ AH Q+                  +LG+   ++   N     +IN N G +        S++S  SL S   G S   D  K   KKGW RSSF KAF +  K S  S                  G   +H+          LA   +  + N  Q+S    +        +DA      + +E+LK+QL+E+DL LTD +LEALSSA QLE LKE++N MR EM +L+ +NERLQK+V   S
Sbjct: 1069 HGSAASLLSGGSSLYGNAEERQAHEIRRLKRELQDARDQVLSLSSQLSTNAHVVTAFEQSLSNMTNRLHQLTATAERKDGELTDMRQTIELLRKQ--------------------------SIQAGLTTAHMQSMGVQTQGQGQVQGQALGQALGQPGSDQKPPNSGSQRAINANNGSMPLGMQRQHSTDSMCSLNSISSGCSAAQDKNKANKKKGWLRSSFTKAFSRNAKISKTSRHVGHHHHHNHSQQELASGKLPLHNGHGEPLGLASLATQPAPPLPNSKQSSPAKTVTLIDNAKPIDAIDQEDQHVVEDLKKQLREKDLVLTDIRLEALSSASQLESLKEMMNKMRAEMMSLKHNNERLQKLVTTRS 1414          
BLAST of Neuron navigator 2 vs. Ensembl Zebrafish
Match: nav2b (neuron navigator 2b [Source:ZFIN;Acc:ZDB-GENE-061207-13])

HSP 1 Score: 553.518 bits (1425), Expect = 2.718e-163
Identity = 343/893 (38.41%), Postives = 512/893 (57.33%), Query Frame = 3
Query: 2757 EDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGT---NLNNDNHTTVSLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAFRKKF------------KHSDVSMSDIEGDYYVHHLADNRSRISNDSQNSSKNFMLDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTANKVVQYVSENTSNCASIDMFSHLFKFSSENEISIGAYVYFNDIIVS----PSSVQHI-TNKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLV-CRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDSQVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQEAANYSTSPGSNDSD 5372
            E+K   EIRKLR EL+ +Q+KV  L+++L  NAH+ +AFE SL N+T RLQ L+ T+E+KD EL  LR  IE L++Q     NS  Q T    +N    T  S   S+ +       Q  LG  +   S+   +   + ++               + IGS+LE D   K+ KK W RSSF +AF KK             + +D S+       Y    A +   I N + NS  +  +D+ + T+  L+ +L+++++KLTD +LEALSSAHQL+QL+E +N M+ E+  L+ +N+RL    ++ES         +G   +S ++ IS +S        ++E+TS    +DM   L      +    G +V    ++VS    P   +    ++ L+G   +S  + W  LD  +R LFKEY+   DP   LG+N +++  Y++G + + S         D+ TP + +    L  E + I + L+   +++   D+LAF+TLIPK VL RY+S L EHR II  GPSGTGK++LA++LA+ +++R  +++   ++A F VD+K+ KEL+ YL+++A+Q         C+N+V     P+V+ILDNLHHV SLA+IF+  L+   Q+ PY+IGTM Q      NLQ HHNFRW+LCANH EPVKGFLGR+LRRKL++ E   +  +  L+  +EWI  VW H+N+FLE+HSSSDVTIGPRLFLSCPM +EGS++WFTDLWNYS++PY+LEAVREGLQ +GR+++WEDP  W+++++PW++S    +  +  SL+RLRPEDVG+D       T++   S             P  Q ++                         P  DPL+NML++L+E A+ + +  S DSD
Sbjct: 1354 EEKAQTEIRKLRRELDASQEKVSALTTQLSANAHLVAAFEQSLGNMTIRLQSLTTTAEQKDTELNDLRKTIELLKKQ-----NSATQATINGVINTPEPTLTSRKVSLDSINGSPQSQRELGIYRQPSSDSVSSMTSATSH---------------SSIGSNLELDSKNKKKKKNWLRSSFKQAFGKKKSPKSASSHSDIEEMTDSSLPSSPKLPYNGSTASS-PMIRNSNSNSLISECMDSDAETVMQLRSELRDKEMKLTDIRLEALSSAHQLDQLRESMNRMQIEVERLKVENDRL----KLES-------RGSGSRAASQMS-ISPSSVGLSSQLSLTESTS----LDML--LEDSGDGSSWKEGQHV---KVVVSLEKDPEWKEECRPSQFLLGCIGVSGKTKWEVLDGVVRRLFKEYIICVDPVTQLGLNTDTVMEYSIGDIHRAS---------DADTP-ELLPCGYLVGESDTISVRLKDLSVDSE--DSLAFETLIPKPVLQRYISQLEEHRRIIFSGPSGTGKSFLASRLAECMVLREGKQLDHQSIATFNVDNKTTKELKQYLSSLADQ---------CKNIVESADVPVVLILDNLHHVASLADIFNGLLNCKSQHCPYIIGTMNQTPSPTPNLQLHHNFRWILCANHTEPVKGFLGRFLRRKLLETEINSRVRNGELVKIIEWIPSVWHHLNRFLETHSSSDVTIGPRLFLSCPMDVEGSRVWFTDLWNYSIIPYMLEAVREGLQMYGRKASWEDPAKWVMESFPWVAS---PQQHEWHSLLRLRPEDVGFD-----GYTISQEGS-------------PGKQPAQ-----------------------GKPEEDPLMNMLLRLKETAHCAGTE-SYDSD 2138          

HSP 2 Score: 111.309 bits (277), Expect = 1.137e-23
Identity = 49/101 (48.51%), Postives = 72/101 (71.29%), Query Frame = 3
Query:  285 IYTEWANHYLEKAGFNNFVNDLQTDLCDGALLADIIIAVTGEKVPNTKPKPKTQIQQMENLNSCLIFLSNIGVVTEGIQSKDINDGNLKAILGLLFNLSRY 587
            IYT+WANHYL K+G    + DLQ D+ DG LLA+II  V  EK+ +    P+++ + +EN+++CL FL+  GV  +G+ +++I +GNLKAILGL F LSR+
Sbjct:   30 IYTDWANHYLAKSGHKRLIKDLQQDVADGVLLAEIIQVVANEKIADINGFPESRSEMIENIDACLGFLAAKGVNIKGLCAEEIRNGNLKAILGLFFILSRF 130          
BLAST of Neuron navigator 2 vs. Ensembl Zebrafish
Match: nav3 (neuron navigator 3 [Source:NCBI gene;Acc:567779])

HSP 1 Score: 518.85 bits (1335), Expect = 4.468e-151
Identity = 344/886 (38.83%), Postives = 472/886 (53.27%), Query Frame = 3
Query: 2775 EIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGTNLNNDNHTTVSLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAFRKKFKHSDVSMSDIEGDYYVHHLADNRSRISNDSQNSSKNFMLDASSNT------------IENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTANKVVQYVSENTSNCASIDMFSHLFKFSSENEI-----SIGAYVYFNDIIVSPSSVQHITNKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCR-SPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDSQVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQEAANYSTSPGSNDSDIA 5378
            +IRKLR EL+ +Q+KV TL+S+L  NAH+ +AFE SL N+T RLQ L+ T+E+K+ EL +LR  IE+L+ Q              N D  T + +     A   P H    L R++   S+++++  +S  +   +GS++                   KK+ KK W RSSF +AF KK  +   S  D   +     L  +   +    Q SS   +L + S T            I  LK +L+E++LKLTD +LEALSSAH L+Q++E +N M+ E+  L+A+N+RL+      S  N                  S +S++++    +S N  N     M   L     E  +     S+   V  N       ++Q    + LIGS  +S  + W  LD  IR LFKEY+   DP  +LG+N +SI  Y +G V +        +E   + P        L  + N I + L+  K  +  +D L FDTLIPK ++ RY++LL+EHR IIL GPSGTGK+YLA KLA  ++ +  +EV+ T LA F VD KS+K+LR YL+++AEQ         C    C    P VVILDNLHH+ SL++IF+ FL+      PYVIGTM Q   S+ NL+ HHNFRWVLCANH EPVKGFLGR+LRRKLI+ E  +    + L+  ++WI K+WQH+N FLE+HSSSDVTIGPRLFLSCPM  +GS++WFTDLWNYSLVPYLLEAVREGLQ  G+                              SL++LRPEDVGYD               S+ +   +S+ + QS                                DPL+NML++LQEAANYS++  S DSD A
Sbjct: 1505 QIRKLRRELDASQEKVATLTSQLAANAHLVAAFEKSLANMTCRLQSLTMTAEQKESELAELRETIEALKTQ--------------NTDAQTAIQV-----ALNGPDHVHRDL-RIRRQHSSESMSSINSAASHSSLGSAKDAED---------------KKKKKKSWLRSSFKQAFSKKKTNKPQSSHDEIEEMTDSSLPSSPKLLHISRQASSPQPLLSSPSTTELCECTEAEAEIILQLKNELREKELKLTDIRLEALSSAHHLDQIREAMNRMQNEIELLKAENDRLK------SSGNTTPAATPAKTARPPSETSSTSSSSSRQSLGLSLNNLNITDTIMSDILLDDGYEGNLRKEGRSVRIVVTINSDSNKTKAMQK--KQYLIGSIGVSGKTKWDVLDGVIRRLFKEYVFRVDPLTSLGMNSDSIVCYRMGDVVR-----SHASEVPELLPCGY-----LVGDNNVITVTLKGVKEGS--IDDLVFDTLIPKPIIQRYLNLLMEHRRIILSGPSGTGKSYLATKLAYFILSKTGREVTDTNLATFNVDQKSSKDLRQYLSSLAEQ---------CNTEECEIELPTVVILDNLHHIGSLSDIFNGFLNCKYHKCPYVIGTMNQGVSSSPNLELHHNFRWVLCANHTEPVKGFLGRFLRRKLIETEIDKNMRSNDLIKIIDWIPKIWQHLNSFLEAHSSSDVTIGPRLFLSCPMDADGSRVWFTDLWNYSLVPYLLEAVREGLQHEGQ------------------------------SLLQLRPEDVGYD-------------GYSSSKDGAASKQVSQSDT----------------------------EGDPLMNMLMRLQEAANYSSA-QSCDSDSA 2254          

HSP 2 Score: 108.612 bits (270), Expect = 6.372e-23
Identity = 49/112 (43.75%), Postives = 72/112 (64.29%), Query Frame = 3
Query:  252 SKTQQANALLTIYTEWANHYLEKAGFNNFVNDLQTDLCDGALLADIIIAVTGEKVPNTKPKPKTQIQQMENLNSCLIFLSNIGVVTEGIQSKDINDGNLKAILGLLFNLSRY 587
            S+  + + +  IYT+WANHYL K+G    + DL  D+ DG LLA+II  +  EK+ +    PK+  Q +EN+  CL FL   GV  +G+ ++++ +GNLK+ILGL F LSRY
Sbjct:   49 SREAEESKICKIYTDWANHYLAKSGCPRLIKDLTQDIPDGVLLAEIIQIIANEKIEDINSCPKSHSQMIENVECCLSFLGARGVSVQGLSAEEVCNGNLKSILGLFFILSRY 160          
BLAST of Neuron navigator 2 vs. Ensembl Zebrafish
Match: NAV1 (neuron navigator 1a [Source:NCBI gene;Acc:100536287])

HSP 1 Score: 394.815 bits (1013), Expect = 1.664e-112
Identity = 280/902 (31.04%), Postives = 462/902 (51.22%), Query Frame = 3
Query: 2691 DSSQNNGSSLSLASNESRRSMS--EDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGTNLNNDNHTTVSLGRSISATVSPAHFQ-NSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAFRKKFKHSDVSMSDIEGDYYVHHLADNRSRISNDSQNSSKNFMLDASSNT------IENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIES---DPNEETNYNTGDEDSSAINDISATSTANKVVQYVSENTSNCASIDMFS-HLFKFSSE-NEISIGAYVYFNDIIVSPSSVQHITNKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDSQVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQEAANYSTSP 5354
            D+   +GS LSL SN S    S  E  Q ++IRKLR ELE +Q+KV  L+++L  NA++ +AFE SL  +T RLQ LS ++E+KD EL++L+  IESL+ +        +    LNN +             V+P   +       +   S  ++  + S+ ++      +   S + +  G +      KK AK G   S       ++    D S  +       H   +N        Q++  + +L+++  T      +  L+ +L E+++KLTD +LEAL+SAHQLEQL+E +N+M+  +  L+A+N++L+      S        ++  +     +++   + T  A  + +  S + + C + D+    L   S + +E+     V   D  VS  + Q       IGS  I   + WS LDS I  +F++Y+S  DP A++G++ +SI  Y++   ++    E+ +N     +P        L+A    + + L+   L    +D+L F+TLIPK ++  Y+SLLL+HR ++L GPSGTGKTYL  +LA++L+ R  ++ SS  +  F +  ++ K+L+ YL+ +A Q       ++         P+V+ILD++    S+ +I +S L+      PYVIGT  Q+   ++N   H +FR +  +N++EP  GFL RYL RKLI+ E   K H+  +L  ++W+ K+W H++ FLE HS+SD  IGP  FLSCP+S+   + WF DLWN S++PYL E  ++G++  G+++ WEDPV+W+  T PW S+       D + L  L P                     + C +   +Q   QS   +  +D+ L ++                 +DPL+ ML+KLQE+ANY  SP
Sbjct:  666 DNDDVHGSVLSLVSNASSSYSSAEERMQGEQIRKLRRELESSQEKVACLTTQLSANANLVAAFEQSLALMTSRLQTLSFSAEQKDGELIELKETIESLKTKNMEAQAVIQ--VALNNPD-------------VAPKELRIRRQNSSESISSLNSITSHSSVGSLKDDAKKKKKKSWLRSSFGKAFS---IKKGAKGGSMYSDI-----EEIATPDSSAPN--SPKLAHEDGENPPPSLQSLQSAVSSVILESNEETESDEKVVSELRSELWEKEMKLTDIRLEALNSAHQLEQLREAMNSMQSMVENLKAENDQLKTGSAPSSLVLPCGPPSSSTSQPSGLASLMSSNQTKPAMSLTKSFSLSLNECFTADVAPVELLSASCQRDEVFTRVVVRIADHQVSREARQQ---DFYIGSVKIHGKTEWSTLDSDIATIFRDYISQLDPGASMGLSVDSIHSYSINQSRRVLGTEDPEN-----SPCDC-----LQAAPGLVTVTLKG--LKEKCVDSLVFETLIPKPMMQHYISLLLKHRRLVLSGPSGTGKTYLTTRLAEYLLERSGRDPSSGLINTFNMHQQTCKDLQLYLSNLANQIDRDCGTDDI--------PLVIILDDISDATSITDIVNSALTCKYHKCPYVIGTTNQSFKMSSNHGLHLSFRMITFSNNVEPANGFLVRYLHRKLIETENNSKAHNSEVLRVLDWVPKLWYHLHTFLEKHSTSDFLIGPCFFLSCPVSLAEFRTWFIDLWNQSIIPYLQEGAKDGVKVHGQKAAWEDPVEWVRDTLPWPSA-----QQDQAKLFHLPPP--------------------TTCPNTAPAQ---QSNDERSHRDTALPTM----------------ESDPLMAMLLKLQESANYIESP 1475          
BLAST of Neuron navigator 2 vs. Ensembl Zebrafish
Match: nav1b (neuron navigator 1b [Source:ZFIN;Acc:ZDB-GENE-120215-84])

HSP 1 Score: 394.43 bits (1012), Expect = 3.289e-111
Identity = 270/798 (33.83%), Postives = 416/798 (52.13%), Query Frame = 3
Query: 2706 NGSSLSLASNESRRSMSEDK-QSQEIRKLRHELEMAQQKVITLSSRLKTNAHMA---SAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGTNLNNDNHTTVSLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAFRKKFKHSDVSMSDIE----------GDYYVHHLADNR-SRISNDSQNSSKNFM-LDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTANKVVQYVSENTSNCASIDMFSHLFKFSS----ENEISIGAYVYFNDIIVSPSSVQHITNKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISS 5039
            +GS LSLASN S    +E++ Q ++IR LR ELE +Q KV  L+++L  NA  A   +AFE SL  +T RLQ LS TSE+KD EL  L+  IE L+ +              N +  T +       +T  P   +  + R   +ES  ++    S ++ G                  SL+    KK+ KK W RSSF KAF KK   +    +DIE              +HH  DN  ++ S  +  S       +     +  L+ +L E++ KLTD +LEALSSAHQLEQL+E +  M+  +  L+A+N++L+        P+  +        SS +  +  +S    V  +    T+     + +  +F   +    ++E  +   V   +  +    V+ +  +  IGS  IS  + W  LDS +   FKEYLS  DP ++LG++ +SI  Y+L  + KR +  +   ET  +  Y             Q  I +    L    +D L F+TL+PK ++  Y+SLLL+HR +IL GPSGTGKTYL  +LA++L+ R  +E++      F +  +S K+L+ YLA +A Q     D  +    +    P+VVILD++H   SL+E+ +  L+      PY+IGT  Q    + N   H +FR V  +N++EP  GFL RYL RKL++AE      ++ LL  ++W+ ++W H++ FLE HS+SD  IGP  FLSCP+++E  + WF DLWN+S++PYL E  ++G++  G++S WEDPV+W+  + PW S+
Sbjct:  991 HGSVLSLASNASSNYSNEERMQGEQIRILRRELESSQDKVANLTTQLAANAGQANLVAAFEQSLALMTARLQSLSVTSEQKDTELQDLKETIEVLKTK--------------NTEAQTLI---HGALSTPDPMPKELQIDRQNSSESISSLNSITSHSSAG------------------SLKEQEAKKKKKKSWLRSSFNKAFSKKGPKA--PYADIEEIATPEASAPSSPKIHHNVDNTFTKASTSTLGSCGGPEETERDEKVVSELRSELWEKERKLTDIRLEALSSAHQLEQLQEAMTNMQLTVENLKAENDQLKTGGPTSRPPSSTSQ-------SSGLGSLGVSSPRQSVSSF--SKTAGTGQTEPYPDVFHSPTSTLQKDESLVRVLVRIPNQQLFKDEVKQL--EFFIGSVRISGRTDWFSLDSAVIQAFKEYLSVVDPGSSLGLSQDSIYSYSLSHL-KRVLGAQPP-ETPPVRLYS----------RGQACITVALKGLKEKCVDVLVFETLVPKPMMQHYISLLLKHRRLILSGPSGTGKTYLTYRLAEYLVERSARELTPAITNTFNMHRQSCKDLQLYLANLANQ----IDRESSTAEI----PLVVILDDVHEPTSLSELVNGALTCKYHKCPYIIGTTNQPVKMSPNHGLHLSFRMVTFSNNVEPANGFLVRYLHRKLMEAEDPRSVTNEDLLRVLDWVPRLWYHLHTFLEKHSTSDFLIGPCFFLSCPVTVEDFRTWFIDLWNHSIIPYLQEGSKDGIKVHGQKSVWEDPVEWVRGSLPWPSA 1720          
BLAST of Neuron navigator 2 vs. Ensembl Zebrafish
Match: NAV1 (neuron navigator 1a [Source:NCBI gene;Acc:100536287])

HSP 1 Score: 390.963 bits (1003), Expect = 3.464e-111
Identity = 268/872 (30.73%), Postives = 447/872 (51.26%), Query Frame = 3
Query: 2775 EIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGTNLNNDNHTTVSLGRSISATVSPAHFQ-NSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAFRKKFKHSDVSMSDIEGDYYVHHLADNRSRISNDSQNSSKNFMLDASSNT------IENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIES---DPNEETNYNTGDEDSSAINDISATSTANKVVQYVSENTSNCASIDMFS-HLFKFSSE-NEISIGAYVYFNDIIVSPSSVQHITNKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDSQVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQEAANYSTSP 5354
            +IRKLR ELE +Q+KV  L+++L  NA++ +AFE SL  +T RLQ LS ++E+KD EL++L+  IESL+ +        +    LNN +             V+P   +       +   S  ++  + S+ ++      +   S + +  G +      KK AK G   S       ++    D S  +       H   +N        Q++  + +L+++  T      +  L+ +L E+++KLTD +LEAL+SAHQLEQL+E +N+M+  +  L+A+N++L+      S        ++  +     +++   + T  A  + +  S + + C + D+    L   S + +E+     V   D  VS  + Q       IGS  I   + WS LDS I  +F++Y+S  DP A++G++ +SI  Y++   ++    E+ +N     +P        L+A    + + L+   L    +D+L F+TLIPK ++  Y+SLLL+HR ++L GPSGTGKTYL  +LA++L+ R  ++ SS  +  F +  ++ K+L+ YL+ +A Q       ++         P+V+ILD++    S+ +I +S L+      PYVIGT  Q+   ++N   H +FR +  +N++EP  GFL RYL RKLI+ E   K H+  +L  ++W+ K+W H++ FLE HS+SD  IGP  FLSCP+S+   + WF DLWN S++PYL E  ++G++  G+++ WEDPV+W+  T PW S+       D + L  L P                     + C +   +Q   QS   +  +D+ L ++                 +DPL+ ML+KLQE+ANY  SP
Sbjct:  688 QIRKLRRELESSQEKVACLTTQLSANANLVAAFEQSLALMTSRLQTLSFSAEQKDGELIELKETIESLKTKNMEAQAVIQ--VALNNPD-------------VAPKELRIRRQNSSESISSLNSITSHSSVGSLKDDAKKKKKKSWLRSSFGKAFS---IKKGAKGGSMYSDI-----EEIATPDSSAPN--SPKLAHEDGENPPPSLQSLQSAVSSVILESNEETESDEKVVSELRSELWEKEMKLTDIRLEALNSAHQLEQLREAMNSMQSMVENLKAENDQLKTGSAPSSLVLPCGPPSSSTSQPSGLASLMSSNQTKPAMSLTKSFSLSLNECFTADVAPVELLSASCQRDEVFTRVVVRIADHQVSREARQQ---DFYIGSVKIHGKTEWSTLDSDIATIFRDYISQLDPGASMGLSVDSIHSYSINQSRRVLGTEDPEN-----SPCDC-----LQAAPGLVTVTLKG--LKEKCVDSLVFETLIPKPMMQHYISLLLKHRRLVLSGPSGTGKTYLTTRLAEYLLERSGRDPSSGLINTFNMHQQTCKDLQLYLSNLANQIDRDCGTDDI--------PLVIILDDISDATSITDIVNSALTCKYHKCPYVIGTTNQSFKMSSNHGLHLSFRMITFSNNVEPANGFLVRYLHRKLIETENNSKAHNSEVLRVLDWVPKLWYHLHTFLEKHSTSDFLIGPCFFLSCPVSLAEFRTWFIDLWNQSIIPYLQEGAKDGVKVHGQKAAWEDPVEWVRDTLPWPSA-----QQDQAKLFHLPPP--------------------TTCPNTAPAQ---QSNDERSHRDTALPTM----------------ESDPLMAMLLKLQESANYIESP 1467          
BLAST of Neuron navigator 2 vs. Ensembl Xenopus
Match: npffr1.1 (neuropeptide FF receptor 1, gene 1 [Source:Xenbase;Acc:XB-GENE-987767])

HSP 1 Score: 551.206 bits (1419), Expect = 4.047e-162
Identity = 342/892 (38.34%), Postives = 499/892 (55.94%), Query Frame = 3
Query: 2757 EDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGTNLNNDNHTTVSLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAFRKK------FKHSDV---SMSDIEGDYYVHHLADNRSRISNDSQNSSKNFM--LDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQ-------KMVRIESDPNEETNYNTGDEDSSAINDISAT--STANKVVQYVSENTSNCASIDMFSHLFKFSSENEISIGAYVYFNDIIVSPSSVQHITNKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDSQVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQEAANYSTSPGSNDSD 5372
            E   S++I+KLR EL  +Q+KV TL+S+L  N+H+ +AFE SL N+T RLQ L+ T+E+K+ EL +L+  IE L+ Q             LN  +H+               H    + R   +ES  ++    S ++IG +  +ES                         W RSSF +AF KK        HSD+   + S +     + H  D+   +S     SS +     +A +  I  LK +L+E++LKLTD +LEALSSAH L+Q++E +N M+ E+  L+A+N+RL+       K VR  S+ +  T+ ++      ++N+++ +  STA+ ++             DM    F+       S+   V  N         +  +   LIGS  +S  + W  LD+ IR L+KEY+   DP ANLG+  +SI  Y +G + +      + +E   + P        L    N I + L+  + N+  LD+  FDTLIPK +  RY++LL+EH  IIL GPSGTGKTYLANKLA+++I +  ++     +A F VDHKS+KELR YLA +A+Q  +  D +          P+V+ILDNLHH+ SL++IF+ FL+      PY+IGTM Q+  S+ NL+ HHNFRWVLC+NH +PVKGFLGR LRRKLI+ E ++   ++ L+  +EWI K W HIN FLE+HSSSDVTIGPRLFLSCPM ++GS+IW+TDLWNYS++PYLLEAVREGLQ +G+R+ WEDP  W+L+T+PW +S+ +  +    +L++LRPEDVGYD               +  +  T+S+ + QS+                               DPL+NML++LQEAAN+S++  S DSD
Sbjct: 1445 EKAHSEQIQKLRRELVASQEKVATLTSQLSANSHLVAAFEKSLGNMTGRLQSLTMTAEQKESELTELKETIEMLKTQ--NAAAQAAIQGALNGSDHS---------------HKDMRIRRQHSSESVSSINSATSHSSIGSVNDAESKKKKKKN------------------WLRSSFKQAFGKKKSNKPPSSHSDIEELTDSSVPSSPKLQHNGDDAGSLSLKLSQSSTDICECTEAEAEIILQLKGELREKELKLTDIRLEALSSAHHLDQIREAMNRMQNEIEILKAENDRLKAETSSPGKTVRPSSESSSCTSSSSRQSLGLSLNNLNVSDHSTADNILD------------DMRDGAFQKEGR---SVKIVVSINKGFGRRKDAK--SRFYLIGSIGVSGKTKWDVLDAVIRRLYKEYIYRVDPAANLGLTSDSISSYCIGDIVR-----ANNSEVPEMLPCGY-----LVGANNTITVNLKGLEENS--LDSFVFDTLIPKPITQRYINLLMEHHRIILSGPSGTGKTYLANKLAEYVINKSGRKKIEEAVATFNVDHKSSKELRQYLANLADQCSADNDIDL---------PLVIILDNLHHIGSLSDIFNGFLNCKYSKCPYIIGTMNQSISSSPNLELHHNFRWVLCSNHTDPVKGFLGRCLRRKLIETEIEQNMRNNDLIKIIEWIPKAWHHINGFLETHSSSDVTIGPRLFLSCPMDVDGSKIWYTDLWNYSVIPYLLEAVREGLQMYGKRAPWEDPSKWVLETFPWSTSSSQQES---PALLQLRPEDVGYD-------------GYATAKEGTTSKNVSQSEK----------------------------EGDPLMNMLMRLQEAANFSSAQ-SCDSD 2218          

HSP 2 Score: 116.316 bits (290), Expect = 4.419e-25
Identity = 56/126 (44.44%), Postives = 81/126 (64.29%), Query Frame = 3
Query:  210 DVENEMKFDSENSISKTQQANALLTIYTEWANHYLEKAGFNNFVNDLQTDLCDGALLADIIIAVTGEKVPNTKPKPKTQIQQMENLNSCLIFLSNIGVVTEGIQSKDINDGNLKAILGLLFNLSRY 587
            D+ +EM    +N I    +      IYT+WANHYL K+G    + DLQ D+ DG LLA+II  +  EK+ +    PK+Q Q +EN++ CL FL+  GV  +G+ +++I +GNLKAILGL F+LSR+
Sbjct:    2 DLSSEMSKHGKNPIGHKLEDQK--KIYTDWANHYLTKSGHKRLIKDLQQDIADGVLLAEIIQIIANEKIEDINGCPKSQSQMIENVDVCLNFLAVRGVNVQGLSAEEIRNGNLKAILGLFFSLSRF 125          
BLAST of Neuron navigator 2 vs. Ensembl Xenopus
Match: npffr1.1 (neuropeptide FF receptor 1, gene 1 [Source:Xenbase;Acc:XB-GENE-987767])

HSP 1 Score: 550.821 bits (1418), Expect = 5.914e-162
Identity = 342/892 (38.34%), Postives = 499/892 (55.94%), Query Frame = 3
Query: 2757 EDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGTNLNNDNHTTVSLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAFRKK------FKHSDV---SMSDIEGDYYVHHLADNRSRISNDSQNSSKNFM--LDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQ-------KMVRIESDPNEETNYNTGDEDSSAINDISAT--STANKVVQYVSENTSNCASIDMFSHLFKFSSENEISIGAYVYFNDIIVSPSSVQHITNKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDSQVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQEAANYSTSPGSNDSD 5372
            E   S++I+KLR EL  +Q+KV TL+S+L  N+H+ +AFE SL N+T RLQ L+ T+E+K+ EL +L+  IE L+ Q             LN  +H+               H    + R   +ES  ++    S ++IG +  +ES                         W RSSF +AF KK        HSD+   + S +     + H  D+   +S     SS +     +A +  I  LK +L+E++LKLTD +LEALSSAH L+Q++E +N M+ E+  L+A+N+RL+       K VR  S+ +  T+ ++      ++N+++ +  STA+ ++             DM    F+       S+   V  N         +  +   LIGS  +S  + W  LD+ IR L+KEY+   DP ANLG+  +SI  Y +G + +      + +E   + P        L    N I + L+  + N+  LD+  FDTLIPK +  RY++LL+EH  IIL GPSGTGKTYLANKLA+++I +  ++     +A F VDHKS+KELR YLA +A+Q  +  D +          P+V+ILDNLHH+ SL++IF+ FL+      PY+IGTM Q+  S+ NL+ HHNFRWVLC+NH +PVKGFLGR LRRKLI+ E ++   ++ L+  +EWI K W HIN FLE+HSSSDVTIGPRLFLSCPM ++GS+IW+TDLWNYS++PYLLEAVREGLQ +G+R+ WEDP  W+L+T+PW +S+ +  +    +L++LRPEDVGYD               +  +  T+S+ + QS+                               DPL+NML++LQEAAN+S++  S DSD
Sbjct: 1447 EKAHSEQIQKLRRELVASQEKVATLTSQLSANSHLVAAFEKSLGNMTGRLQSLTMTAEQKESELTELKETIEMLKTQ--NAAAQAAIQGALNGSDHS---------------HKDMRIRRQHSSESVSSINSATSHSSIGSVNDAESKKKKKKN------------------WLRSSFKQAFGKKKSNKPPSSHSDIEELTDSSVPSSPKLQHNGDDAGSLSLKLSQSSTDICECTEAEAEIILQLKGELREKELKLTDIRLEALSSAHHLDQIREAMNRMQNEIEILKAENDRLKAETSSPGKTVRPSSESSSCTSSSSRQSLGLSLNNLNVSDHSTADNILD------------DMRDGAFQKEGR---SVKIVVSINKGFGRRKDAK--SRFYLIGSIGVSGKTKWDVLDAVIRRLYKEYIYRVDPAANLGLTSDSISSYCIGDIVR-----ANNSEVPEMLPCGY-----LVGANNTITVNLKGLEENS--LDSFVFDTLIPKPITQRYINLLMEHHRIILSGPSGTGKTYLANKLAEYVINKSGRKKIEEAVATFNVDHKSSKELRQYLANLADQCSADNDIDL---------PLVIILDNLHHIGSLSDIFNGFLNCKYSKCPYIIGTMNQSISSSPNLELHHNFRWVLCSNHTDPVKGFLGRCLRRKLIETEIEQNMRNNDLIKIIEWIPKAWHHINGFLETHSSSDVTIGPRLFLSCPMDVDGSKIWYTDLWNYSVIPYLLEAVREGLQMYGKRAPWEDPSKWVLETFPWSTSSSQQES---PALLQLRPEDVGYD-------------GYATAKEGTTSKNVSQSEK----------------------------EGDPLMNMLMRLQEAANFSSAQ-SCDSD 2220          

HSP 2 Score: 116.316 bits (290), Expect = 3.962e-25
Identity = 56/126 (44.44%), Postives = 81/126 (64.29%), Query Frame = 3
Query:  210 DVENEMKFDSENSISKTQQANALLTIYTEWANHYLEKAGFNNFVNDLQTDLCDGALLADIIIAVTGEKVPNTKPKPKTQIQQMENLNSCLIFLSNIGVVTEGIQSKDINDGNLKAILGLLFNLSRY 587
            D+ +EM    +N I    +      IYT+WANHYL K+G    + DLQ D+ DG LLA+II  +  EK+ +    PK+Q Q +EN++ CL FL+  GV  +G+ +++I +GNLKAILGL F+LSR+
Sbjct:    2 DLSSEMSKHGKNPIGHKLEDQK--KIYTDWANHYLTKSGHKRLIKDLQQDIADGVLLAEIIQIIANEKIEDINGCPKSQSQMIENVDVCLNFLAVRGVNVQGLSAEEIRNGNLKAILGLFFSLSRF 125          
BLAST of Neuron navigator 2 vs. Ensembl Xenopus
Match: npffr1.1 (neuropeptide FF receptor 1, gene 1 [Source:Xenbase;Acc:XB-GENE-987767])

HSP 1 Score: 551.206 bits (1419), Expect = 5.947e-162
Identity = 342/892 (38.34%), Postives = 499/892 (55.94%), Query Frame = 3
Query: 2757 EDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGTNLNNDNHTTVSLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAFRKK------FKHSDV---SMSDIEGDYYVHHLADNRSRISNDSQNSSKNFM--LDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQ-------KMVRIESDPNEETNYNTGDEDSSAINDISAT--STANKVVQYVSENTSNCASIDMFSHLFKFSSENEISIGAYVYFNDIIVSPSSVQHITNKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDSQVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQEAANYSTSPGSNDSD 5372
            E   S++I+KLR EL  +Q+KV TL+S+L  N+H+ +AFE SL N+T RLQ L+ T+E+K+ EL +L+  IE L+ Q             LN  +H+               H    + R   +ES  ++    S ++IG +  +ES                         W RSSF +AF KK        HSD+   + S +     + H  D+   +S     SS +     +A +  I  LK +L+E++LKLTD +LEALSSAH L+Q++E +N M+ E+  L+A+N+RL+       K VR  S+ +  T+ ++      ++N+++ +  STA+ ++             DM    F+       S+   V  N         +  +   LIGS  +S  + W  LD+ IR L+KEY+   DP ANLG+  +SI  Y +G + +      + +E   + P        L    N I + L+  + N+  LD+  FDTLIPK +  RY++LL+EH  IIL GPSGTGKTYLANKLA+++I +  ++     +A F VDHKS+KELR YLA +A+Q  +  D +          P+V+ILDNLHH+ SL++IF+ FL+      PY+IGTM Q+  S+ NL+ HHNFRWVLC+NH +PVKGFLGR LRRKLI+ E ++   ++ L+  +EWI K W HIN FLE+HSSSDVTIGPRLFLSCPM ++GS+IW+TDLWNYS++PYLLEAVREGLQ +G+R+ WEDP  W+L+T+PW +S+ +  +    +L++LRPEDVGYD               +  +  T+S+ + QS+                               DPL+NML++LQEAAN+S++  S DSD
Sbjct: 1468 EKAHSEQIQKLRRELVASQEKVATLTSQLSANSHLVAAFEKSLGNMTGRLQSLTMTAEQKESELTELKETIEMLKTQ--NAAAQAAIQGALNGSDHS---------------HKDMRIRRQHSSESVSSINSATSHSSIGSVNDAESKKKKKKN------------------WLRSSFKQAFGKKKSNKPPSSHSDIEELTDSSVPSSPKLQHNGDDAGSLSLKLSQSSTDICECTEAEAEIILQLKGELREKELKLTDIRLEALSSAHHLDQIREAMNRMQNEIEILKAENDRLKAETSSPGKTVRPSSESSSCTSSSSRQSLGLSLNNLNVSDHSTADNILD------------DMRDGAFQKEGR---SVKIVVSINKGFGRRKDAK--SRFYLIGSIGVSGKTKWDVLDAVIRRLYKEYIYRVDPAANLGLTSDSISSYCIGDIVR-----ANNSEVPEMLPCGY-----LVGANNTITVNLKGLEENS--LDSFVFDTLIPKPITQRYINLLMEHHRIILSGPSGTGKTYLANKLAEYVINKSGRKKIEEAVATFNVDHKSSKELRQYLANLADQCSADNDIDL---------PLVIILDNLHHIGSLSDIFNGFLNCKYSKCPYIIGTMNQSISSSPNLELHHNFRWVLCSNHTDPVKGFLGRCLRRKLIETEIEQNMRNNDLIKIIEWIPKAWHHINGFLETHSSSDVTIGPRLFLSCPMDVDGSKIWYTDLWNYSVIPYLLEAVREGLQMYGKRAPWEDPSKWVLETFPWSTSSSQQES---PALLQLRPEDVGYD-------------GYATAKEGTTSKNVSQSEK----------------------------EGDPLMNMLMRLQEAANFSSAQ-SCDSD 2241          

HSP 2 Score: 116.316 bits (290), Expect = 4.143e-25
Identity = 56/126 (44.44%), Postives = 81/126 (64.29%), Query Frame = 3
Query:  210 DVENEMKFDSENSISKTQQANALLTIYTEWANHYLEKAGFNNFVNDLQTDLCDGALLADIIIAVTGEKVPNTKPKPKTQIQQMENLNSCLIFLSNIGVVTEGIQSKDINDGNLKAILGLLFNLSRY 587
            D+ +EM    +N I    +      IYT+WANHYL K+G    + DLQ D+ DG LLA+II  +  EK+ +    PK+Q Q +EN++ CL FL+  GV  +G+ +++I +GNLKAILGL F+LSR+
Sbjct:    2 DLSSEMSKHGKNPIGHKLEDQK--KIYTDWANHYLTKSGHKRLIKDLQQDIADGVLLAEIIQIIANEKIEDINGCPKSQSQMIENVDVCLNFLAVRGVNVQGLSAEEIRNGNLKAILGLFFSLSRF 125          
BLAST of Neuron navigator 2 vs. Ensembl Xenopus
Match: npffr1.1 (neuropeptide FF receptor 1, gene 1 [Source:Xenbase;Acc:XB-GENE-987767])

HSP 1 Score: 542.347 bits (1396), Expect = 6.469e-159
Identity = 341/886 (38.49%), Postives = 499/886 (56.32%), Query Frame = 3
Query: 2775 EIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGTNLNNDNHTTVSLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAFRKK------FKHSDV---SMSDIEGDYYVHHLADNRSRISNDSQNSSKNFM--LDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQ-------KMVRIESDPNEETNYNTGDEDSSAINDISAT--STANKVVQYVSENTSNCASIDMFSHLFKFSSENEISIGAYVYFNDIIVSPSSVQHITNKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDSQVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQEAANYSTSPGSNDSD 5372
            +I+KLR EL  +Q+KV TL+S+L  N+H+ +AFE SL N+T RLQ L+ T+E+K+ EL +L+  IE L+ Q             LN  +H+               H    + R   +ES  ++    S ++IG +  +ES        +   +    FK        RSSF +AF KK        HSD+   + S +     + H  D+   +S     SS +     +A +  I  LK +L+E++LKLTD +LEALSSAH L+Q++E +N M+ E+  L+A+N+RL+       K VR  S+ +  T+ ++      ++N+++ +  STA+ ++             DM    F+       S+   V  N         +  +   LIGS  +S  + W  LD+ IR L+KEY+   DP ANLG+  +SI  Y +G + +      + +E   + P        L    N I + L+  + N+  LD+  FDTLIPK +  RY++LL+EH  IIL GPSGTGKTYLANKLA+++I +  ++     +A F VDHKS+KELR YLA +A+Q  +  D +          P+V+ILDNLHH+ SL++IF+ FL+      PY+IGTM Q+  S+ NL+ HHNFRWVLC+NH +PVKGFLGR LRRKLI+ E ++   ++ L+  +EWI K W HIN FLE+HSSSDVTIGPRLFLSCPM ++GS+IW+TDLWNYS++PYLLEAVREGLQ +G+R+ WEDP  W+L+T+PW +S+ +  +    +L++LRPEDVGYD               +  +  T+S+ + QS+                               DPL+NML++LQEAAN+S++  S DSD
Sbjct: 1486 QIQKLRRELVASQEKVATLTSQLSANSHLVAAFEKSLGNMTGRLQSLTMTAEQKESELTELKETIEMLKTQ--NAAAQAAIQGALNGSDHS---------------HKDMRIRRQHSSESVSSINSATSHSSIGSVNDAESKKKKKKNWVMCLV----FK-------LRSSFKQAFGKKKSNKPPSSHSDIEELTDSSVPSSPKLQHNGDDAGSLSLKLSQSSTDICECTEAEAEIILQLKGELREKELKLTDIRLEALSSAHHLDQIREAMNRMQNEIEILKAENDRLKAETSSPGKTVRPSSESSSCTSSSSRQSLGLSLNNLNVSDHSTADNILD------------DMRDGAFQKEGR---SVKIVVSINKGFGRRKDAK--SRFYLIGSIGVSGKTKWDVLDAVIRRLYKEYIYRVDPAANLGLTSDSISSYCIGDIVR-----ANNSEVPEMLPCGY-----LVGANNTITVNLKGLEENS--LDSFVFDTLIPKPITQRYINLLMEHHRIILSGPSGTGKTYLANKLAEYVINKSGRKKIEEAVATFNVDHKSSKELRQYLANLADQCSADNDIDL---------PLVIILDNLHHIGSLSDIFNGFLNCKYSKCPYIIGTMNQSISSSPNLELHHNFRWVLCSNHTDPVKGFLGRCLRRKLIETEIEQNMRNNDLIKIIEWIPKAWHHINGFLETHSSSDVTIGPRLFLSCPMDVDGSKIWYTDLWNYSVIPYLLEAVREGLQMYGKRAPWEDPSKWVLETFPWSTSSSQQES---PALLQLRPEDVGYD-------------GYATAKEGTTSKNVSQSEK----------------------------EGDPLMNMLMRLQEAANFSSAQ-SCDSD 2260          

HSP 2 Score: 75.8702 bits (185), Expect = 7.461e-13
Identity = 49/136 (36.03%), Postives = 69/136 (50.74%), Query Frame = 3
Query:  180 QASLLNECKEDVENEMKFDSENSISKTQQANALLTIYTEWANHYLEKAGFNNFVNDLQTDLCDGALLADIIIAVTGEKVPNTKPKPKTQIQQMENLNSCLIFLSNIGVVTEGIQSKDINDGNLKAILGLLFNLSRY 587
            Q  L + C  D+E++ +   + SI +T+ +     IYT+WANHYL K+G    + DLQ D+ DG LLA+II                  I +  N+N     LS            +I +GNLKAILGL F+LSR+
Sbjct:   55 QLPLKSSC--DLEDKKRL--QGSIKETEDSK----IYTDWANHYLTKSGHKRLIKDLQQDIADGVLLAEIIQI----------------IGKWLNINHFFSSLS------------EIRNGNLKAILGLFFSLSRF 154          
BLAST of Neuron navigator 2 vs. Ensembl Xenopus
Match: npffr1.1 (neuropeptide FF receptor 1, gene 1 [Source:Xenbase;Acc:XB-GENE-987767])

HSP 1 Score: 535.798 bits (1379), Expect = 1.274e-156
Identity = 344/917 (37.51%), Postives = 497/917 (54.20%), Query Frame = 3
Query: 2775 EIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGTNLNNDNHTTVSLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAF-RKKFKHSDVSMSDIE----------------GD------------------YYV-------HHLADNRSRISNDSQNSSKNFMLDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQ-------KMVRIESDPNEETNYNTGDEDSSAINDISAT--STANKVVQYVSENTSNCASIDMFSHLFKFSSENEISIGAYVYFNDIIVSPSSVQHITNKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDSQVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQEAANYSTSPGSNDSD 5372
            +I+KLR EL  +Q+KV TL+S+L  N+H+ +AFE SL N+T RLQ L+ T+E+K+ EL +L+  IE L+ Q             LN  +H+               H    + R   +ES  ++    S ++IG +  +ES        +   +    FK        RSSF +AF +KK      S SDIE                GD                  ++V       H +  +RSRI             +A +  I  LK +L+E++LKLTD +LEALSSAH L+Q++E +N M+ E+  L+A+N+RL+       K VR  S+ +  T+ ++      ++N+++ +  STA+   Q    +     SI+       F    +     Y                    LIGS  +S  + W  LD+ IR L+KEY+   DP ANLG+  +SI  Y +G + +      + +E   + P        L    N I + L+  + N+  LD+  FDTLIPK +  RY++LL+EH  IIL GPSGTGKTYLANKLA+++I +  ++     +A F VDHKS+KELR YLA +A+Q  +  D +          P+V+ILDNLHH+ SL++IF+ FL+      PY+IGTM Q+  S+ NL+ HHNFRWVLC+NH +PVKGFLGR LRRKLI+ E ++   ++ L+  +EWI K W HIN FLE+HSSSDVTIGPRLFLSCPM ++GS+IW+TDLWNYS++PYLLEAVREGLQ +G+R+ WEDP  W+L+T+PW +S+ +  +    +L++LRPEDVGYD               +  +  T+S+ + QS+                               DPL+NML++LQEAAN+S++  S DSD
Sbjct: 1501 QIQKLRRELVASQEKVATLTSQLSANSHLVAAFEKSLGNMTGRLQSLTMTAEQKESELTELKETIEMLKTQ--NAAAQAAIQGALNGSDHS---------------HKDMRIRRQHSSESVSSINSATSHSSIGSVNDAESKKKKKKNWVMCLV----FK-------LRSSFKQAFGKKKSNKPPSSHSDIEELTDSSVPSSPKLQHNGDDAGSLSLKLSQSSTESSLFWVPKKRQNGHVIYKHRSRICE---------CTEAEAEIILQLKGELREKELKLTDIRLEALSSAHHLDQIREAMNRMQNEIEILKAENDRLKAETSSPGKTVRPSSESSSCTSSSSRQSLGLSLNNLNVSDHSTADGAFQKEGRSVKIVVSINK-----GFGRRKDAKSRFY--------------------LIGSIGVSGKTKWDVLDAVIRRLYKEYIYRVDPAANLGLTSDSISSYCIGDIVR-----ANNSEVPEMLPCGY-----LVGANNTITVNLKGLEENS--LDSFVFDTLIPKPITQRYINLLMEHHRIILSGPSGTGKTYLANKLAEYVINKSGRKKIEEAVATFNVDHKSSKELRQYLANLADQCSADNDIDL---------PLVIILDNLHHIGSLSDIFNGFLNCKYSKCPYIIGTMNQSISSSPNLELHHNFRWVLCSNHTDPVKGFLGRCLRRKLIETEIEQNMRNNDLIKIIEWIPKAWHHINGFLETHSSSDVTIGPRLFLSCPMDVDGSKIWYTDLWNYSVIPYLLEAVREGLQMYGKRAPWEDPSKWVLETFPWSTSSSQQES---PALLQLRPEDVGYD-------------GYATAKEGTTSKNVSQSEK----------------------------EGDPLMNMLMRLQEAANFSSAQ-SCDSD 2289          

HSP 2 Score: 77.411 bits (189), Expect = 2.771e-13
Identity = 49/136 (36.03%), Postives = 74/136 (54.41%), Query Frame = 3
Query:  180 QASLLNECKEDVENEMKFDSENSISKTQQANALLTIYTEWANHYLEKAGFNNFVNDLQTDLCDGALLADIIIAVTGEKVPNTKPKPKTQIQQMENLNSCLIFLSNIGVVTEGIQSKDINDGNLKAILGLLFNLSRY 587
            Q  L + C  D+E++ +   + SI +T+ +     IYT+WANHYL K+G    + DLQ D+ DG LLA+II  +    +          +  + +L  CLI  S++          +I +GNLKAILGL F+LSR+
Sbjct:   55 QLPLKSSC--DLEDKKRL--QGSIKETEDSK----IYTDWANHYLTKSGHKRLIKDLQQDIADGVLLAEIIQIIGKLYLIFI----LYYVYILYSLLMCLIVFSSL---------SEIRNGNLKAILGLFFSLSRF 169          
BLAST of Neuron navigator 2 vs. Ensembl Mouse
Match: Nav3 (neuron navigator 3 [Source:MGI Symbol;Acc:MGI:2183703])

HSP 1 Score: 555.829 bits (1431), Expect = 8.182e-166
Identity = 352/882 (39.91%), Postives = 491/882 (55.67%), Query Frame = 3
Query: 2757 EDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGT---NLNNDNHTTVSLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAF-RKKFKHSDVSMSDIE---------GDYYVHHLADNRSRISNDSQNSSKNF-MLDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTAN-KVVQYVSENTSNCASIDMFSHLFKFSSENEISIG-AYVYFNDIIVSPSSVQHITNKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQN-ETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDSQVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQEAANYSTS 5351
            E   S++I KLR EL  +Q+KV TL+S+L  NAH+ +AFE SL N+T RLQ L+ T+E+K+ EL++LR  IE L+ Q     NS  Q      LN  +H    L                  R++   S+++V+  +S  +   IGS     S               KK+ KK W RSSF +AF +KK      S SDIE              H+  ++ S     SQ++S      +A +  I  LK +L+E++LKLTD +LEALSSAH L+Q++E +N M+ E+  L+A+N+RL+      + P    + ++    SS+       S  N  + + V+ +     + D   H    S +  +SI   Y    D           +   LIGS  +S  + W  LD  IR LFKEY+   D  ++LG++ + I  Y +G + +      S N E   + P        L  + N I + L+  + N+  LD+  FDTLIPK +  RY +LL+EH  IIL GPSGTGKTYLANKLA+++I +  ++ +   +A F VDHKS+KEL+ YLA +AEQ   S DNN          P+V+ILDNLHHV SL++IF+ FL+      PY+IGTM Q   S+ NL+ HHNFRWVLCANH EPVKGFLGRYLRRKLI+ E +    ++ L+  ++WI K W H+N FLE+HSSSDVTIGPRLFL CPM +EGS++WF DLWNYSLVPY+LEAVREGLQ +G+R+ WEDP  W+L T+PW S+++        +L++LRPEDVGY+             + ++ +  T+S+ IPQ                            T    DPL+NML+KLQEAANY ++
Sbjct: 1052 EKAHSEQIHKLRRELVASQEKVATLTSQLSANAHLVAAFEKSLGNMTGRLQSLTMTAEQKESELIELRETIEMLKAQ-----NSAAQAAIQGALNGPDHPPKDL------------------RIRRQHSSESVSSINSATSHSSIGSGNDADS---------------KKKKKKNWLRSSFKQAFGKKKSTKPPSSHSDIEELTDSSLPASPKLPHNAGESGSSSMKPSQSASAICECTEAEAEIILQLKSELREKELKLTDIRLEALSSAHHLDQIREAMNRMQNEIEILKAENDRLKAETGNTAKPARPPSDSSSTASSSSSRQSLGLSLNNLNITESVTSDILLDDTGDATGHKDGRSVKIIVSISKGYGRAKD---------QKSQAYLIGSIGVSGKTKWDVLDGVIRRLFKEYVFRIDTSSSLGLSSDCIASYCIGDLIR------SHNLEVPELLPCGY-----LVGDNNIITVNLKGVEENS--LDSFVFDTLIPKPITQRYFNLLMEHHRIILSGPSGTGKTYLANKLAEYVITKSGRKKTEDAIATFNVDHKSSKELQQYLANLAEQC--SADNNGVEL------PVVIILDNLHHVGSLSDIFNGFLNCKYNKCPYIIGTMNQGVSSSPNLELHHNFRWVLCANHTEPVKGFLGRYLRRKLIEMEIERNIRNNDLVKIIDWIPKTWHHLNSFLETHSSSDVTIGPRLFLPCPMDVEGSRVWFMDLWNYSLVPYVLEAVREGLQMYGKRAPWEDPSKWVLDTYPWSSASLPQEG---PALLQLRPEDVGYE-------------ACTSTKEATTSKHIPQ----------------------------TDTEGDPLMNMLMKLQEAANYPST 1821          
BLAST of Neuron navigator 2 vs. Ensembl Mouse
Match: Nav2 (neuron navigator 2 [Source:MGI Symbol;Acc:MGI:2183691])

HSP 1 Score: 561.222 bits (1445), Expect = 5.384e-165
Identity = 346/902 (38.36%), Postives = 498/902 (55.21%), Query Frame = 3
Query: 2748 SMSEDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDH---------ELLQLRNIIESLRQQGFTN-------NNSNEQGTNLN-NDNHTTVSLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGW---FRSSFGKAFRKKFKHS---------DVSMSDIEGDYYVHHLADNRSR--ISNDSQNSSKNFMLDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTANKVVQYVSENTSNCASIDMF---SHLFKFSSENEISIGAYVYFNDIIV-SPSSVQHITNKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDSQVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQEAANYST 5348
            S  E+K   EIRKLR EL+ +Q+KV  L+++L  NAH+ +AFE SL N+T RLQ L+ T+E+KD          ELL+ +N        G  N        N + Q T+L     H++ S+    SAT   +H                                        + +GS++E+D  KK+ +K W    RSSF +AF KK             +++ S +     + H     S   + N   NS  +  +D+ + T+  L+ +L+++++KLTD +LEALSSAHQL+QL+E +N M+ E+  L+A+N+RL+             +  +G   + +   ISA+   +  +   S N +   S+DM    +       E    +   V F + +     S  H+    LIG   +S  + W  LD  +R LFKEY+   DP + LG++ +S+  Y++G + KRS    + +ET  + P        L  E   I + ++    N+  LD+L F++LIPK +L RYVSLL EHR IIL GPSGTGKTYLAN+L++++++R  +E++   +A F VDHKS+KELR YL+ +A+Q  S    NN  ++     P+V+ILDNLHHV+SL EIF+  L+      PY+IGTM QA+ S  NLQ HHNFRWVLCANH EPVKGFLGR+LRRKL++ E   +  +  L+  + WI KVW H+N+FLE+HSSSDVTIGPRLFLSCP+ ++GS++WFTDLWNYS++PYLLEAVREGLQ +GRR+ WEDP  W++ T+PW +S    +  +   L++LRPEDVG+D             SL   +  TS Q+ P                                  DPL+NML++LQEAANYS+
Sbjct: 1627 STPEEKCQSEIRKLRRELDASQEKVSALTTQLTANAHLVAAFEQSLGNMTIRLQSLTMTAEQKDSELNELRKTIELLKKQNAAAQAAINGVINTPELNCKGNGSAQATDLRIRRQHSSDSVSSINSAT---SH----------------------------------------SSVGSNIESD-SKKKKRKNWVNELRSSFKQAFGKKKSPKSASSHSDIEEMTDSSLPSSPKLPHNGSTGSTPLLRNAHSNSLISECMDSEAETVMQLRNELRDKEMKLTDIRLEALSSAHQLDQLREAMNRMQSEIEKLKAENDRLK-----------SESQGSGCSRAPSQVSISASPRQSLGLSQHSLNLTESTSLDMLLDDTGECSARKEGGRHVKIVVSFQEAMKWKEDSRPHL---FLIGCIGVSGKTKWDVLDGVVRRLFKEYIVHVDPVSQLGLSSDSVLGYSIGEI-KRS----NASETPELLPCGY-----LVGENTTILVTVKGLTENS--LDSLVFESLIPKPILQRYVSLLTEHRRIILSGPSGTGKTYLANRLSEYVVLREGRELTDGVIATFNVDHKSSKELRQYLSNLADQCNS---ENNAVDM-----PLVIILDNLHHVSSLGEIFNGLLNCKYHKCPYIIGTMNQATSSTPNLQLHHNFRWVLCANHTEPVKGFLGRFLRRKLMETEISGRVRNAELVKIINWIPKVWHHLNRFLEAHSSSDVTIGPRLFLSCPIDVDGSRVWFTDLWNYSIIPYLLEAVREGLQLYGRRAPWEDPAKWVMDTYPWAAS---PQQHEWPPLLQLRPEDVGFDGY-----------SLPR-EGSTSKQVPPSDTEG-----------------------------DPLMNMLMRLQEAANYSS 2406          

HSP 2 Score: 116.701 bits (291), Expect = 2.663e-25
Identity = 51/101 (50.50%), Postives = 72/101 (71.29%), Query Frame = 3
Query:  285 IYTEWANHYLEKAGFNNFVNDLQTDLCDGALLADIIIAVTGEKVPNTKPKPKTQIQQMENLNSCLIFLSNIGVVTEGIQSKDINDGNLKAILGLLFNLSRY 587
            IYT+WANHYL K+G    + DLQ D+ DG LLA II  V  +K+ +    PK + Q +EN+++CL FL+  G+ T+G+ +++I +GNLKAILGL F+LSRY
Sbjct:   87 IYTDWANHYLAKSGHKRLIKDLQQDVTDGVLLAQIIQVVANDKIEDINGCPKNRSQMIENIDACLNFLAAKGINTQGLSAEEIRNGNLKAILGLFFSLSRY 187          
BLAST of Neuron navigator 2 vs. Ensembl Mouse
Match: Nav2 (neuron navigator 2 [Source:MGI Symbol;Acc:MGI:2183691])

HSP 1 Score: 561.222 bits (1445), Expect = 6.504e-165
Identity = 346/902 (38.36%), Postives = 498/902 (55.21%), Query Frame = 3
Query: 2748 SMSEDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDH---------ELLQLRNIIESLRQQGFTN-------NNSNEQGTNLN-NDNHTTVSLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGW---FRSSFGKAFRKKFKHS---------DVSMSDIEGDYYVHHLADNRSR--ISNDSQNSSKNFMLDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTANKVVQYVSENTSNCASIDMF---SHLFKFSSENEISIGAYVYFNDIIV-SPSSVQHITNKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDSQVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQEAANYST 5348
            S  E+K   EIRKLR EL+ +Q+KV  L+++L  NAH+ +AFE SL N+T RLQ L+ T+E+KD          ELL+ +N        G  N        N + Q T+L     H++ S+    SAT   +H                                        + +GS++E+D  KK+ +K W    RSSF +AF KK             +++ S +     + H     S   + N   NS  +  +D+ + T+  L+ +L+++++KLTD +LEALSSAHQL+QL+E +N M+ E+  L+A+N+RL+             +  +G   + +   ISA+   +  +   S N +   S+DM    +       E    +   V F + +     S  H+    LIG   +S  + W  LD  +R LFKEY+   DP + LG++ +S+  Y++G + KRS    + +ET  + P        L  E   I + ++    N+  LD+L F++LIPK +L RYVSLL EHR IIL GPSGTGKTYLAN+L++++++R  +E++   +A F VDHKS+KELR YL+ +A+Q  S    NN  ++     P+V+ILDNLHHV+SL EIF+  L+      PY+IGTM QA+ S  NLQ HHNFRWVLCANH EPVKGFLGR+LRRKL++ E   +  +  L+  + WI KVW H+N+FLE+HSSSDVTIGPRLFLSCP+ ++GS++WFTDLWNYS++PYLLEAVREGLQ +GRR+ WEDP  W++ T+PW +S    +  +   L++LRPEDVG+D             SL   +  TS Q+ P                                  DPL+NML++LQEAANYS+
Sbjct: 1627 STPEEKCQSEIRKLRRELDASQEKVSALTTQLTANAHLVAAFEQSLGNMTIRLQSLTMTAEQKDSELNELRKTIELLKKQNAAAQAAINGVINTPELNCKGNGSAQATDLRIRRQHSSDSVSSINSAT---SH----------------------------------------SSVGSNIESD-SKKKKRKNWVSQLRSSFKQAFGKKKSPKSASSHSDIEEMTDSSLPSSPKLPHNGSTGSTPLLRNAHSNSLISECMDSEAETVMQLRNELRDKEMKLTDIRLEALSSAHQLDQLREAMNRMQSEIEKLKAENDRLK-----------SESQGSGCSRAPSQVSISASPRQSLGLSQHSLNLTESTSLDMLLDDTGECSARKEGGRHVKIVVSFQEAMKWKEDSRPHL---FLIGCIGVSGKTKWDVLDGVVRRLFKEYIVHVDPVSQLGLSSDSVLGYSIGEI-KRS----NASETPELLPCGY-----LVGENTTILVTVKGLTENS--LDSLVFESLIPKPILQRYVSLLTEHRRIILSGPSGTGKTYLANRLSEYVVLREGRELTDGVIATFNVDHKSSKELRQYLSNLADQCNS---ENNAVDM-----PLVIILDNLHHVSSLGEIFNGLLNCKYHKCPYIIGTMNQATSSTPNLQLHHNFRWVLCANHTEPVKGFLGRFLRRKLMETEISGRVRNAELVKIINWIPKVWHHLNRFLEAHSSSDVTIGPRLFLSCPIDVDGSRVWFTDLWNYSIIPYLLEAVREGLQLYGRRAPWEDPAKWVMDTYPWAAS---PQQHEWPPLLQLRPEDVGFDGY-----------SLPR-EGSTSKQVPPSDTEG-----------------------------DPLMNMLMRLQEAANYSS 2406          

HSP 2 Score: 116.701 bits (291), Expect = 2.553e-25
Identity = 51/101 (50.50%), Postives = 72/101 (71.29%), Query Frame = 3
Query:  285 IYTEWANHYLEKAGFNNFVNDLQTDLCDGALLADIIIAVTGEKVPNTKPKPKTQIQQMENLNSCLIFLSNIGVVTEGIQSKDINDGNLKAILGLLFNLSRY 587
            IYT+WANHYL K+G    + DLQ D+ DG LLA II  V  +K+ +    PK + Q +EN+++CL FL+  G+ T+G+ +++I +GNLKAILGL F+LSRY
Sbjct:   87 IYTDWANHYLAKSGHKRLIKDLQQDVTDGVLLAQIIQVVANDKIEDINGCPKNRSQMIENIDACLNFLAAKGINTQGLSAEEIRNGNLKAILGLFFSLSRY 187          
BLAST of Neuron navigator 2 vs. Ensembl Mouse
Match: Nav2 (neuron navigator 2 [Source:MGI Symbol;Acc:MGI:2183691])

HSP 1 Score: 560.451 bits (1443), Expect = 7.770e-165
Identity = 346/902 (38.36%), Postives = 498/902 (55.21%), Query Frame = 3
Query: 2748 SMSEDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDH---------ELLQLRNIIESLRQQGFTN-------NNSNEQGTNLN-NDNHTTVSLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGW---FRSSFGKAFRKKFKHS---------DVSMSDIEGDYYVHHLADNRSR--ISNDSQNSSKNFMLDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTANKVVQYVSENTSNCASIDMF---SHLFKFSSENEISIGAYVYFNDIIV-SPSSVQHITNKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDSQVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQEAANYST 5348
            S  E+K   EIRKLR EL+ +Q+KV  L+++L  NAH+ +AFE SL N+T RLQ L+ T+E+KD          ELL+ +N        G  N        N + Q T+L     H++ S+    SAT   +H                                        + +GS++E+D  KK+ +K W    RSSF +AF KK             +++ S +     + H     S   + N   NS  +  +D+ + T+  L+ +L+++++KLTD +LEALSSAHQL+QL+E +N M+ E+  L+A+N+RL+             +  +G   + +   ISA+   +  +   S N +   S+DM    +       E    +   V F + +     S  H+    LIG   +S  + W  LD  +R LFKEY+   DP + LG++ +S+  Y++G + KRS    + +ET  + P        L  E   I + ++    N+  LD+L F++LIPK +L RYVSLL EHR IIL GPSGTGKTYLAN+L++++++R  +E++   +A F VDHKS+KELR YL+ +A+Q  S    NN  ++     P+V+ILDNLHHV+SL EIF+  L+      PY+IGTM QA+ S  NLQ HHNFRWVLCANH EPVKGFLGR+LRRKL++ E   +  +  L+  + WI KVW H+N+FLE+HSSSDVTIGPRLFLSCP+ ++GS++WFTDLWNYS++PYLLEAVREGLQ +GRR+ WEDP  W++ T+PW +S    +  +   L++LRPEDVG+D             SL   +  TS Q+ P                                  DPL+NML++LQEAANYS+
Sbjct: 1566 STPEEKCQSEIRKLRRELDASQEKVSALTTQLTANAHLVAAFEQSLGNMTIRLQSLTMTAEQKDSELNELRKTIELLKKQNAAAQAAINGVINTPELNCKGNGSAQATDLRIRRQHSSDSVSSINSAT---SH----------------------------------------SSVGSNIESD-SKKKKRKNWVNELRSSFKQAFGKKKSPKSASSHSDIEEMTDSSLPSSPKLPHNGSTGSTPLLRNAHSNSLISECMDSEAETVMQLRNELRDKEMKLTDIRLEALSSAHQLDQLREAMNRMQSEIEKLKAENDRLK-----------SESQGSGCSRAPSQVSISASPRQSLGLSQHSLNLTESTSLDMLLDDTGECSARKEGGRHVKIVVSFQEAMKWKEDSRPHL---FLIGCIGVSGKTKWDVLDGVVRRLFKEYIVHVDPVSQLGLSSDSVLGYSIGEI-KRS----NASETPELLPCGY-----LVGENTTILVTVKGLTENS--LDSLVFESLIPKPILQRYVSLLTEHRRIILSGPSGTGKTYLANRLSEYVVLREGRELTDGVIATFNVDHKSSKELRQYLSNLADQCNS---ENNAVDM-----PLVIILDNLHHVSSLGEIFNGLLNCKYHKCPYIIGTMNQATSSTPNLQLHHNFRWVLCANHTEPVKGFLGRFLRRKLMETEISGRVRNAELVKIINWIPKVWHHLNRFLEAHSSSDVTIGPRLFLSCPIDVDGSRVWFTDLWNYSIIPYLLEAVREGLQLYGRRAPWEDPAKWVMDTYPWAAS---PQQHEWPPLLQLRPEDVGFDGY-----------SLPR-EGSTSKQVPPSDTEG-----------------------------DPLMNMLMRLQEAANYSS 2345          

HSP 2 Score: 116.701 bits (291), Expect = 2.535e-25
Identity = 51/101 (50.50%), Postives = 72/101 (71.29%), Query Frame = 3
Query:  285 IYTEWANHYLEKAGFNNFVNDLQTDLCDGALLADIIIAVTGEKVPNTKPKPKTQIQQMENLNSCLIFLSNIGVVTEGIQSKDINDGNLKAILGLLFNLSRY 587
            IYT+WANHYL K+G    + DLQ D+ DG LLA II  V  +K+ +    PK + Q +EN+++CL FL+  G+ T+G+ +++I +GNLKAILGL F+LSRY
Sbjct:   26 IYTDWANHYLAKSGHKRLIKDLQQDVTDGVLLAQIIQVVANDKIEDINGCPKNRSQMIENIDACLNFLAAKGINTQGLSAEEIRNGNLKAILGLFFSLSRY 126          
BLAST of Neuron navigator 2 vs. Ensembl Mouse
Match: Nav3 (neuron navigator 3 [Source:MGI Symbol;Acc:MGI:2183703])

HSP 1 Score: 555.058 bits (1429), Expect = 4.937e-163
Identity = 348/882 (39.46%), Postives = 489/882 (55.44%), Query Frame = 3
Query: 2757 EDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGT---NLNNDNHTTVSLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAF-RKKFKHSDVSMSDIE---------GDYYVHHLADNRSRISNDSQNSSKNF-MLDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTAN-KVVQYVSENTSNCASIDMFSHLFKFSSENEISIG-AYVYFNDIIVSPSSVQHITNKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQN-ETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDSQVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQEAANYSTS 5351
            E   S++I KLR EL  +Q+KV TL+S+L  NAH+ +AFE SL N+T RLQ L+ T+E+K+ EL++LR  IE L+ Q     NS  Q      LN  +H    L                  R++   S+++V+  +S  +   IGS          D  S  +       ++    RSSF +AF +KK      S SDIE              H+  ++ S     SQ++S      +A +  I  LK +L+E++LKLTD +LEALSSAH L+Q++E +N M+ E+  L+A+N+RL+      + P    + ++    SS+       S  N  + + V+ +     + D   H    S +  +SI   Y    D           +   LIGS  +S  + W  LD  IR LFKEY+   D  ++LG++ + I  Y +G + +      S N E   + P        L  + N I + L+  + N+  LD+  FDTLIPK +  RY +LL+EH  IIL GPSGTGKTYLANKLA+++I +  ++ +   +A F VDHKS+KEL+ YLA +AEQ   S DNN          P+V+ILDNLHHV SL++IF+ FL+      PY+IGTM Q   S+ NL+ HHNFRWVLCANH EPVKGFLGRYLRRKLI+ E +    ++ L+  ++WI K W H+N FLE+HSSSDVTIGPRLFL CPM +EGS++WF DLWNYSLVPY+LEAVREGLQ +G+R+ WEDP  W+L T+PW S+++        +L++LRPEDVGY+             + ++ +  T+S+ IPQ                            T    DPL+NML+KLQEAANY ++
Sbjct: 1567 EKAHSEQIHKLRRELVASQEKVATLTSQLSANAHLVAAFEKSLGNMTGRLQSLTMTAEQKESELIELRETIEMLKAQ-----NSAAQAAIQGALNGPDHPPKDL------------------RIRRQHSSESVSSINSATSHSSIGSG--------NDADSKKKKKKNWVNSRGSELRSSFKQAFGKKKSTKPPSSHSDIEELTDSSLPASPKLPHNAGESGSSSMKPSQSASAICECTEAEAEIILQLKSELREKELKLTDIRLEALSSAHHLDQIREAMNRMQNEIEILKAENDRLKAETGNTAKPARPPSDSSSTASSSSSRQSLGLSLNNLNITESVTSDILLDDTGDATGHKDGRSVKIIVSISKGYGRAKD---------QKSQAYLIGSIGVSGKTKWDVLDGVIRRLFKEYVFRIDTSSSLGLSSDCIASYCIGDLIR------SHNLEVPELLPCGY-----LVGDNNIITVNLKGVEENS--LDSFVFDTLIPKPITQRYFNLLMEHHRIILSGPSGTGKTYLANKLAEYVITKSGRKKTEDAIATFNVDHKSSKELQQYLANLAEQC--SADNNGVEL------PVVIILDNLHHVGSLSDIFNGFLNCKYNKCPYIIGTMNQGVSSSPNLELHHNFRWVLCANHTEPVKGFLGRYLRRKLIEMEIERNIRNNDLVKIIDWIPKTWHHLNSFLETHSSSDVTIGPRLFLPCPMDVEGSRVWFMDLWNYSLVPYVLEAVREGLQMYGKRAPWEDPSKWVLDTYPWSSASLPQEG---PALLQLRPEDVGYE-------------ACTSTKEATTSKHIPQ----------------------------TDTEGDPLMNMLMKLQEAANYPST 2343          

HSP 2 Score: 122.479 bits (306), Expect = 4.685e-27
Identity = 56/129 (43.41%), Postives = 84/129 (65.12%), Query Frame = 3
Query:  201 CKEDVENEMKFDSENSISKTQQANALLTIYTEWANHYLEKAGFNNFVNDLQTDLCDGALLADIIIAVTGEKVPNTKPKPKTQIQQMENLNSCLIFLSNIGVVTEGIQSKDINDGNLKAILGLLFNLSRY 587
            C+  +++  +F  + ++  T +      IYT+WANHYL K+G    + DLQ D+ DG LLADII  +  EKV +    P++Q Q +EN++ CL FL+  GV  +G+ +++I +GNLKAILGL F+LSRY
Sbjct:   54 CQLTLKSTCEFGEKKALQGTAKEIEDSKIYTDWANHYLAKSGHKRLIKDLQQDIADGVLLADIIQIIANEKVEDINGCPRSQSQMIENVDVCLSFLAARGVNVQGLSAEEIRNGNLKAILGLFFSLSRY 182          
BLAST of Neuron navigator 2 vs. UniProt/SwissProt
Match: sp|Q80TN7|NAV3_MOUSE (Neuron navigator 3 OS=Mus musculus OX=10090 GN=Nav3 PE=1 SV=2)

HSP 1 Score: 560.066 bits (1442), Expect = 5.962e-164
Identity = 352/882 (39.91%), Postives = 491/882 (55.67%), Query Frame = 3
Query: 2757 EDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGT---NLNNDNHTTVSLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAF-RKKFKHSDVSMSDIE---------GDYYVHHLADNRSRISNDSQNSSKNF-MLDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTAN-KVVQYVSENTSNCASIDMFSHLFKFSSENEISIG-AYVYFNDIIVSPSSVQHITNKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQN-ETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDSQVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQEAANYSTS 5351
            E   S++I KLR EL  +Q+KV TL+S+L  NAH+ +AFE SL N+T RLQ L+ T+E+K+ EL++LR  IE L+ Q     NS  Q      LN  +H    L                  R++   S+++V+  +S  +   IGS     S               KK+ KK W RSSF +AF +KK      S SDIE              H+  ++ S     SQ++S      +A +  I  LK +L+E++LKLTD +LEALSSAH L+Q++E +N M+ E+  L+A+N+RL+      + P    + ++    SS+       S  N  + + V+ +     + D   H    S +  +SI   Y    D           +   LIGS  +S  + W  LD  IR LFKEY+   D  ++LG++ + I  Y +G + +      S N E   + P        L  + N I + L+  + N+  LD+  FDTLIPK +  RY +LL+EH  IIL GPSGTGKTYLANKLA+++I +  ++ +   +A F VDHKS+KEL+ YLA +AEQ   S DNN          P+V+ILDNLHHV SL++IF+ FL+      PY+IGTM Q   S+ NL+ HHNFRWVLCANH EPVKGFLGRYLRRKLI+ E +    ++ L+  ++WI K W H+N FLE+HSSSDVTIGPRLFL CPM +EGS++WF DLWNYSLVPY+LEAVREGLQ +G+R+ WEDP  W+L T+PW S+++        +L++LRPEDVGY+             + ++ +  T+S+ IPQ                            T    DPL+NML+KLQEAANY ++
Sbjct: 1567 EKAHSEQIHKLRRELVASQEKVATLTSQLSANAHLVAAFEKSLGNMTGRLQSLTMTAEQKESELIELRETIEMLKAQ-----NSAAQAAIQGALNGPDHPPKDL------------------RIRRQHSSESVSSINSATSHSSIGSGNDADS---------------KKKKKKNWLRSSFKQAFGKKKSTKPPSSHSDIEELTDSSLPASPKLPHNAGESGSSSMKPSQSASAICECTEAEAEIILQLKSELREKELKLTDIRLEALSSAHHLDQIREAMNRMQNEIEILKAENDRLKAETGNTAKPARPPSDSSSTASSSSSRQSLGLSLNNLNITESVTSDILLDDTGDATGHKDGRSVKIIVSISKGYGRAKD---------QKSQAYLIGSIGVSGKTKWDVLDGVIRRLFKEYVFRIDTSSSLGLSSDCIASYCIGDLIR------SHNLEVPELLPCGY-----LVGDNNIITVNLKGVEENS--LDSFVFDTLIPKPITQRYFNLLMEHHRIILSGPSGTGKTYLANKLAEYVITKSGRKKTEDAIATFNVDHKSSKELQQYLANLAEQC--SADNNGVEL------PVVIILDNLHHVGSLSDIFNGFLNCKYNKCPYIIGTMNQGVSSSPNLELHHNFRWVLCANHTEPVKGFLGRYLRRKLIEMEIERNIRNNDLVKIIDWIPKTWHHLNSFLETHSSSDVTIGPRLFLPCPMDVEGSRVWFMDLWNYSLVPYVLEAVREGLQMYGKRAPWEDPSKWVLDTYPWSSASLPQEG---PALLQLRPEDVGYE-------------ACTSTKEATTSKHIPQ----------------------------TDTEGDPLMNMLMKLQEAANYPST 2336          

HSP 2 Score: 122.479 bits (306), Expect = 3.113e-26
Identity = 56/129 (43.41%), Postives = 84/129 (65.12%), Query Frame = 3
Query:  201 CKEDVENEMKFDSENSISKTQQANALLTIYTEWANHYLEKAGFNNFVNDLQTDLCDGALLADIIIAVTGEKVPNTKPKPKTQIQQMENLNSCLIFLSNIGVVTEGIQSKDINDGNLKAILGLLFNLSRY 587
            C+  +++  +F  + ++  T +      IYT+WANHYL K+G    + DLQ D+ DG LLADII  +  EKV +    P++Q Q +EN++ CL FL+  GV  +G+ +++I +GNLKAILGL F+LSRY
Sbjct:   54 CQLTLKSTCEFGEKKALQGTAKEIEDSKIYTDWANHYLAKSGHKRLIKDLQQDIADGVLLADIIQIIANEKVEDINGCPRSQSQMIENVDVCLSFLAARGVNVQGLSAEEIRNGNLKAILGLFFSLSRY 182          
BLAST of Neuron navigator 2 vs. UniProt/SwissProt
Match: sp|Q8IVL0|NAV3_HUMAN (Neuron navigator 3 OS=Homo sapiens OX=9606 GN=NAV3 PE=1 SV=3)

HSP 1 Score: 553.518 bits (1425), Expect = 1.383e-161
Identity = 352/904 (38.94%), Postives = 491/904 (54.31%), Query Frame = 3
Query: 2757 EDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGT---NLNNDNHTTVSLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAF-RKKFKHSDVSMSDIE---------GDYYVHHLADNRSRISNDSQNSSKNFML-----------------------DASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTAN-KVVQYVSENTSNCASIDMFSHLFKFSSENEISIG-AYVYFNDIIVSPSSVQHITNKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQN-ETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDSQVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQEAANYSTS 5351
            E   S++I KLR EL  +Q+KV TL+S+L  NAH+ +AFE SL N+T RLQ L+ T+E+K+ EL++LR  IE L+ Q     NS  Q      LN  +H    L                  R++   S+++V+  +S  +   IGS          D  S  +       ++    RSSF +AF +KK      S SDIE              H+  D  S     SQ++S + ++                       +A +  I  LK +L+E++LKLTD +LEALSSAH L+Q++E +N M+ E+  L+A+N+RL+      + P    + ++    SS+       S  N  + + VS +     + D   H    S +  +SI   Y    D           +   LIGS  +S  + W  LD  IR LFKEY+   D   +LG++ + I  Y +G + +      S N E   + P        L  + N I + L+  + N+  LD+  FDTLIPK +  RY +LL+EH  IIL GPSGTGKTYLANKLA+++I +  ++ +   +A F VDHKS+KEL+ YLA +AEQ   S DNN          P+V+ILDNLHHV SL++IF+ FL+      PY+IGTM Q   S+ NL+ HHNFRWVLCANH EPVKGFLGRYLRRKLI+ E +    ++ L+  ++WI K W H+N FLE+HSSSDVTIGPRLFL CPM +EGS++WF DLWNYSLVPY+LEAVREGLQ +G+R+ WEDP  W+L T+PW S+ +   +    +L++LRPEDVGY+             S ++ +  T+S+ IPQ                            T    DPL+NML+KLQEAANYS++
Sbjct: 1564 EKAHSEQIHKLRRELVASQEKVATLTSQLSANAHLVAAFEKSLGNMTGRLQSLTMTAEQKESELIELRETIEMLKAQ-----NSAAQAAIQGALNGPDHPPKDL------------------RIRRQHSSESVSSINSATSHSSIGSG--------NDADSKKKKKKNWVNSRGSELRSSFKQAFGKKKSTKPPSSHSDIEELTDSSLPASPKLPHNAGDCGSASMKPSQSASASPLVWPPKKRQNGPVIYKHRSRICECTEAEAEIILQLKSELREKELKLTDIRLEALSSAHHLDQIREAMNRMQNEIEILKAENDRLKAETGNTAKPTRPPSESSSSTSSSSSRQSLGLSLNNLNITEAVSSDILLDDAGDATGHKDGRSVKIIVSISKGYGRAKD---------QKSQAYLIGSIGVSGKTKWDVLDGVIRRLFKEYVFRIDTSTSLGLSSDCIASYCIGDLIR------SHNLEVPELLPCGY-----LVGDNNIITVNLKGVEENS--LDSFVFDTLIPKPITQRYFNLLMEHHRIILSGPSGTGKTYLANKLAEYVITKSGRKKTEDAIATFNVDHKSSKELQQYLANLAEQC--SADNNGVEL------PVVIILDNLHHVGSLSDIFNGFLNCKYNKCPYIIGTMNQGVSSSPNLELHHNFRWVLCANHTEPVKGFLGRYLRRKLIEIEIERNIRNNDLVKIIDWIPKTWHHLNSFLETHSSSDVTIGPRLFLPCPMDVEGSRVWFMDLWNYSLVPYILEAVREGLQMYGKRTPWEDPSKWVLDTYPWSSATLPQES---PALLQLRPEDVGYE-------------SCTSTKEATTSKHIPQ----------------------------TDTEGDPLMNMLMKLQEAANYSST 2362          

HSP 2 Score: 120.939 bits (302), Expect = 9.650e-26
Identity = 57/139 (41.01%), Postives = 90/139 (64.75%), Query Frame = 3
Query:  171 SEYQASLLNECKEDVENEMKFDSENSISKTQQANALLTIYTEWANHYLEKAGFNNFVNDLQTDLCDGALLADIIIAVTGEKVPNTKPKPKTQIQQMENLNSCLIFLSNIGVVTEGIQSKDINDGNLKAILGLLFNLSRY 587
            +E ++S+L+ C+  +++  +F  +  +    +      IYT+WANHYL K+G    + DLQ D+ DG LLA+II  +  EKV +    P++Q Q +EN++ CL FL+  GV  +G+ +++I +GNLKAILGL F+LSRY
Sbjct:   45 TETESSMLS-CQLALKSTCEFGEKKPLQGKAKEKEDSKIYTDWANHYLAKSGHKRLIKDLQQDIADGVLLAEIIQIIANEKVEDINGCPRSQSQMIENVDVCLSFLAARGVNVQGLSAEEIRNGNLKAILGLFFSLSRY 182          
BLAST of Neuron navigator 2 vs. UniProt/SwissProt
Match: sp|Q8IVL1|NAV2_HUMAN (Neuron navigator 2 OS=Homo sapiens OX=9606 GN=NAV2 PE=1 SV=3)

HSP 1 Score: 525.783 bits (1353), Expect = 4.631e-152
Identity = 296/728 (40.66%), Postives = 428/728 (58.79%), Query Frame = 3
Query: 3222 IGSSLENDPFKKQAKKGW---FRSSFGKAFRKKFKHS---------DVSMSDIEGDYYVHHLADNRSR--ISNDSQNSSKNFMLDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTANKVVQYVSENTSNCASIDMF---SHLFKFSSENEISIGAYVYFNDIIV-SPSSVQHITNKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDS-QVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQEAANYST 5348
            +GS++E+D  KK+ +K W    RSSF +AF KK             +++ S +     + H     S   + N   NS  +  +D+ + T+  L+ +L+++++KLTD +LEALSSAHQL+QL+E +N M+ E+  L+A+N+RL+             +  +G   + +   ISA+   +  +   S N +   S+DM    +       E    +   V F + +     S  H+    LIG   +S  + W  LD  +R LFKEY+   DP + LG+N +S+  Y++G + KRS    + +ET  + P        L  E   I + ++    N+  LD+L F++LIPK +L RYVSLL+EHR IIL GPSGTGKTYLAN+L++++++R  +E++   +A F VDHKS+KELR YL+ +A+Q  S    NN  ++     P+V+ILDNLHHV+SL EIF+  L+      PY+IGTM QA+ S  NLQ HHNFRWVLCANH EPVKGFLGR+LRRKL++ E   +  +  L+  ++WI KVW H+N+FLE+HSSSDVTIGPRLFLSCP+ ++GS++WFTDLWNYS++PYLLEAVREGLQ +GRR+ WEDP  W++ T+PW +S    +  +   L++LRPEDVG+D   +P              +  TS Q+ P                                  DPL+NML++LQEAANYS+
Sbjct: 1815 VGSNIESD-SKKKKRKNWVNELRSSFKQAFGKKKSPKSASSHSDIEEMTDSSLPSSPKLPHNGSTGSTPLLRNSHSNSLISECMDSEAETVMQLRNELRDKEMKLTDIRLEALSSAHQLDQLREAMNRMQSEIEKLKAENDRLK-----------SESQGSGCSRAPSQVSISASPRQSMGLSQHSLNLTESTSLDMLLDDTGECSARKEGGRHVKIVVSFQEEMKWKEDSRPHL---FLIGCIGVSGKTKWDVLDGVVRRLFKEYIIHVDPVSQLGLNSDSVLGYSIGEI-KRS----NTSETPELLPCGY-----LVGENTTISVTVKGLAENS--LDSLVFESLIPKPILQRYVSLLIEHRRIILSGPSGTGKTYLANRLSEYIVLREGRELTDGVIATFNVDHKSSKELRQYLSNLADQCNS---ENNAVDM-----PLVIILDNLHHVSSLGEIFNGLLNCKYHKCPYIIGTMNQATSSTPNLQLHHNFRWVLCANHTEPVKGFLGRFLRRKLMETEISGRVRNMELVKIIDWIPKVWHHLNRFLEAHSSSDVTIGPRLFLSCPIDVDGSRVWFTDLWNYSIIPYLLEAVREGLQLYGRRAPWEDPAKWVMDTYPWAAS---PQQHEWPPLLQLRPEDVGFDGYSMPR-------------EGSTSKQMPPSDAEG-----------------------------DPLMNMLMRLQEAANYSS 2462          

HSP 2 Score: 115.931 bits (289), Expect = 3.002e-24
Identity = 51/101 (50.50%), Postives = 71/101 (70.30%), Query Frame = 3
Query:  285 IYTEWANHYLEKAGFNNFVNDLQTDLCDGALLADIIIAVTGEKVPNTKPKPKTQIQQMENLNSCLIFLSNIGVVTEGIQSKDINDGNLKAILGLLFNLSRY 587
            IYT+WANHYL K+G    + DLQ D+ DG LLA II  V  EK+ +    PK + Q +EN+++CL FL+  G+  +G+ +++I +GNLKAILGL F+LSRY
Sbjct:   90 IYTDWANHYLAKSGHKRLIRDLQQDVTDGVLLAQIIQVVANEKIEDINGCPKNRSQMIENIDACLNFLAAKGINIQGLSAEEIRNGNLKAILGLFFSLSRY 190          
BLAST of Neuron navigator 2 vs. UniProt/SwissProt
Match: sp|Q5TZ18|NAV3_DANRE (Neuron navigator 3 OS=Danio rerio OX=7955 GN=nav3 PE=3 SV=1)

HSP 1 Score: 518.85 bits (1335), Expect = 3.373e-150
Identity = 344/886 (38.83%), Postives = 472/886 (53.27%), Query Frame = 3
Query: 2775 EIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGTNLNNDNHTTVSLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAFRKKFKHSDVSMSDIEGDYYVHHLADNRSRISNDSQNSSKNFMLDASSNT------------IENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTANKVVQYVSENTSNCASIDMFSHLFKFSSENEI-----SIGAYVYFNDIIVSPSSVQHITNKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCR-SPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDSQVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQEAANYSTSPGSNDSDIA 5378
            +IRKLR EL+ +Q+KV TL+S+L  NAH+ +AFE SL N+T RLQ L+ T+E+K+ EL +LR  IE+L+ Q              N D  T + +     A   P H    L R++   S+++++  +S  +   +GS++                   KK+ KK W RSSF +AF KK  +   S  D   +     L  +   +    Q SS   +L + S T            I  LK +L+E++LKLTD +LEALSSAH L+Q++E +N M+ E+  L+A+N+RL+      S  N                  S +S++++    +S N  N     M   L     E  +     S+   V  N       ++Q    + LIGS  +S  + W  LD  IR LFKEY+   DP  +LG+N +SI  Y +G V +        +E   + P        L  + N I + L+  K  +  +D L FDTLIPK ++ RY++LL+EHR IIL GPSGTGK+YLA KLA  ++ +  +EV+ T LA F VD KS+K+LR YL+++AEQ         C    C    P VVILDNLHH+ SL++IF+ FL+      PYVIGTM Q   S+ NL+ HHNFRWVLCANH EPVKGFLGR+LRRKLI+ E  +    + L+  ++WI K+WQH+N FLE+HSSSDVTIGPRLFLSCPM  +GS++WFTDLWNYSLVPYLLEAVREGLQ  G+                              SL++LRPEDVGYD               S+ +   +S+ + QS                                DPL+NML++LQEAANYS++  S DSD A
Sbjct: 1505 QIRKLRRELDASQEKVATLTSQLAANAHLVAAFEKSLANMTCRLQSLTMTAEQKESELAELRETIEALKTQ--------------NTDAQTAIQV-----ALNGPDHVHRDL-RIRRQHSSESMSSINSAASHSSLGSAKDAED---------------KKKKKKSWLRSSFKQAFSKKKTNKPQSSHDEIEEMTDSSLPSSPKLLHISRQASSPQPLLSSPSTTELCECTEAEAEIILQLKNELREKELKLTDIRLEALSSAHHLDQIREAMNRMQNEIELLKAENDRLK------SSGNTTPAATPAKTARPPSETSSTSSSSSRQSLGLSLNNLNITDTIMSDILLDDGYEGNLRKEGRSVRIVVTINSDSNKTKAMQK--KQYLIGSIGVSGKTKWDVLDGVIRRLFKEYVFRVDPLTSLGMNSDSIVCYRMGDVVR-----SHASEVPELLPCGY-----LVGDNNVITVTLKGVKEGS--IDDLVFDTLIPKPIIQRYLNLLMEHRRIILSGPSGTGKSYLATKLAYFILSKTGREVTDTNLATFNVDQKSSKDLRQYLSSLAEQ---------CNTEECEIELPTVVILDNLHHIGSLSDIFNGFLNCKYHKCPYVIGTMNQGVSSSPNLELHHNFRWVLCANHTEPVKGFLGRFLRRKLIETEIDKNMRSNDLIKIIDWIPKIWQHLNSFLEAHSSSDVTIGPRLFLSCPMDADGSRVWFTDLWNYSLVPYLLEAVREGLQHEGQ------------------------------SLLQLRPEDVGYD-------------GYSSSKDGAASKQVSQSDT----------------------------EGDPLMNMLMRLQEAANYSSA-QSCDSDSA 2254          

HSP 2 Score: 108.612 bits (270), Expect = 4.810e-22
Identity = 49/112 (43.75%), Postives = 72/112 (64.29%), Query Frame = 3
Query:  252 SKTQQANALLTIYTEWANHYLEKAGFNNFVNDLQTDLCDGALLADIIIAVTGEKVPNTKPKPKTQIQQMENLNSCLIFLSNIGVVTEGIQSKDINDGNLKAILGLLFNLSRY 587
            S+  + + +  IYT+WANHYL K+G    + DL  D+ DG LLA+II  +  EK+ +    PK+  Q +EN+  CL FL   GV  +G+ ++++ +GNLK+ILGL F LSRY
Sbjct:   49 SREAEESKICKIYTDWANHYLAKSGCPRLIKDLTQDIPDGVLLAEIIQIIANEKIEDINSCPKSHSQMIENVECCLSFLGARGVSVQGLSAEEVCNGNLKSILGLFFILSRY 160          
BLAST of Neuron navigator 2 vs. UniProt/SwissProt
Match: sp|Q9VIQ9|SICK_DROME (Protein sickie OS=Drosophila melanogaster OX=7227 GN=sick PE=3 SV=3)

HSP 1 Score: 396.741 bits (1018), Expect = 1.857e-110
Identity = 212/492 (43.09%), Postives = 277/492 (56.30%), Query Frame = 3
Query: 3876 NKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNR-PYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSN-WEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDSQVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQEAANYS 5345
            N+ +I   +IS  +TW  LD  +R  FK+Y++  DP  NLG+N +SI  Y LG  ++       +     + P   I           + I L+        + +LAFD+LIP++++HRY+SLL EHR +ILCGPSGTGK+YLA +LA+ L+ R  +   S  +A F VDHKS+K+LR YL  IAEQ+  +   N    L     P V+ILDNLHH ++L ++F   LS+   N+ P +IGTM+QA+ + TNLQ HHNFRWVL ANHMEPVKGFLGR+LRR+L Q E Q +     L A + W+  VWQHIN+FLE HSSSDVTIGPRLFL+CPM ++ SQ+WFTD+WNY L PYL+EAVREG+Q +GRR   W DP  +I  ++PW                       G DS  PL    A    L         Q  P                                    LLNML++LQEAANYS
Sbjct: 1763 NEFVIACTYISGKTTWQNLDYVVRKTFKDYVARIDPGTNLGLNTDSITSYHLGEAKR-----GPEMGFPELLPCGYI-----VGSVRTLYICLQG-------VGSLAFDSLIPRSIVHRYISLLTEHRRLILCGPSGTGKSYLARRLAEFLVARSARGNPSEAIATFNVDHKSSKDLRQYLGHIAEQAAIA---NGVSEL-----PSVIILDNLHHASALGDVFSCLLSAGPANKLPCIIGTMSQATCNTTNLQLHHNFRWVLTANHMEPVKGFLGRFLRRRLFQLELQTQHPQPELAAVLAWLPSVWQHINRFLEVHSSSDVTIGPRLFLACPMDLKDSQVWFTDIWNYHLSPYLVEAVREGVQLYGRRGGAWNDPSAFIRNSYPW---------------------PYGPDSVPPLRQINAEDVGLEGVALTNGDQQDP------------------------------------LLNMLMRLQEAANYS 2172          

HSP 2 Score: 160.229 bits (404), Expect = 9.210e-38
Identity = 130/372 (34.95%), Postives = 184/372 (49.46%), Query Frame = 3
Query: 2706 NGSSLSLASNESR-RSMSEDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGTNLNNDNHTTVSLGRSISATVSPAHFQN------------------SLGRVKGNESNKNVAEYDSIN-NIGLIG-------SSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAFRKKFKHSDVSMSD-------------IEGDYYVHH----------LADNRS-RISNDSQNSSKNFM--------LDA----SSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIES 3632
            +GS+ SL S  S     +E++Q+ EIR+L+ EL+ A+ +V++LSS+L TNAH+ +AFE SL N+T RL +L+ T+ERKD EL  +R  IE LR+Q                          SI A ++ AH Q+                  +LG+   ++   N     +IN N G +        S++S  SL S   G S   D  K   KKGW RSSF KAF +  K S  S                  G   +H+          LA   +  + N  Q+S    +        +DA      + +E+LK+QL+E+DL LTD +LEALSSA QLE LKE++N MR EM +L+ +NERLQK+V   S
Sbjct: 1248 HGSAASLLSGGSSLYGNAEERQAHEIRRLKRELQDARDQVLSLSSQLSTNAHVVTAFEQSLSNMTNRLHQLTATAERKDGELTDMRQTIELLRKQ--------------------------SIQAGLTTAHMQSMGVQTQGQGQVQGQALGQALGQPGSDQKPPNSGSQRAINANNGSMPLGMQRQHSTDSMCSLNSISSGCSAAQDKNKANKKKGWLRSSFTKAFSRNAKISKTSRHVGHHHHHNHSQQELASGKLPLHNGHGEPLGLASLATQPAPPLPNSKQSSPAKTVTLIDNAKPIDAIDQEDQHVVEDLKKQLREKDLVLTDIRLEALSSASQLESLKEMMNKMRAEMMSLKHNNERLQKLVTTRS 1593          

HSP 3 Score: 97.4413 bits (241), Expect = 1.228e-18
Identity = 55/112 (49.11%), Postives = 68/112 (60.71%), Query Frame = 3
Query:  270 NALLT-----IYTEWANHYLEKAGFNNFVNDLQTDLCDGALLADIIIAVTGEKVPNTKPKPKTQIQQMENLNSCLIFLSNIGVVT-EGIQSKDINDGNLKAILGLLFNLSRY 587
            N +LT     IYT+WAN+YLE+A     V DL  D  DG LLA++I AVT  KVP+   KPK Q Q  +N+NSCL  L +  V   E I + DI  G LKA+L L F LSR+
Sbjct:   16 NGILTRDYAEIYTDWANYYLERAKSKRKVTDLSADCRDGLLLAEVIEAVTSFKVPDLVKKPKNQQQMFDNVNSCLHVLRSQSVGGLENITTNDICAGRLKAVLALFFALSRF 127          
BLAST of Neuron navigator 2 vs. TrEMBL
Match: A0A1Z5LEM2 (Neuron navigator 2 (Fragment) OS=Ornithodoros moubata OX=6938 PE=4 SV=1)

HSP 1 Score: 640.188 bits (1650), Expect = 0.000e+0
Identity = 409/987 (41.44%), Postives = 565/987 (57.24%), Query Frame = 3
Query: 2508 APATFEDLQLQSCFSLPSSQNFLRSNSARYTDTISSDKS--FPQNIKLPYATNTNSFISKTEIDSSQNNGSSLSLASNESRRSMS-EDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQG-TNLNNDNHTTV--SLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSINNIGLIG-SSESCTSLVSTDIGSSLENDPF--KKQAKKGWFRSSFGKAFRKKFKHSDVSMSDIE-------------------GDYYVH--HLADNRSRISNDSQNSSKNFMLDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTANKVVQYVSENTSNCASIDMFSHLFKFSSENEISIGAYVYFNDIIVSPSSVQHITNKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDSQVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQEAANYSTSPGSNDSDIA 5378
            +P+T  + +  SC   PS    L  +++RY  T S   S   P+N  +P +      +SK      + +GSS SL S  S    + E+KQ+ EIRKLR ELE A +KV TL+S+L TNAHM +AFE SL N+T RLQ L+ T+E+KD EL +LR  +E+L+QQ      S E G T +   +   V  S+G + +   +     N + R   N      A  D   +  L   S  S  S  S     SL+N     K + KKGW RSSF KAF +  K+ + S+SD+E                   G  +VH   +A N    ++ S +S+ N   + +   + +LK+QL+E+D+ LTD +LEALSSAHQL+ LKE L+ MR EM  L+ DN+RLQ++V  +S          G    S     SA S A ++    S  ++N   + M  +    +    +S+ AY+  +  +   +S   + N+  +G+  +S  + W  LD  +R  FKEY+S  DP +NLG+N ES+  Y +G + +       + E   + P        L  E  +I+++L+ TK N   +D +A +TLIPK+++ RY+SLL EHR IILCGPSGTGKT+L  KLA++L+++  ++V++ ++A F+VDHKS KELR YL+ IAEQ +SS    N  +L     P V+ILDNLHHV SL E+F+ FLS+  Q  PY+IGTM QA+ S TNLQ HHNFRWVLCANHMEPVKGFLGRYL+R+LI+ E +      SL   + W+ KVW H+NKFLE+HSSSDVTIGPRLFLSCP+ + GSQ+WFTDLWNYS+VPYLLEAVREGLQ +GRR+ WEDP +W+LQT+PW SS       +   L+RLRPEDVGYD+                    ++   +P  Q                          +    DPLLNML++LQEAA+YS SP  ND + A
Sbjct:   25 SPSTAAEYRHPSCP--PSPTRSLGQSTSRYLYTSSPLHSSHGPRN-SMPMSHYVGGLLSKMNTKDDEVHGSSTSLVSTTSSLYSTTEEKQAHEIRKLRKELEQAHEKVATLTSQLTTNAHMVAAFEQSLSNMTSRLQHLTATAEQKDSELSELRGTVEALKQQ------SAEAGLTKMALQSMAAVQRSMGNNSTCPTTTPTAANLVRRHTFNTPKDAAALQDHRMSRQLSADSMSSVNSASSACSNGSLKNGSCNKKDKKKKGWLRSSFSKAFSRSKKNRNGSVSDVEDIRAFQSDSSVPNSPLLGLGSNHVHLNGIACNGGMKTSHS-SSALNENEEDNPEAVRDLKKQLREKDMVLTDIRLEALSSAHQLDSLKETLSKMRTEMMNLKQDNDRLQRLVHSKS---------LGSSQGSLPRKSSAESIARRLSASESATSTNLDIVAMDGN--TDADGKRVSVVAYLGSHGDLGKFTSKAEVRNEAYLGAIMVSPKTKWDNLDHLVRKCFKEYVSRVDPSSNLGLNSESVLCYHIGDIVR-----SKEMELPELLPCGC-----LVGETLKIQVVLKGTKQN--AVDGMALETLIPKSIVQRYISLLTEHRRIILCGPSGTGKTFLGQKLAEYLVLKSGKDVAAGSIATFSVDHKSAKELRQYLSNIAEQCESS----NAGDL-----PTVIILDNLHHVGSLGEVFNGFLSAKYQKCPYIIGTMNQATCSTTNLQLHHNFRWVLCANHMEPVKGFLGRYLQRRLIEEEVRLSAQQPSLAKVINWMPKVWLHLNKFLETHSSSDVTIGPRLFLSCPVDVPGSQVWFTDLWNYSIVPYLLEAVREGLQLYGRRAPWEDPAEWVLQTYPWPSSG------ESPQLLRLRPEDVGYDA--------------------SAGAKVPAEQ--------------------------SEAEADPLLNMLMRLQEAASYS-SPQGNDGESA 916          
BLAST of Neuron navigator 2 vs. TrEMBL
Match: A0A1S3J6D7 (neuron navigator 2 isoform X8 OS=Lingula unguis OX=7574 GN=LOC106170586 PE=4 SV=1)

HSP 1 Score: 639.417 bits (1648), Expect = 0.000e+0
Identity = 390/905 (43.09%), Postives = 536/905 (59.23%), Query Frame = 3
Query: 2748 SMSEDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGTNLNNDNHTTVSLGR--SISATVSPAHFQNSL---GRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAFRKKFKHSDVSMSDIEGDYYVHHLAD---NRSRISNDSQNS---------------SKNFMLD-----ASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPN------EETNYNTGDEDSSAINDISATSTANKVVQYVSENTSNCASIDMFSHLFKFSSEN-EISIGAYVYFNDIIVSPSSVQHITN-----KVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDSQVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQEAANY 5342
            S +E+KQ+ EIRKL+ ELE A +KV TL+++L TNAH+ +AFE SL N+T RLQ L+ T+E KD EL +LR  IE+L++Q  T      Q  NL +   +  S  R  S+S+T S    +N+    GR+    S+++++  +S         S +C++       +  E+   KK+ K GW RSSF KAF +K K+ + S+SD+E D      AD   N   +S    +                S + + D     AS  ++  LK+QL+E+D+KLTD QLEALSSAHQL+QL++ +N MR EMS+L+ADN+RLQ+M+  +S  +      E    +TG  D              KV            S++M       S E+ + + G  +    ++     +  +T      +V+IG+  +S    W  LDS +R +F+EY+   DP  NLG+N ES+  Y +G + +           DS  P + +    L  +   I+I LR    N+  +DA AF+TLIPK+++ RYVSLLLEHR IILCGPSGTGKTYLA K+A+HL+IR  +E+S  ++A F VDHKS+KELR YLA IA+Q +SS    N  +L     P V+ILDNLH+V+SL E+F+ FLS   Q  PY+IGTM Q++ S TNLQ HHNFRWVLCANHMEPVKGFLGRYL+RKLI+AE    +++D L+  +EW+ KVW H+NKFLE+HSSSDVTIGPRLFLSCPM + GSQ+WFTDLWNYS+VPYLLEAVREG+Q +GRR+ WEDP +W++ ++PW   + K    D  SL+RLRPEDVGYDS                 Q + + Q  P+S                        +  +    DPLLNML++LQEAA+Y
Sbjct: 1597 STAEEKQNAEIRKLKRELECATEKVSTLTNQLSTNAHVVAAFEQSLSNMTSRLQNLTCTAEAKDTELAELRATIEALKKQSTT---LPFQQINLADAPLSPNSARRHASVSSTGSAYGGENATSGNGRISRQMSSESMSSLNS--------MSSACSATSQQSSTTDTESGKKKKKGKGGWLRSSFSKAFSRK-KNKNGSVSDVEPDTASMRSADSVPNSPMVSTHMPHGIHMINGPNTPVTPSLSASGLYDGIDGAASGESVVKLKKQLREKDMKLTDIQLEALSSAHQLDQLRDTMNKMRDEMSSLKADNDRLQRMMNSKSLTSSQSSDLERERRSTGSLDRE-----------RKV------GLGQHPSLEML-----LSQESPDKTEGRKIAITVLLTPTGDIGKVTEASNQPEVVIGAIPVSGKMKWDMLDSIVRRMFREYVLRVDPVTNLGLNAESVLAYHIGEITR---------TKDSGLP-ELLPCGYLVGDTTTIQISLRGVYQNS--VDAAAFETLIPKSIMQRYVSLLLEHRRIILCGPSGTGKTYLAQKMAEHLVIRSGKELSMGSIATFNVDHKSSKELRQYLANIADQCESS----NVGDL-----PSVIILDNLHNVSSLGEVFNGFLSCKYQKCPYIIGTMNQSTCSTTNLQLHHNFRWVLCANHMEPVKGFLGRYLKRKLIEAEVTGIRNND-LVKIIEWMPKVWAHLNKFLETHSSSDVTIGPRLFLSCPMDVNGSQVWFTDLWNYSIVPYLLEAVREGIQLYGRRAPWEDPAEWVIDSYPW---SKKDDGGDGPSLLRLRPEDVGYDS-----------------QGLPAGQKAPKS------------------------AAQSESEGDPLLNMLMRLQEAASY 2401          

HSP 2 Score: 138.658 bits (348), Expect = 1.105e-28
Identity = 63/112 (56.25%), Postives = 82/112 (73.21%), Query Frame = 3
Query:  252 SKTQQANALLTIYTEWANHYLEKAGFNNFVNDLQTDLCDGALLADIIIAVTGEKVPNTKPKPKTQIQQMENLNSCLIFLSNIGVVTEGIQSKDINDGNLKAILGLLFNLSRY 587
            +KT +    + IYT+WANHYLEK      + DLQ D+ DG LLAD+I AVT +KV + K KP+T  Q +ENLN+CL FL+++GV  EG+ +KDI DGNLKAILGL F+LSR+
Sbjct:   20 TKTGETAKTVQIYTDWANHYLEKNKQKRLITDLQHDITDGVLLADVIEAVTNQKVQDIKQKPRTSSQMIENLNTCLTFLAHLGVNVEGLSAKDIKDGNLKAILGLFFSLSRF 131          
BLAST of Neuron navigator 2 vs. TrEMBL
Match: V3ZVA5 (AAA domain-containing protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_131500 PE=4 SV=1)

HSP 1 Score: 632.484 bits (1630), Expect = 0.000e+0
Identity = 393/917 (42.86%), Postives = 544/917 (59.32%), Query Frame = 3
Query: 2706 NGSSLSL-ASNESRRSMSEDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGTNLNNDNHTTVSLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAFRKKFKHSDVSMSDIEGDYYVHHLADNRSRISNDSQNSSKNFMLDASSN-------------------TIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTANKVVQYVSENTSNCASIDMFSHLFKFSSENE-----ISIGAYVYFNDIIVSPSSVQHITNK---VLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDSQVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQEAANYSTSPGSNDSD 5372
            +GS+LSL +S  S  S +E++ S EIRKLR EL+ AQ KV+TLS++L TN+H+ +AFE SL N+T RLQ L+ T+E+KD EL +LR  IE+L++Q                        G S+   +SP    N   R     S   +    S +++  I S  S  S  S   G++   D  K + KKGW RSSF KAF +K K+ + SMSD+E         D +S  SN S  +S   ++ A                       + +LKQQL+E+D+KLTD +LEALSSAHQLEQL+E +N M+ EMS L+ DNERL K   + S  ++ T + +        + I  T + + + + +S   ++ +S+DM   L   ++ N+     +++  Y+  N     P   +    K   VLIG   +S  + W  LD++++ +FKEY+   DP  NLG++ ES++ Y +G V +        +E   + P        L  E  QI I L+ TK N   +D+LAF+T+IPK+++ RY+ LLLEHR IILCGPSGTGK+YLA KLA+HL++R  + +++ ++A F VDHKS+KELR YL+ IAEQ         C N +    P V+ILDNLHHVNSLA++F+ FLS   Q  PY+IGTM Q + + TNLQ HHNFRWVLCANHMEPVKGFLGRYLRRKL++AE +    ++ L   ++WI KVW H+NKFLE+HSSSDVTIGPRLFLSCPM + GSQ+WFTDLWNYSLVPY+LEAVR+GLQ +G+RS ++DP +W+++T+PW    +  R     +L+++RPEDVGYD+Q     T  SS+S++                                      +N T    DPL+NML++LQEAANYS SP SNDSD
Sbjct:    2 HGSNLSLISSASSVHSSAEERYSHEIRKLRRELDGAQDKVLTLSNQLNTNSHVVAAFEQSLSNMTARLQALTFTAEQKDSELNELRYTIEALKRQS-----------------------GISVEEVISP----NPSRRHTSPVSESGIIRQMSSDSMSSINSLSSACSATSQHSGAA--TDDGKGKKKKGWLRSSFSKAFNRK-KNKNGSMSDVE--------PDTQSLRSNISAPNSPLLLMHAGPGGPLKGSHSSGALCETEDGVNVVDLKQQLREKDMKLTDIRLEALSSAHQLEQLRETMNKMKSEMSALKCDNERLNKTGSLMSPQHQRTLHISQ-------SSIPGTRSNDSLDRSIS--LTDHSSLDM---LLAETAANDREGKRVTLAMYLGSN-----PDPTKEGIEKPAEVLIGYLSVSGKTKWDILDNNVKKIFKEYVLRVDPVTNLGLSSESLQSYHVGEVTR-----TKDSELPELLPIGY-----LVGETMQIGICLKGTKQN--TVDSLAFETMIPKSIIQRYIQLLLEHRRIILCGPSGTGKSYLAQKLAEHLVLRSGRVLTAGSVATFNVDHKSSKELRLYLSNIAEQ---------CENTIANELPGVIILDNLHHVNSLADVFNGFLSVKYQKCPYIIGTMNQQTCNATNLQLHHNFRWVLCANHMEPVKGFLGRYLRRKLVEAEVRTGIRNNDLNKIIDWIPKVWTHLNKFLETHSSSDVTIGPRLFLSCPMDIAGSQVWFTDLWNYSLVPYMLEAVRDGLQVYGKRSPFDDPSEWVIETYPWCKEGMNDR-----ALLKMRPEDVGYDTQS----THPSSTSMN--------------------------------------ANGTEADGDPLVNMLMRLQEAANYS-SPQSNDSD 794          
BLAST of Neuron navigator 2 vs. TrEMBL
Match: A0A2J7PBH5 (AAA domain-containing protein OS=Cryptotermes secundus OX=105785 GN=B7P43_G15281 PE=4 SV=1)

HSP 1 Score: 629.017 bits (1621), Expect = 0.000e+0
Identity = 459/1140 (40.26%), Postives = 624/1140 (54.74%), Query Frame = 3
Query: 2094 HRPSMSGTDSSEYSTNYACMRKY---ASDFEADLELDSSVEISTQTDKSAKMGYYSDSDSILNPRFGKLDHCQNSDLSALISEKLVGYRRLMNTSGMDPATYLSYQKNLMASK--RGTP----QSADKDRIYGIVLNSNVARSAAGPAPATFEDLQLQSCFSLPSSQNFLRSNSARYTDTISSDKSFPQNIKLPYATNTNSFISKTEIDSSQNNGSSLSLASNESR-RSMSEDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGTNLNNDNHTTVSLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSIN-NIGLIGSSESCTSLVSTDIGSSL------------------ENDPFKKQAKKGWFRSSFGKAFRKKFKHSDVSMSDIEGDYYV---------------HHLADNRSRISNDSQNSSKNF---MLDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTANKVVQYVSENTSNCASIDMFSHLFKFSSENEISIGAYVYFNDIIVSPSSVQHITNKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDSQVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQEAANYSTSPGSNDSD 5372
            HRPS      + YS NYA ++ Y   +S + + L   ++   S     SA     +DS   L     +L H + S    L   +L+ ++R    S   P   L+   ++ ++K  +  P    +S + D  YGI L SN    ++ P   T       S  S  +S  F   N +  T + SS      +I  PY+      +SKT     + +GSS+SL S  S   S  E+KQS EIRKLR EL+ AQ+KV TL+++L TNAH+ SAFE SL N+T+RLQ L+ T+ERKD ELL+LR  IE LR+Q                          S+ A ++ AH Q+          + ++A   +IN N G  G S     L STD  SS+                        K+ KKGW RSSF KAF +  K+ + S+SD+E    +               HH+  N S+I   SQ+SS  +     +A  + +E LK+QL+E+DL LTD +LEALSSAHQLE LK+ +  MR EM  L+ DNERLQ++V  +S  + +++    D   S     S T T+  +     +      S+ + SH            G+Y  + +   +PSS        +I +  +S  + W  LD  IR +FKEY+   DP +NLG++ ES+  Y +G V      +   ++   + PY  +    +   +N I + L+   L+N  +DALAF+TLIPK+++ RYVSLL EHR IILCGPSGTGK+YLANKLA+ L++R  +E ++ ++A F VDHKS+KELR YLA +AEQ +     NN  +L     P V+ILDNLHH  SL E+F+ FL++     PY+IGTM QA+ S TNLQ HHNFRWVLCANHMEPVKGFLGR+LRR+L++AE QE   ++ L    +WI KVWQH+NKFLE+HSSSDVTIGPRLFLSCP   +GSQ+WFTDLWNYS+VPYLLEAVREGLQ +GRR+ WEDP  +I QT+PW  S V+       +L+RLRPEDVGYD Q    +  +S  S+S+ QS T                                        DPLLNML++LQEAANYS+   SNDSD
Sbjct:  365 HRPSDGSLSDTTYS-NYADLQNYYANSSPYSSWLRYSATYTSSLPARASAAGLVEADSVESLCSLPAQLQHHRAS----LTHARLLMHQR---ESSASPGPRLNRSNSIRSTKSEKMYPSMLQRSEELDPYYGIPLCSNAVSHSSQPTSPT------PSQVSQGTSSRF---NYSPITTSASSHGLSRISIS-PYS----GLLSKTNSKDDEIHGSSVSLVSTASSLYSTPEEKQSHEIRKLRRELQDAQEKVHTLTNQLSTNAHVVSAFEQSLSNMTQRLQHLTSTAERKDSELLELRQTIELLRKQ--------------------------SVEAGLTSAHIQSM---------SPSLARRHTININAGAQGGSSMLRQL-STDSVSSINSLSSACSLSSSAHAPDNSTTSASKKKKKGWLRSSFSKAFSRSKKNKNGSVSDVEDSRGLSSDISAPSSPLLNAPHHM--NGSQIKG-SQSSSAIYDKEPHEARPDVVEELKKQLREKDLVLTDIRLEALSSAHQLESLKDTVIKMRNEMLNLKQDNERLQRIVTSKSLTSSQSSLPITD---SLERRFSMTETSTPL-PTDPDGKRVVVSVFLGSH------------GSYHKYIEDGNTPSSC-------VIAALFLSGKTKWDMLDCLIRRVFKEYVLRVDPVSNLGLSAESVCSYHIGEVV-----QHKDSQVPDLLPYGYL----VGDSQNSIYVCLKGA-LHNCSVDALAFETLIPKSIVQRYVSLLSEHRRIILCGPSGTGKSYLANKLAEFLVLRDGKESTAESIATFNVDHKSSKELRQYLANVAEQCE-----NNASDL-----PSVIILDNLHHAASLGEVFNGFLNAKYSKCPYIIGTMNQATCSTTNLQLHHNFRWVLCANHMEPVKGFLGRFLRRRLLEAEVQEGVRNNDLNRIFDWIPKVWQHLNKFLETHSSSDVTIGPRLFLSCPCDPDGSQVWFTDLWNYSVVPYLLEAVREGLQLYGRRAPWEDPTHFICQTYPWTGSTVQGGQ---EALLRLRPEDVGYDVQQSGGVGGSSIKSMSSTQSDTDG--------------------------------------DPLLNMLMRLQEAANYSSPHSSNDSD 1359          
BLAST of Neuron navigator 2 vs. TrEMBL
Match: A0A2J7PBH0 (AAA domain-containing protein OS=Cryptotermes secundus OX=105785 GN=B7P43_G15281 PE=4 SV=1)

HSP 1 Score: 626.706 bits (1615), Expect = 0.000e+0
Identity = 459/1140 (40.26%), Postives = 624/1140 (54.74%), Query Frame = 3
Query: 2094 HRPSMSGTDSSEYSTNYACMRKY---ASDFEADLELDSSVEISTQTDKSAKMGYYSDSDSILNPRFGKLDHCQNSDLSALISEKLVGYRRLMNTSGMDPATYLSYQKNLMASK--RGTP----QSADKDRIYGIVLNSNVARSAAGPAPATFEDLQLQSCFSLPSSQNFLRSNSARYTDTISSDKSFPQNIKLPYATNTNSFISKTEIDSSQNNGSSLSLASNESR-RSMSEDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGTNLNNDNHTTVSLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSIN-NIGLIGSSESCTSLVSTDIGSSL------------------ENDPFKKQAKKGWFRSSFGKAFRKKFKHSDVSMSDIEGDYYV---------------HHLADNRSRISNDSQNSSKNF---MLDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTANKVVQYVSENTSNCASIDMFSHLFKFSSENEISIGAYVYFNDIIVSPSSVQHITNKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDSQVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQEAANYSTSPGSNDSD 5372
            HRPS      + YS NYA ++ Y   +S + + L   ++   S     SA     +DS   L     +L H + S    L   +L+ ++R    S   P   L+   ++ ++K  +  P    +S + D  YGI L SN    ++ P   T       S  S  +S  F   N +  T + SS      +I  PY+      +SKT     + +GSS+SL S  S   S  E+KQS EIRKLR EL+ AQ+KV TL+++L TNAH+ SAFE SL N+T+RLQ L+ T+ERKD ELL+LR  IE LR+Q                          S+ A ++ AH Q+          + ++A   +IN N G  G S     L STD  SS+                        K+ KKGW RSSF KAF +  K+ + S+SD+E    +               HH+  N S+I   SQ+SS  +     +A  + +E LK+QL+E+DL LTD +LEALSSAHQLE LK+ +  MR EM  L+ DNERLQ++V  +S  + +++    D   S     S T T+  +     +      S+ + SH            G+Y  + +   +PSS        +I +  +S  + W  LD  IR +FKEY+   DP +NLG++ ES+  Y +G V      +   ++   + PY  +    +   +N I + L+   L+N  +DALAF+TLIPK+++ RYVSLL EHR IILCGPSGTGK+YLANKLA+ L++R  +E ++ ++A F VDHKS+KELR YLA +AEQ +     NN  +L     P V+ILDNLHH  SL E+F+ FL++     PY+IGTM QA+ S TNLQ HHNFRWVLCANHMEPVKGFLGR+LRR+L++AE QE   ++ L    +WI KVWQH+NKFLE+HSSSDVTIGPRLFLSCP   +GSQ+WFTDLWNYS+VPYLLEAVREGLQ +GRR+ WEDP  +I QT+PW  S V+       +L+RLRPEDVGYD Q    +  +S  S+S+ QS T                                        DPLLNML++LQEAANYS+   SNDSD
Sbjct:  156 HRPSDGSLSDTTYS-NYADLQNYYANSSPYSSWLRYSATYTSSLPARASAAGLVEADSVESLCSLPAQLQHHRAS----LTHARLLMHQR---ESSASPGPRLNRSNSIRSTKSEKMYPSMLQRSEELDPYYGIPLCSNAVSHSSQPTSPT------PSQVSQGTSSRF---NYSPITTSASSHGLSRISIS-PYS----GLLSKTNSKDDEIHGSSVSLVSTASSLYSTPEEKQSHEIRKLRRELQDAQEKVHTLTNQLSTNAHVVSAFEQSLSNMTQRLQHLTSTAERKDSELLELRQTIELLRKQ--------------------------SVEAGLTSAHIQSM---------SPSLARRHTININAGAQGGSSMLRQL-STDSVSSINSLSSACSLSSSAHAPDNSTTSASKKKKKGWLRSSFSKAFSRSKKNKNGSVSDVEDSRGLSSDISAPSSPLLNAPHHM--NGSQIKG-SQSSSAIYDKEPHEARPDVVEELKKQLREKDLVLTDIRLEALSSAHQLESLKDTVIKMRNEMLNLKQDNERLQRIVTSKSLTSSQSSLPITD---SLERRFSMTETSTPLPT-DPDGKRVVVSVFLGSH------------GSYHKYIEDGNTPSSC-------VIAALFLSGKTKWDMLDCLIRRVFKEYVLRVDPVSNLGLSAESVCSYHIGEVV-----QHKDSQVPDLLPYGYL----VGDSQNSIYVCLKGA-LHNCSVDALAFETLIPKSIVQRYVSLLSEHRRIILCGPSGTGKSYLANKLAEFLVLRDGKESTAESIATFNVDHKSSKELRQYLANVAEQCE-----NNASDL-----PSVIILDNLHHAASLGEVFNGFLNAKYSKCPYIIGTMNQATCSTTNLQLHHNFRWVLCANHMEPVKGFLGRFLRRRLLEAEVQEGVRNNDLNRIFDWIPKVWQHLNKFLETHSSSDVTIGPRLFLSCPCDPDGSQVWFTDLWNYSVVPYLLEAVREGLQLYGRRAPWEDPTHFICQTYPWTGSTVQ---GGQEALLRLRPEDVGYDVQQSGGVGGSSIKSMSSTQSDTDG--------------------------------------DPLLNMLMRLQEAANYSSPHSSNDSD 1150          
BLAST of Neuron navigator 2 vs. Ensembl Cavefish
Match: nav3 (neuron navigator 3 [Source:NCBI gene;Acc:103044466])

HSP 1 Score: 555.829 bits (1431), Expect = 1.794e-163
Identity = 348/889 (39.15%), Postives = 483/889 (54.33%), Query Frame = 3
Query: 2757 EDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGTNLNNDNHTTVSLGRSISATVSPAHFQNSLG--RVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAFRKKFKHSDVSMSDIEGDYYVHHLADNRSRISNDSQNSSKNF-----------MLDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTANKVVQYVSENTSNCASIDMFSHLFKFSSENEISI-GAYVYFNDIIVSPSSVQHITN--KVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKE-LRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDSQVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQEAANYSTSPGSNDSD 5372
            E   S++IRKLR EL+ +Q+KV TL+S+L  N+H+ +AFE SL N+T RLQ L+ T+E+K+ EL +LR  IE+L+ Q              N D  T + +     A   P H    L   R   +ES  ++    S +++G    SE       +                  W RSSF +AF KK K + +  +  E D     L  +       +Q S+                +A +  I  LK +L+E++LKLTD +LEALSSAH L+Q++E +N M+ E+ TL+A+N+RL+      S  N   +              S +S++++    +S N  N     M   L     E  +   G  V     I   S+        + LIGS  +S  + W  LD  IR LFKEY+   DP  +LG+N +SI  Y +G V +         E   + P        L  + N I + L+  + ++  +D L FDTLIPK ++ RY++LL+EHR IIL GPSGTGK++LA KLA ++I +  +EV+   LA F VD KS+K+ LR YL+T+AEQ  S               P+VVILDNLHH+ SL++IF+ FL+      PYVIGTM Q   S+ NL+ HHNFRWVLCANH EPV+GFLGR+LRRKLI+ E  +    + L+  ++WI K WQH+N FLE+HSSSDVTIGPRLFLSCPM +EG ++WFTDLWNYSLVPYL EAVREGLQ +G+R+ WEDP  W++ T+PW ++ ++    D  SL++LRPEDVGYD               S+ +   SS+ + QS                                DPL+NML++LQEAANYS++  S DSD
Sbjct: 1542 EKAHSEQIRKLRRELDASQEKVATLTSQLAANSHLVAAFEKSLGNMTGRLQSLTMTAEQKESELAELRETIEALKTQ--------------NTDAQTAIQV-----ALNGPDHLHRDLKIRRQHSSESMSSITSAASHSSLGSCKDSEDKKKKKKS------------------WLRSSFKQAFGKK-KSTKLQTAHDELDEIPDSLPASPKLQHQSNQGSTPTLHSSPSTTELCECTEAEAEIILQLKNELREKELKLTDIRLEALSSAHHLDQIREAMNRMQNEIETLKAENDRLK------SSGNSTPSATPAKTARPPSETSSTSSSSSRQSLGLSLNNLNITDTIMSDLLLDDGFEGNLRKEGRSVRIVVTICGGSNRTKAMKGQEYLIGSIGVSGKTKWDVLDGVIRRLFKEYVFRVDPLTSLGLNSDSIVSYRMGEVIR-----SHAAEVPELLPCGY-----LVGDNNIISVTLKGVRESS--IDDLVFDTLIPKPIMQRYLNLLMEHRRIILSGPSGTGKSHLATKLAHYIITKSGREVTEANLACFNVDQKSSKQDLRQYLSTLAEQCNSEHSEVEL--------PLVVILDNLHHIGSLSDIFNGFLNCKYHKCPYVIGTMNQGVSSSPNLELHHNFRWVLCANHTEPVRGFLGRFLRRKLIEMEIDKNTRSNELIKIIDWIPKTWQHLNGFLEAHSSSDVTIGPRLFLSCPMEVEGCRVWFTDLWNYSLVPYLQEAVREGLQLYGKRAAWEDPCKWVMDTYPWSAALLQ---HDGQSLLQLRPEDVGYD-------------GYSSFKDGASSKQVSQSDT----------------------------EGDPLMNMLMRLQEAANYSST-QSCDSD 2321          

HSP 2 Score: 107.071 bits (266), Expect = 1.924e-22
Identity = 49/121 (40.50%), Postives = 71/121 (58.68%), Query Frame = 3
Query:  225 MKFDSENSISKTQQANALLTIYTEWANHYLEKAGFNNFVNDLQTDLCDGALLADIIIAVTGEKVPNTKPKPKTQIQQMENLNSCLIFLSNIGVVTEGIQSKDINDGNLKAILGLLFNLSRY 587
            ++ + +    +  +   +  IYT+WANHYL KAG    + DL  D+ DG LLA II  +  EKV      P+T  Q +EN+ +CL FL   GV  + + ++++  GNLK+ILGL F LSRY
Sbjct:   47 VRVEPQERSGREAEERKICKIYTDWANHYLTKAGCPRLIKDLTQDIPDGVLLAQIIQIIANEKVEEVSDCPRTHSQMIENVEACLTFLEARGVSVQSLTAEEVCKGNLKSILGLFFILSRY 167          
BLAST of Neuron navigator 2 vs. Ensembl Cavefish
Match: nav3 (neuron navigator 3 [Source:NCBI gene;Acc:103044466])

HSP 1 Score: 553.132 bits (1424), Expect = 1.229e-162
Identity = 346/887 (39.01%), Postives = 482/887 (54.34%), Query Frame = 3
Query: 2763 KQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGTNLNNDNHTTVSLGRSISATVSPAHFQNSLG--RVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAFRKKFKHSDVSMSDIEGDYYVHHLADNRSRISNDSQNSSKNF-----------MLDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTANKVVQYVSENTSNCASIDMFSHLFKFSSENEISI-GAYVYFNDIIVSPSSVQHITN--KVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKE-LRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDSQVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQEAANYSTSPGSNDSD 5372
            + + +IRKLR EL+ +Q+KV TL+S+L  N+H+ +AFE SL N+T RLQ L+ T+E+K+ EL +LR  IE+L+ Q              N D  T + +     A   P H    L   R   +ES  ++    S +++G    SE       +                  W RSSF +AF KK K + +  +  E D     L  +       +Q S+                +A +  I  LK +L+E++LKLTD +LEALSSAH L+Q++E +N M+ E+ TL+A+N+RL+      S  N   +              S +S++++    +S N  N     M   L     E  +   G  V     I   S+        + LIGS  +S  + W  LD  IR LFKEY+   DP  +LG+N +SI  Y +G V +         E   + P        L  + N I + L+  + ++  +D L FDTLIPK ++ RY++LL+EHR IIL GPSGTGK++LA KLA ++I +  +EV+   LA F VD KS+K+ LR YL+T+AEQ  S               P+VVILDNLHH+ SL++IF+ FL+      PYVIGTM Q   S+ NL+ HHNFRWVLCANH EPV+GFLGR+LRRKLI+ E  +    + L+  ++WI K WQH+N FLE+HSSSDVTIGPRLFLSCPM +EG ++WFTDLWNYSLVPYL EAVREGLQ +G+R+ WEDP  W++ T+PW ++ ++    D  SL++LRPEDVGYD               S+ +   SS+ + QS                                DPL+NML++LQEAANYS++  S DSD
Sbjct: 1510 RNTTQIRKLRRELDASQEKVATLTSQLAANSHLVAAFEKSLGNMTGRLQSLTMTAEQKESELAELRETIEALKTQ--------------NTDAQTAIQV-----ALNGPDHLHRDLKIRRQHSSESMSSITSAASHSSLGSCKDSEDKKKKKKS------------------WLRSSFKQAFGKK-KSTKLQTAHDELDEIPDSLPASPKLQHQSNQGSTPTLHSSPSTTELCECTEAEAEIILQLKNELREKELKLTDIRLEALSSAHHLDQIREAMNRMQNEIETLKAENDRLK------SSGNSTPSATPAKTARPPSETSSTSSSSSRQSLGLSLNNLNITDTIMSDLLLDDGFEGNLRKEGRSVRIVVTICGGSNRTKAMKGQEYLIGSIGVSGKTKWDVLDGVIRRLFKEYVFRVDPLTSLGLNSDSIVSYRMGEVIR-----SHAAEVPELLPCGY-----LVGDNNIISVTLKGVRESS--IDDLVFDTLIPKPIMQRYLNLLMEHRRIILSGPSGTGKSHLATKLAHYIITKSGREVTEANLACFNVDQKSSKQDLRQYLSTLAEQCNSEHSEVEL--------PLVVILDNLHHIGSLSDIFNGFLNCKYHKCPYVIGTMNQGVSSSPNLELHHNFRWVLCANHTEPVRGFLGRFLRRKLIEMEIDKNTRSNELIKIIDWIPKTWQHLNGFLEAHSSSDVTIGPRLFLSCPMEVEGCRVWFTDLWNYSLVPYLQEAVREGLQLYGKRAAWEDPCKWVMDTYPWSAALLQ---HDGQSLLQLRPEDVGYD-------------GYSSFKDGASSKQVSQSDT----------------------------EGDPLMNMLMRLQEAANYSST-QSCDSD 2287          

HSP 2 Score: 106.301 bits (264), Expect = 2.752e-22
Identity = 49/101 (48.51%), Postives = 64/101 (63.37%), Query Frame = 3
Query:  285 IYTEWANHYLEKAGFNNFVNDLQTDLCDGALLADIIIAVTGEKVPNTKPKPKTQIQQMENLNSCLIFLSNIGVVTEGIQSKDINDGNLKAILGLLFNLSRY 587
            IYT+WANHYL KAG    + DL  D+ DG LLA II  +  EKV      P+T  Q +EN+ +CL FL   GV  + + ++++  GNLK+ILGL F LSRY
Sbjct:   25 IYTDWANHYLTKAGCPRLIKDLTQDIPDGVLLAQIIQIIANEKVEEVSDCPRTHSQMIENVEACLTFLEARGVSVQSLTAEEVCKGNLKSILGLFFILSRY 125          
BLAST of Neuron navigator 2 vs. Ensembl Cavefish
Match: nav3 (neuron navigator 3 [Source:NCBI gene;Acc:103044466])

HSP 1 Score: 552.747 bits (1423), Expect = 1.307e-162
Identity = 346/887 (39.01%), Postives = 482/887 (54.34%), Query Frame = 3
Query: 2763 KQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGTNLNNDNHTTVSLGRSISATVSPAHFQNSLG--RVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAFRKKFKHSDVSMSDIEGDYYVHHLADNRSRISNDSQNSSKNF-----------MLDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTANKVVQYVSENTSNCASIDMFSHLFKFSSENEISI-GAYVYFNDIIVSPSSVQHITN--KVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKE-LRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDSQVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQEAANYSTSPGSNDSD 5372
            + + +IRKLR EL+ +Q+KV TL+S+L  N+H+ +AFE SL N+T RLQ L+ T+E+K+ EL +LR  IE+L+ Q              N D  T + +     A   P H    L   R   +ES  ++    S +++G    SE       +                  W RSSF +AF KK K + +  +  E D     L  +       +Q S+                +A +  I  LK +L+E++LKLTD +LEALSSAH L+Q++E +N M+ E+ TL+A+N+RL+      S  N   +              S +S++++    +S N  N     M   L     E  +   G  V     I   S+        + LIGS  +S  + W  LD  IR LFKEY+   DP  +LG+N +SI  Y +G V +         E   + P        L  + N I + L+  + ++  +D L FDTLIPK ++ RY++LL+EHR IIL GPSGTGK++LA KLA ++I +  +EV+   LA F VD KS+K+ LR YL+T+AEQ  S               P+VVILDNLHH+ SL++IF+ FL+      PYVIGTM Q   S+ NL+ HHNFRWVLCANH EPV+GFLGR+LRRKLI+ E  +    + L+  ++WI K WQH+N FLE+HSSSDVTIGPRLFLSCPM +EG ++WFTDLWNYSLVPYL EAVREGLQ +G+R+ WEDP  W++ T+PW ++ ++    D  SL++LRPEDVGYD               S+ +   SS+ + QS                                DPL+NML++LQEAANYS++  S DSD
Sbjct: 1496 RNTTQIRKLRRELDASQEKVATLTSQLAANSHLVAAFEKSLGNMTGRLQSLTMTAEQKESELAELRETIEALKTQ--------------NTDAQTAIQV-----ALNGPDHLHRDLKIRRQHSSESMSSITSAASHSSLGSCKDSEDKKKKKKS------------------WLRSSFKQAFGKK-KSTKLQTAHDELDEIPDSLPASPKLQHQSNQGSTPTLHSSPSTTELCECTEAEAEIILQLKNELREKELKLTDIRLEALSSAHHLDQIREAMNRMQNEIETLKAENDRLK------SSGNSTPSATPAKTARPPSETSSTSSSSSRQSLGLSLNNLNITDTIMSDLLLDDGFEGNLRKEGRSVRIVVTICGGSNRTKAMKGQEYLIGSIGVSGKTKWDVLDGVIRRLFKEYVFRVDPLTSLGLNSDSIVSYRMGEVIR-----SHAAEVPELLPCGY-----LVGDNNIISVTLKGVRESS--IDDLVFDTLIPKPIMQRYLNLLMEHRRIILSGPSGTGKSHLATKLAHYIITKSGREVTEANLACFNVDQKSSKQDLRQYLSTLAEQCNSEHSEVEL--------PLVVILDNLHHIGSLSDIFNGFLNCKYHKCPYVIGTMNQGVSSSPNLELHHNFRWVLCANHTEPVRGFLGRFLRRKLIEMEIDKNTRSNELIKIIDWIPKTWQHLNGFLEAHSSSDVTIGPRLFLSCPMEVEGCRVWFTDLWNYSLVPYLQEAVREGLQLYGKRAAWEDPCKWVMDTYPWSAALLQ---HDGQSLLQLRPEDVGYD-------------GYSSFKDGASSKQVSQSDT----------------------------EGDPLMNMLMRLQEAANYSST-QSCDSD 2273          

HSP 2 Score: 106.301 bits (264), Expect = 2.635e-22
Identity = 49/101 (48.51%), Postives = 64/101 (63.37%), Query Frame = 3
Query:  285 IYTEWANHYLEKAGFNNFVNDLQTDLCDGALLADIIIAVTGEKVPNTKPKPKTQIQQMENLNSCLIFLSNIGVVTEGIQSKDINDGNLKAILGLLFNLSRY 587
            IYT+WANHYL KAG    + DL  D+ DG LLA II  +  EKV      P+T  Q +EN+ +CL FL   GV  + + ++++  GNLK+ILGL F LSRY
Sbjct:   25 IYTDWANHYLTKAGCPRLIKDLTQDIPDGVLLAQIIQIIANEKVEEVSDCPRTHSQMIENVEACLTFLEARGVSVQSLTAEEVCKGNLKSILGLFFILSRY 125          
BLAST of Neuron navigator 2 vs. Ensembl Cavefish
Match: nav3 (neuron navigator 3 [Source:NCBI gene;Acc:103044466])

HSP 1 Score: 552.362 bits (1422), Expect = 2.930e-162
Identity = 346/887 (39.01%), Postives = 482/887 (54.34%), Query Frame = 3
Query: 2763 KQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGTNLNNDNHTTVSLGRSISATVSPAHFQNSLG--RVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAFRKKFKHSDVSMSDIEGDYYVHHLADNRSRISNDSQNSSKNF-----------MLDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTANKVVQYVSENTSNCASIDMFSHLFKFSSENEISI-GAYVYFNDIIVSPSSVQHITN--KVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKE-LRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDSQVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQEAANYSTSPGSNDSD 5372
            + + +IRKLR EL+ +Q+KV TL+S+L  N+H+ +AFE SL N+T RLQ L+ T+E+K+ EL +LR  IE+L+ Q              N D  T + +     A   P H    L   R   +ES  ++    S +++G    SE       +                  W RSSF +AF KK K + +  +  E D     L  +       +Q S+                +A +  I  LK +L+E++LKLTD +LEALSSAH L+Q++E +N M+ E+ TL+A+N+RL+      S  N   +              S +S++++    +S N  N     M   L     E  +   G  V     I   S+        + LIGS  +S  + W  LD  IR LFKEY+   DP  +LG+N +SI  Y +G V +         E   + P        L  + N I + L+  + ++  +D L FDTLIPK ++ RY++LL+EHR IIL GPSGTGK++LA KLA ++I +  +EV+   LA F VD KS+K+ LR YL+T+AEQ  S               P+VVILDNLHH+ SL++IF+ FL+      PYVIGTM Q   S+ NL+ HHNFRWVLCANH EPV+GFLGR+LRRKLI+ E  +    + L+  ++WI K WQH+N FLE+HSSSDVTIGPRLFLSCPM +EG ++WFTDLWNYSLVPYL EAVREGLQ +G+R+ WEDP  W++ T+PW ++ ++    D  SL++LRPEDVGYD               S+ +   SS+ + QS                                DPL+NML++LQEAANYS++  S DSD
Sbjct: 1545 RNTTQIRKLRRELDASQEKVATLTSQLAANSHLVAAFEKSLGNMTGRLQSLTMTAEQKESELAELRETIEALKTQ--------------NTDAQTAIQV-----ALNGPDHLHRDLKIRRQHSSESMSSITSAASHSSLGSCKDSEDKKKKKKS------------------WLRSSFKQAFGKK-KSTKLQTAHDELDEIPDSLPASPKLQHQSNQGSTPTLHSSPSTTELCECTEAEAEIILQLKNELREKELKLTDIRLEALSSAHHLDQIREAMNRMQNEIETLKAENDRLK------SSGNSTPSATPAKTARPPSETSSTSSSSSRQSLGLSLNNLNITDTIMSDLLLDDGFEGNLRKEGRSVRIVVTICGGSNRTKAMKGQEYLIGSIGVSGKTKWDVLDGVIRRLFKEYVFRVDPLTSLGLNSDSIVSYRMGEVIR-----SHAAEVPELLPCGY-----LVGDNNIISVTLKGVRESS--IDDLVFDTLIPKPIMQRYLNLLMEHRRIILSGPSGTGKSHLATKLAHYIITKSGREVTEANLACFNVDQKSSKQDLRQYLSTLAEQCNSEHSEVEL--------PLVVILDNLHHIGSLSDIFNGFLNCKYHKCPYVIGTMNQGVSSSPNLELHHNFRWVLCANHTEPVRGFLGRFLRRKLIEMEIDKNTRSNELIKIIDWIPKTWQHLNGFLEAHSSSDVTIGPRLFLSCPMEVEGCRVWFTDLWNYSLVPYLQEAVREGLQLYGKRAAWEDPCKWVMDTYPWSAALLQ---HDGQSLLQLRPEDVGYD-------------GYSSFKDGASSKQVSQSDT----------------------------EGDPLMNMLMRLQEAANYSST-QSCDSD 2322          

HSP 2 Score: 107.071 bits (266), Expect = 1.783e-22
Identity = 49/121 (40.50%), Postives = 71/121 (58.68%), Query Frame = 3
Query:  225 MKFDSENSISKTQQANALLTIYTEWANHYLEKAGFNNFVNDLQTDLCDGALLADIIIAVTGEKVPNTKPKPKTQIQQMENLNSCLIFLSNIGVVTEGIQSKDINDGNLKAILGLLFNLSRY 587
            ++ + +    +  +   +  IYT+WANHYL KAG    + DL  D+ DG LLA II  +  EKV      P+T  Q +EN+ +CL FL   GV  + + ++++  GNLK+ILGL F LSRY
Sbjct:   47 VRVEPQERSGREAEERKICKIYTDWANHYLTKAGCPRLIKDLTQDIPDGVLLAQIIQIIANEKVEEVSDCPRTHSQMIENVEACLTFLEARGVSVQSLTAEEVCKGNLKSILGLFFILSRY 167          
BLAST of Neuron navigator 2 vs. Ensembl Cavefish
Match: nav3 (neuron navigator 3 [Source:NCBI gene;Acc:103044466])

HSP 1 Score: 551.977 bits (1421), Expect = 3.139e-162
Identity = 346/887 (39.01%), Postives = 482/887 (54.34%), Query Frame = 3
Query: 2763 KQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGTNLNNDNHTTVSLGRSISATVSPAHFQNSLG--RVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAFRKKFKHSDVSMSDIEGDYYVHHLADNRSRISNDSQNSSKNF-----------MLDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTANKVVQYVSENTSNCASIDMFSHLFKFSSENEISI-GAYVYFNDIIVSPSSVQHITN--KVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKE-LRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDSQVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQEAANYSTSPGSNDSD 5372
            + + +IRKLR EL+ +Q+KV TL+S+L  N+H+ +AFE SL N+T RLQ L+ T+E+K+ EL +LR  IE+L+ Q              N D  T + +     A   P H    L   R   +ES  ++    S +++G    SE       +                  W RSSF +AF KK K + +  +  E D     L  +       +Q S+                +A +  I  LK +L+E++LKLTD +LEALSSAH L+Q++E +N M+ E+ TL+A+N+RL+      S  N   +              S +S++++    +S N  N     M   L     E  +   G  V     I   S+        + LIGS  +S  + W  LD  IR LFKEY+   DP  +LG+N +SI  Y +G V +         E   + P        L  + N I + L+  + ++  +D L FDTLIPK ++ RY++LL+EHR IIL GPSGTGK++LA KLA ++I +  +EV+   LA F VD KS+K+ LR YL+T+AEQ  S               P+VVILDNLHH+ SL++IF+ FL+      PYVIGTM Q   S+ NL+ HHNFRWVLCANH EPV+GFLGR+LRRKLI+ E  +    + L+  ++WI K WQH+N FLE+HSSSDVTIGPRLFLSCPM +EG ++WFTDLWNYSLVPYL EAVREGLQ +G+R+ WEDP  W++ T+PW ++ ++    D  SL++LRPEDVGYD               S+ +   SS+ + QS                                DPL+NML++LQEAANYS++  S DSD
Sbjct: 1552 RNTTQIRKLRRELDASQEKVATLTSQLAANSHLVAAFEKSLGNMTGRLQSLTMTAEQKESELAELRETIEALKTQ--------------NTDAQTAIQV-----ALNGPDHLHRDLKIRRQHSSESMSSITSAASHSSLGSCKDSEDKKKKKKS------------------WLRSSFKQAFGKK-KSTKLQTAHDELDEIPDSLPASPKLQHQSNQGSTPTLHSSPSTTELCECTEAEAEIILQLKNELREKELKLTDIRLEALSSAHHLDQIREAMNRMQNEIETLKAENDRLK------SSGNSTPSATPAKTARPPSETSSTSSSSSRQSLGLSLNNLNITDTIMSDLLLDDGFEGNLRKEGRSVRIVVTICGGSNRTKAMKGQEYLIGSIGVSGKTKWDVLDGVIRRLFKEYVFRVDPLTSLGLNSDSIVSYRMGEVIR-----SHAAEVPELLPCGY-----LVGDNNIISVTLKGVRESS--IDDLVFDTLIPKPIMQRYLNLLMEHRRIILSGPSGTGKSHLATKLAHYIITKSGREVTEANLACFNVDQKSSKQDLRQYLSTLAEQCNSEHSEVEL--------PLVVILDNLHHIGSLSDIFNGFLNCKYHKCPYVIGTMNQGVSSSPNLELHHNFRWVLCANHTEPVRGFLGRFLRRKLIEMEIDKNTRSNELIKIIDWIPKTWQHLNGFLEAHSSSDVTIGPRLFLSCPMEVEGCRVWFTDLWNYSLVPYLQEAVREGLQLYGKRAAWEDPCKWVMDTYPWSAALLQ---HDGQSLLQLRPEDVGYD-------------GYSSFKDGASSKQVSQSDT----------------------------EGDPLMNMLMRLQEAANYSST-QSCDSD 2329          

HSP 2 Score: 107.071 bits (266), Expect = 1.755e-22
Identity = 49/121 (40.50%), Postives = 71/121 (58.68%), Query Frame = 3
Query:  225 MKFDSENSISKTQQANALLTIYTEWANHYLEKAGFNNFVNDLQTDLCDGALLADIIIAVTGEKVPNTKPKPKTQIQQMENLNSCLIFLSNIGVVTEGIQSKDINDGNLKAILGLLFNLSRY 587
            ++ + +    +  +   +  IYT+WANHYL KAG    + DL  D+ DG LLA II  +  EKV      P+T  Q +EN+ +CL FL   GV  + + ++++  GNLK+ILGL F LSRY
Sbjct:   47 VRVEPQERSGREAEERKICKIYTDWANHYLTKAGCPRLIKDLTQDIPDGVLLAQIIQIIANEKVEEVSDCPRTHSQMIENVEACLTFLEARGVSVQSLTAEEVCKGNLKSILGLFFILSRY 167          
BLAST of Neuron navigator 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000554.1 (pep scaffold:Pmarinus_7.0:GL476467:19579:154902:-1 gene:ENSPMAG00000000485.1 transcript:ENSPMAT00000000554.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 509.22 bits (1310), Expect = 2.064e-148
Identity = 278/651 (42.70%), Postives = 393/651 (60.37%), Query Frame = 3
Query: 3450 IENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTANKVVQYV-----SENTSNCASIDMF---SHLFKFSSENEISIGAYVYFNDIIV--SPSSVQHITNKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDSQVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQEAANYSTSPGSNDSD 5372
            +  L+ +L+E+++KLTD +LEALSSAHQL+QL+E +N M+ E+  L+A+N+RL+      SD         G  + S      + S+ +   Q V     S N     S+DM          + ++  ++   V   D+      S +Q  T    IGS  +S  + W  LD  +R LFKEY+   DP  NLG++ +S+  Y++G + +       +++   + P        L  E   I++ L+    ++  LD+L F+TLIPK  L RYVSLL+EHR IIL GPSGTGKT+LAN+LA+ ++ R  ++V+   +A F VDHKS+KELR YL  +A+Q  S    +N  ++     P+V+ILDNLHH+ SL +IF+ FL+   Q  PY+IGTM QA+ S  NLQ HHNFRWVLCANH+EPV GFLGR+LRRKLI+ E Q    ++ L+  ++W+ KVWQH+N+FLE+HSSSDVTIGPRLFLSCPM + GS++WFTDLWNYS++PY+LEAVREGLQ +GRRS WEDP  W+++T+PW S+ ++    D  +L++LRPEDVG+D               ++ +  ++S+  P S                                DPL+NML++LQEAANYS SP S DSD
Sbjct: 1798 VMQLRSELREKEMKLTDIRLEALSSAHQLDQLRESMNRMQSEIEKLKAENDRLK------SD---------GGGNCSRAQSQLSMSSTSSPRQSVGLSQHSLNLPESTSLDMLLDDGSGDGSTRKDRRNVKIVVSLTDLPKRREDSKIQEYT----IGSIGVSGKTKWDVLDGVVRRLFKEYILRVDPLTNLGLSTDSVLGYSIGDLVR-----SRESDVPELLPCGY-----LVGENTTIRVALKGMVEHS--LDSLVFETLIPKATLQRYVSLLMEHRRIILSGPSGTGKTFLANRLAEFIVQRSGRDVTDGVIATFNVDHKSSKELRQYLLNLADQCNS---ESNAADM-----PLVIILDNLHHIGSLGDIFNGFLNCKYQKCPYIIGTMNQATTSTPNLQLHHNFRWVLCANHVEPVNGFLGRFLRRKLIETEIQSSSRNNDLIRIMDWMPKVWQHLNRFLEAHSSSDVTIGPRLFLSCPMDVGGSRVWFTDLWNYSIIPYVLEAVREGLQLYGRRSAWEDPAKWVMETYPWASTPLQ---HDWPTLLQLRPEDVGFD-------------GYTSAREGSTSKPAPPSDV----------------------------EGDPLMNMLMRLQEAANYS-SPQSCDSD 2364          

HSP 2 Score: 121.709 bits (304), Expect = 1.371e-27
Identity = 53/101 (52.48%), Postives = 74/101 (73.27%), Query Frame = 3
Query:  285 IYTEWANHYLEKAGFNNFVNDLQTDLCDGALLADIIIAVTGEKVPNTKPKPKTQIQQMENLNSCLIFLSNIGVVTEGIQSKDINDGNLKAILGLLFNLSRY 587
            IYT+WANHYL K+G    + DLQ D+ DG LLA+II  V  EK+ +    P++Q Q +EN+++CL FL++ GV  +G+ S++I +GNLKAILGL F+LSRY
Sbjct:    2 IYTDWANHYLAKSGHKRLIRDLQQDVSDGVLLAEIIQVVANEKIEDINGCPRSQAQMVENIDACLSFLASKGVNIQGLSSEEIRNGNLKAILGLFFSLSRY 102          

HSP 3 Score: 85.1149 bits (209), Expect = 1.557e-16
Identity = 41/77 (53.25%), Postives = 59/77 (76.62%), Query Frame = 3
Query: 2757 EDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQ 2987
            E   S+++RKLR EL+ +Q+KV TL+++L TNAH+ +AFE SL N+T RLQ L+ T+E+KD EL +LR  IE L++Q
Sbjct: 1559 EKAVSEQMRKLRRELDQSQEKVATLTAQLTTNAHLVAAFEQSLANMTSRLQSLTMTAEQKDSELNELRKTIEMLKRQ 1635          
BLAST of Neuron navigator 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005258.1 (pep scaffold:Pmarinus_7.0:GL479251:795:35698:-1 gene:ENSPMAG00000004752.1 transcript:ENSPMAT00000005258.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 228.409 bits (581), Expect = 1.405e-60
Identity = 197/684 (28.80%), Postives = 338/684 (49.42%), Query Frame = 3
Query: 2700 QNNGSSLSLAS-NESRRSMSEDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGTNLNNDNHTTVSLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGW---FRSSFGKAF----------RKKFKHSDVSMSDIEGDYYVH---HLADNRSRIS--NDSQNSSKNFMLD-----ASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTANKVVQYVSENTSNCASIDMFSHLFKFSSENEISIGAYVYFNDIIVSPSSV--QHITNKV---LIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSIT-PYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSN---IQNRPYVIGTMTQASFSNTNLQAHHNFR 4652
            Q +GS LSLAS   S  S+ ++K   EI  LR EL+ +Q KV TL+ +L TNA++ +AFE SL ++T RLQ L+ ++E+KD EL +LR +I++L ++   N  + E  + + +         +S + ++SP   +  L R    ES        S+N+I         TS  S ++  +       K+ KKGW    + SF +AF            +   S  + +       +H   ++  +R +      S++     + D        +TI  L+ +L+ +++KLTD +LEAL+SAHQL  L++ +N+M+  + +L+ +N++L+               +T    ++   + +A  T+ + ++   +++ +  S      L K S +      A      ++VS +    Q  T+KV    +G   I ES+TW +LD  IR +FKEY+   DP ++LG++ ESI  Y +G+V++      ++N  + +  P+ S+     E  E  I I L+   L    LD+LAF+ L PK VL R   LLL+HR ++LCGP G+GK+ LA +L + L+ R    V+  T+A F+V+  +  E+R YL  +AE      +  +         P V+ILD L       ++    ++     +   PY+IG   Q + +  +++ H N R
Sbjct:  704 QLHGSVLSLASCTSSIYSVPDEKSQSEIETLRRELDQSQDKVSTLTGQLSTNANLVAAFEKSLTSMTSRLQNLTASAEQKDSELGELRKMIDNLTKE---NMAAQEAMSGVLSTTQ------QSNTGSLSPQAGEPRLHRQNSCES------ISSVNSI---------TSHSSAELADA-------KKKKKGWAPQLKISFRQAFSKKKGGKGPGEGEPGKSSETSAQPAATKCLHSNGYIMSSRGQCPALKSSESMCHAVVSDYRQPPPEVDTIMQLRSELRHKEMKLTDIRLEALNSAHQLNTLQDAMNSMQSMIESLKVENDQLKS--------------DTPVVGAATAPEGTAEPTSPRPLRSRLQHSRSLPSTSNLESLLKDSVDK-----AQCKQVRLVVSSAESWRQSKTSKVTQFALGRVDIGESTTWEELDGIIRHVFKEYIIRVDPVSSLGLSSESIVGYNVGAVRR------TRNSPEPVPLPWDSLP----EDGEPCIAISLKG--LGESSLDSLAFEGLTPKPVLQRCSGLLLDHRHLVLCGPPGSGKSCLAAQLGQWLVRRAGLRVTDDTVATFSVNQSTADEIRQYLVDLAELCSGGLEIGDV--------PRVIILDGLQEAGQPGDLLTPAINCQHHVLCTSPYLIGIFEQVTSATPDVKLHPNVR 1317          
BLAST of Neuron navigator 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005257.1 (pep scaffold:Pmarinus_7.0:GL479251:795:35698:-1 gene:ENSPMAG00000004752.1 transcript:ENSPMAT00000005257.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 227.254 bits (578), Expect = 4.292e-60
Identity = 194/682 (28.45%), Postives = 333/682 (48.83%), Query Frame = 3
Query: 2706 NGSSLSLAS-NESRRSMSEDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGTNLNNDNHTTVSLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGW---FRSSFGKAF----------RKKFKHSDVSMSDIEGDYYVH---HLADNRSRIS--NDSQNSSKNFMLD-----ASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTANKVVQYVSENTSNCASIDMFSHLFKFSSENEISIGAYVYFNDIIVSPSSV--QHITNKV---LIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSIT-PYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSN---IQNRPYVIGTMTQASFSNTNLQAHHNFR 4652
            +GS LSLAS   S  S+ ++K   EI  LR EL+ +Q KV TL+ +L TNA++ +AFE SL ++T RLQ L+ ++E+KD EL +LR +I++L ++      +     +    ++T          ++SP   +  L R    ES        S+N+I         TS  S ++  +       K+ KKGW    + SF +AF            +   S  + +       +H   ++  +R +      S++     + D        +TI  L+ +L+ +++KLTD +LEAL+SAHQL  L++ +N+M+  + +L+ +N++L+               +T    ++   + +A  T+ + ++   +++ +  S      L K S +      A      ++VS +    Q  T+KV    +G   I ES+TW +LD  IR +FKEY+   DP ++LG++ ESI  Y +G+V++      ++N  + +  P+ S+     E  E  I I L+   L    LD+LAF+ L PK VL R   LLL+HR ++LCGP G+GK+ LA +L + L+ R    V+  T+A F+V+  +  E+R YL  +AE      +  +         P V+ILD L       ++    ++     +   PY+IG   Q + +  +++ H N R
Sbjct:  742 HGSVLSLASCTSSIYSVPDEKSQSEIETLRRELDQSQDKVSTLTGQLSTNANLVAAFEKSLTSMTSRLQNLTASAEQKDSELGELRKMIDNLTKENMAAQEAMSGVLSTTQQSNT---------GSLSPQAGEPRLHRQNSCES------ISSVNSI---------TSHSSAELADA-------KKKKKGWAPQLKISFRQAFSKKKGGKGPGEGEPGKSSETSAQPAATKCLHSNGYIMSSRGQCPALKSSESMCHAVVSDYRQPPPEVDTIMQLRSELRHKEMKLTDIRLEALNSAHQLNTLQDAMNSMQSMIESLKVENDQLKS--------------DTPVVGAATAPEGTAEPTSPRPLRSRLQHSRSLPSTSNLESLLKDSVDK-----AQCKQVRLVVSSAESWRQSKTSKVTQFALGRVDIGESTTWEELDGIIRHVFKEYIIRVDPVSSLGLSSESIVGYNVGAVRR------TRNSPEPVPLPWDSLP----EDGEPCIAISLKG--LGESSLDSLAFEGLTPKPVLQRCSGLLLDHRHLVLCGPPGSGKSCLAAQLGQWLVRRAGLRVTDDTVATFSVNQSTADEIRQYLVDLAELCSGGLEIGDV--------PRVIILDGLQEAGQPGDLLTPAINCQHHVLCTSPYLIGIFEQVTSATPDVKLHPNVR 1353          
BLAST of Neuron navigator 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005268.1 (pep scaffold:Pmarinus_7.0:GL479251:795:35698:-1 gene:ENSPMAG00000004752.1 transcript:ENSPMAT00000005268.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 221.861 bits (564), Expect = 1.548e-58
Identity = 195/673 (28.97%), Postives = 332/673 (49.33%), Query Frame = 3
Query: 2700 QNNGSSLSLASNESRRSMSEDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGTNLNNDNHTTVSLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAF--RKKFKHSDVSMSDIEGDYYVHHLADNRSRISNDSQNSSKNFMLDAS-----------SNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTANKVVQYVSENTSNCASIDMFSHLFKFSSENEISIGAYVYFNDIIVSPSSV--QHITNKV---LIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSIT-PYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSN---IQNRPYVIGTMTQASFSNTNLQAHHNFR 4652
            Q +GS LSLAS  S         S +I  LR EL+ +Q KV TL+ +L TNA++ +AFE SL ++T RLQ L+ ++E+KD EL +LR +I++L ++   N  + E  + + +         +S + ++SP   +  L R    ES        S+N+I         TS  S ++  +       K+ KKGW + SF +AF  +K  K           +      A + +  +   Q  +K     A             +TI  L+ +L+ +++KLTD +LEAL+SAHQL  L++ +N+M+  + +L+ +N++L+    +           T  E ++   + ++       +Q+ S +  + +++ + + L+  S   +    A      ++VS +    Q  T+KV    +G   I ES+TW +LD  IR +FKEY+   DP ++LG++ ESI  Y +G+V++      ++N  + +  P+ S+     E  E  I I L+   L    LD+LAF+ L PK VL R   LLL+HR ++LCGP G+GK+ LA +L + L+ R    V+  T+A F+V+  +  E+R YL  +AE      +  +         P V+ILD L       ++    ++     +   PY+IG   Q + +  +++ H N R
Sbjct:  650 QLHGSVLSLASCTS------SIYSVQIETLRRELDQSQDKVSTLTGQLSTNANLVAAFEKSLTSMTSRLQNLTASAEQKDSELGELRKMIDNLTKE---NMAAQEAMSGVLSTTQ------QSNTGSLSPQAGEPRLHRQNSCES------ISSVNSI---------TSHSSAELADA-------KKKKKGWLKISFRQAFSKKKGGKGPGEGEPGKSSETSAQPAATSEADTTTPGQPGTKPSEGPAGYGFTDKQPPPEVDTIMQLRSELRHKEMKLTDIRLEALNSAHQLNTLQDAMNSMQSMIESLKVENDQLKSDTPV-------VGAATAPEGTA---EPTSPRPLRSRLQH-SRSLPSTSNLALTTRLYSQSLLKDSVDKAQCKQVRLVVSSAESWRQSKTSKVTQFALGRVDIGESTTWEELDGIIRHVFKEYIIRVDPVSSLGLSSESIVGYNVGAVRR------TRNSPEPVPLPWDSLP----EDGEPCIAISLKG--LGESSLDSLAFEGLTPKPVLQRCSGLLLDHRHLVLCGPPGSGKSCLAAQLGQWLVRRAGLRVTDDTVATFSVNQSTADEIRQYLVDLAELCSGGLEIGDV--------PRVIILDGLQEAGQPGDLLTPAINCQHHVLCTSPYLIGIFEQVTSATPDVKLHPNVR 1254          
BLAST of Neuron navigator 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008111.1 (pep scaffold:Pmarinus_7.0:GL478136:8967:48859:1 gene:ENSPMAG00000007298.1 transcript:ENSPMAT00000008111.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.2326 bits (147), Expect = 2.980e-9
Identity = 42/132 (31.82%), Postives = 72/132 (54.55%), Query Frame = 3
Query:  219 NEMKFDSENSISKTQQANALLTI-----------YTEWANHYLEKAGFNNFVNDLQTDLCDGALLADIIIAVTGEKVPNTKP-KPKTQIQQMENLNSCLIFLSNIGVVTEGIQSKDINDGNLKAILGLLFNL 578
            +E  +D+ENS ++  + + +  +           +T+W N +L +      + DL TDL DG +L  ++  ++GEK+P  KP + K +I  +EN++  L FL    V  E + S DI DGN + ILGL++ +
Sbjct:   29 SEEDWDNENSSARLFERSRIKALADEREAVQKKTFTKWVNSHLARVSCR--ITDLYTDLRDGRMLIKLLEVLSGEKLP--KPTRGKMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLILGLIWTI 156          
BLAST of Neuron navigator 2 vs. Ensembl Nematostella
Match: EDO39746 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9A1])

HSP 1 Score: 150.214 bits (378), Expect = 4.875e-36
Identity = 134/559 (23.97%), Postives = 245/559 (43.83%), Query Frame = 3
Query: 3507 LEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTANKVVQYVSENTSNCAS-----------IDMFSHLFKFSSENEISIGAYVYFNDIIVSPSSVQHITNKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANL--------GI-------NPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSP--PIVVILDNLHHVNSLAEIFDSFL---SSNIQNRPYVIGTMTQAS----FSNTNLQAHHNFRWVL-------CANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLL------ATVEWISKVWQHINKFLESHSSSD---VTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPW 5030
            +EA  + HQ ++L+ ++N ++ E+  L+ +N+ L+  V      +   +  TG+  S A   + A ST +      +++   C S           + +F   F F    +  I   V+      S        + V++G+  +   S W+ +    +  F E+L   DP++ L        G+        P++I  +T      R  N    +  D+I   +    +++  + N    IL      N   D+L ++TL+P+ V+  ++  +LEHR +ILCGP G GK++LA+KLA+HL  R +   S + + + TV   S ++L+  LA +           +C ++  R+   P V++LD L+ + SLA+IF+      +SN  +   ++      +      N  L+ + +    L       C       +G+ G     ++I    Q  ++   L+      A +E    +        +S S SD       P LF SCPM    ++ WF ++WNY ++PYL + +R   + + R   W+DP  W++  WPW
Sbjct: 2023 MEAYVALHQADELQSIINEIKGELRLLKEENKVLRSQV------DGLAHDKTGEVRSVAETSVDAGSTGS------ADSKRGCVSATPPTHEKVFVVLIFYIPFHFLVSYDEMISVDVFLRGFGKSVGIRHPKKSDVMLGTVLVKGGSDWAGVYDAAKKSFSEHLKLVDPYSYLGLSSSSLHGVETGAVMWTPDTIRRHTPRVEISRKHNSCILHLKDTI--RRHTPRVEISRKHNSC--ILHLKDGTNESCDSLVYNTLLPRKVIEDFLYQVLEHRYVILCGPVGLGKSFLASKLAEHLAERLNWRASPSVITL-TVGQTSRRDLKKTLARLM----------SC-DIYSRAEGVPAVIVLDQLNCLASLADIFEPAQLADNSNSDDEELLLDLFVWLTEVWHHINRILEDYCSLDVTLGPSLFYSCPMDFHSAEGWFGNVWNYQVIPYLHQTIRNSSKLVTSLKRGAQLEIAGSLESWTTAEFQSESDSDRESAVHCPSLFYSCPMDFHSAEGWFGNVWNYQVIPYLHQTIRNSSKIYERNIVWDDPTKWVIMRWPW 2553          
BLAST of Neuron navigator 2 vs. Ensembl Nematostella
Match: EDO31588 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXH4])

HSP 1 Score: 72.7886 bits (177), Expect = 1.798e-13
Identity = 38/99 (38.38%), Postives = 56/99 (56.57%), Query Frame = 3
Query:  288 YTEWANHYLEKAGFNNFVNDLQTDLCDGALLADIIIAVTGEKVPNTKPKPKTQIQQMENLNSCLIFLSNIGVVTEGIQSKDINDGNLKAILGLLFNLSR 584
            YT W N  L K G +  + D++  + DG  L  ++  +  EK+P    KP T+ Q++ENL  C+ F+ N  +  +GI   D+ DGNLK+IL L  NL R
Sbjct:  115 YTIWTN-LLMKRGRHRQITDIRKSIGDGQTLVYMLEVLAQEKIPGVYAKPVTRAQKLENLQLCMSFMGNREINLQGIYVGDLIDGNLKSILALCGNLRR 212          
BLAST of Neuron navigator 2 vs. Ensembl Nematostella
Match: EDO49576 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGP7])

HSP 1 Score: 67.3958 bits (163), Expect = 5.603e-11
Identity = 35/95 (36.84%), Postives = 59/95 (62.11%), Query Frame = 3
Query:  288 YTEWANHYLEKAGFNNFVNDLQTDLCDGALLADIIIAVTGEKVPNTKPKPKTQIQQMENLNSCLIFLSNIGVVTEGIQSKDINDGNLKAILGLLF 572
            +T+W N +L+K+G +  VNDL  DL DG +L  ++  ++GEK+     + K ++  ++N+N  L FL    V  E I ++D+ DGN + ILGL++
Sbjct:   29 FTKWVNSFLDKSGLH--VNDLFEDLADGKILISLLEIISGEKI-GFAARGKFRVHNIQNVNKALEFLQK-SVKLESIGAEDVVDGNERLILGLIW 119          
BLAST of Neuron navigator 2 vs. Ensembl Nematostella
Match: EDO29101 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4L2])

HSP 1 Score: 64.6994 bits (156), Expect = 1.573e-10
Identity = 34/95 (35.79%), Postives = 56/95 (58.95%), Query Frame = 3
Query:  288 YTEWANHYLEKAGFNNFVNDLQTDLCDGALLADIIIAVTGEKVPNTKPKPKTQIQQMENLNSCLIFLSNIGVVTEGIQSKDINDGNLKAILGLLF 572
            +T+W N +L+K      VNDL  DL DG +L  ++  ++GEK+     + K ++  ++N+N  L FL    V  E I ++D+ DGN + ILGL++
Sbjct:   29 FTKWVNSFLDKVRSGLHVNDLFEDLADGKILISLLEIISGEKI-GFAARGKFRVHNIQNVNKALEFLQK-SVKLESIGAEDVVDGNERLILGLIW 121          
BLAST of Neuron navigator 2 vs. Ensembl Nematostella
Match: ALPHA-ACTININ (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4X0])

HSP 1 Score: 62.003 bits (149), Expect = 2.605e-9
Identity = 30/97 (30.93%), Postives = 59/97 (60.82%), Query Frame = 3
Query:  288 YTEWANHYLEKAGFNNFVNDLQTDLCDGALLADIIIAVTGEKVPNTKPKPKTQIQQMENLNSCLIFLSNIGVVTEGIQSKDINDGNLKAILGLLFNL 578
            +T W N +L K G    + +++ DL DG LL  ++  ++GE++P+ + + K +  ++ N+N  L F++  GV    + +++I DGNLK  LG+++ +
Sbjct:   33 FTAWCNSHLRKTGKQ--IGEIEEDLRDGVLLLQLLEIISGERLPHPE-RGKLRFHRIANVNKALDFVAGKGVKLVSVGAEEIVDGNLKMTLGMIWTI 126          
BLAST of Neuron navigator 2 vs. Ensembl Medaka
Match: nav2a (neuron navigator 2 [Source:NCBI gene;Acc:105356399])

HSP 1 Score: 565.459 bits (1456), Expect = 6.921e-167
Identity = 342/814 (42.01%), Postives = 482/814 (59.21%), Query Frame = 3
Query: 2748 SMSEDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGT--NLNNDNHTTVSLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLEND-PFKKQAKKGWFRSSFGKAFRKKFK------HSDVS-MSD---IEGDYYVHHLADNRSRISNDSQNSSK-NFMLDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTANKVVQYVSEN--TSNCASIDMFSHLFKFSSENEISI-GAYVYFNDIIVS---------PSSVQHITNKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDS 5111
            S +E+K   EIRKLR EL+ +Q+KV  L+++L  NAH+ +AFE SL N+T RL+ L+ T+E+KD EL +LR  IE L++Q     N+  Q T   + N    T    R+     SP   Q  L R++   S+ +               S   ++   + IGS+++ D   KK+ KK W RSSF +AF KK        HSD+  M+D          H+ A   S +  ++ +SS  +  LD+ + T+  L+ +L+E+++KLTD +LEALSSAHQL+QL+E +N M+ E+  L+A+N+RL    ++E+     T        S + + +S T+     +   S N  +S   S+DM   L     E      G +V    ++VS          S   H     LIG   +   + W  LD  +R LFKEY+S  DP + LG++ +SI+ Y +G V + S    S   T  + P   +        +N I I L+    ++  +D+L F+TLIPK VL RYV LL EHR +IL GPSGTGKTYLAN+L++HL++   + ++   +  F VDHKS+KEL  YLA +AEQ         C N+     P+VVILDNLHHV SL EIF+   + N Q  PY+IGTM+QA+ S+ NLQ HHNFRWVLCANH+EPVKGFLGR+LRR+LI+ E   +  +  L+  V+WI + WQH+N+FLE+HSSSDVTIGPRLFL CPM +EGS++WFTDLWNYS++PY+LEAVREGLQ +GRR+ WEDP  W++++ PW S+       D   L++LRPEDVG+D 
Sbjct: 1482 STNEEKSQSEIRKLRRELDASQEKVSALTTQLSANAHLVAAFEQSLGNMTLRLKSLTLTAEQKDSELNELRKTIELLKKQ-----NAVAQATINGVINTPELTPKCNRTAGNNGSPQQQQPDL-RIRRQHSSDS--------------VSSVASATSQSSIGSNMDADSKNKKKNKKNWLRSSFKQAFAKKKSPKSASSHSDIEEMTDSSLPSSPKLNHNGASATSHMLRNTHSSSLLSECLDSEAETVMQLRSELREKEMKLTDIRLEALSSAHQLDQLREAMNRMQLEIEKLKAENDRL----KVENQ-GSRTGSQASISSSPSPHTLSQTAVPGPGLSQHSLNLTSSESTSLDML--LDDTGGEGAARKEGRHV---KVVVSLDEGSKWGEGSQSHHF----LIGCIGVCGKTKWDVLDGVVRRLFKEYISHVDPVSQLGLSTDSIQGYNIGEVHRPS--RLSTTSTPELLPCGYL------VGDNSINIQLKGASSDS--VDSLVFETLIPKPVLQRYVFLLKEHRRVILSGPSGTGKTYLANQLSRHLLLLEGRPLTPNAVVTFNVDHKSSKELHQYLAGLAEQ---------CSNVSETDCPLVVILDNLHHVGSLGEIFNGLFNCNHQRCPYIIGTMSQATSSSPNLQLHHNFRWVLCANHVEPVKGFLGRFLRRRLIETEIGSRTRNVELVKIVDWIPRAWQHLNRFLETHSSSDVTIGPRLFLPCPMDVEGSRVWFTDLWNYSIIPYMLEAVREGLQLYGRRAPWEDPTAWVIESCPWSSTPPP---GDWPPLLKLRPEDVGFDG 2239          

HSP 2 Score: 60.8474 bits (146), Expect = 1.651e-8
Identity = 25/45 (55.56%), Postives = 37/45 (82.22%), Query Frame = 3
Query:  453 QMENLNSCLIFLSNIGVVTEGIQSKDINDGNLKAILGLLFNLSRY 587
            Q+EN+++CL FL+  GV  +G+ +++I +GNLKAILGL F+LSRY
Sbjct:   14 QIENIDTCLTFLAAKGVNIQGLSAEEIRNGNLKAILGLFFSLSRY 58          
BLAST of Neuron navigator 2 vs. Ensembl Medaka
Match: nav2a (neuron navigator 2 [Source:NCBI gene;Acc:105356399])

HSP 1 Score: 565.459 bits (1456), Expect = 7.411e-167
Identity = 342/814 (42.01%), Postives = 482/814 (59.21%), Query Frame = 3
Query: 2748 SMSEDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGT--NLNNDNHTTVSLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLEND-PFKKQAKKGWFRSSFGKAFRKKFK------HSDVS-MSD---IEGDYYVHHLADNRSRISNDSQNSSK-NFMLDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTANKVVQYVSEN--TSNCASIDMFSHLFKFSSENEISI-GAYVYFNDIIVS---------PSSVQHITNKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDS 5111
            S +E+K   EIRKLR EL+ +Q+KV  L+++L  NAH+ +AFE SL N+T RL+ L+ T+E+KD EL +LR  IE L++Q     N+  Q T   + N    T    R+     SP   Q  L R++   S+ +               S   ++   + IGS+++ D   KK+ KK W RSSF +AF KK        HSD+  M+D          H+ A   S +  ++ +SS  +  LD+ + T+  L+ +L+E+++KLTD +LEALSSAHQL+QL+E +N M+ E+  L+A+N+RL    ++E+     T        S + + +S T+     +   S N  +S   S+DM   L     E      G +V    ++VS          S   H     LIG   +   + W  LD  +R LFKEY+S  DP + LG++ +SI+ Y +G V + S    S   T  + P   +        +N I I L+    ++  +D+L F+TLIPK VL RYV LL EHR +IL GPSGTGKTYLAN+L++HL++   + ++   +  F VDHKS+KEL  YLA +AEQ         C N+     P+VVILDNLHHV SL EIF+   + N Q  PY+IGTM+QA+ S+ NLQ HHNFRWVLCANH+EPVKGFLGR+LRR+LI+ E   +  +  L+  V+WI + WQH+N+FLE+HSSSDVTIGPRLFL CPM +EGS++WFTDLWNYS++PY+LEAVREGLQ +GRR+ WEDP  W++++ PW S+       D   L++LRPEDVG+D 
Sbjct: 1517 STNEEKSQSEIRKLRRELDASQEKVSALTTQLSANAHLVAAFEQSLGNMTLRLKSLTLTAEQKDSELNELRKTIELLKKQ-----NAVAQATINGVINTPELTPKCNRTAGNNGSPQQQQPDL-RIRRQHSSDS--------------VSSVASATSQSSIGSNMDADSKNKKKNKKNWLRSSFKQAFAKKKSPKSASSHSDIEEMTDSSLPSSPKLNHNGASATSHMLRNTHSSSLLSECLDSEAETVMQLRSELREKEMKLTDIRLEALSSAHQLDQLREAMNRMQLEIEKLKAENDRL----KVENQ-GSRTGSQASISSSPSPHTLSQTAVPGPGLSQHSLNLTSSESTSLDML--LDDTGGEGAARKEGRHV---KVVVSLDEGSKWGEGSQSHHF----LIGCIGVCGKTKWDVLDGVVRRLFKEYISHVDPVSQLGLSTDSIQGYNIGEVHRPS--RLSTTSTPELLPCGYL------VGDNSINIQLKGASSDS--VDSLVFETLIPKPVLQRYVFLLKEHRRVILSGPSGTGKTYLANQLSRHLLLLEGRPLTPNAVVTFNVDHKSSKELHQYLAGLAEQ---------CSNVSETDCPLVVILDNLHHVGSLGEIFNGLFNCNHQRCPYIIGTMSQATSSSPNLQLHHNFRWVLCANHVEPVKGFLGRFLRRRLIETEIGSRTRNVELVKIVDWIPRAWQHLNRFLETHSSSDVTIGPRLFLPCPMDVEGSRVWFTDLWNYSIIPYMLEAVREGLQLYGRRAPWEDPTAWVIESCPWSSTPPP---GDWPPLLKLRPEDVGFDG 2274          

HSP 2 Score: 58.9214 bits (141), Expect = 7.204e-8
Identity = 24/44 (54.55%), Postives = 36/44 (81.82%), Query Frame = 3
Query:  456 MENLNSCLIFLSNIGVVTEGIQSKDINDGNLKAILGLLFNLSRY 587
            +EN+++CL FL+  GV  +G+ +++I +GNLKAILGL F+LSRY
Sbjct:    2 IENIDTCLTFLAAKGVNIQGLSAEEIRNGNLKAILGLFFSLSRY 45          
BLAST of Neuron navigator 2 vs. Ensembl Medaka
Match: nav2a (neuron navigator 2 [Source:NCBI gene;Acc:105356399])

HSP 1 Score: 565.074 bits (1455), Expect = 1.254e-166
Identity = 342/814 (42.01%), Postives = 482/814 (59.21%), Query Frame = 3
Query: 2748 SMSEDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGT--NLNNDNHTTVSLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLEND-PFKKQAKKGWFRSSFGKAFRKKFK------HSDVS-MSD---IEGDYYVHHLADNRSRISNDSQNSSK-NFMLDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTANKVVQYVSEN--TSNCASIDMFSHLFKFSSENEISI-GAYVYFNDIIVS---------PSSVQHITNKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDS 5111
            S +E+K   EIRKLR EL+ +Q+KV  L+++L  NAH+ +AFE SL N+T RL+ L+ T+E+KD EL +LR  IE L++Q     N+  Q T   + N    T    R+     SP   Q  L R++   S+ +               S   ++   + IGS+++ D   KK+ KK W RSSF +AF KK        HSD+  M+D          H+ A   S +  ++ +SS  +  LD+ + T+  L+ +L+E+++KLTD +LEALSSAHQL+QL+E +N M+ E+  L+A+N+RL    ++E+     T        S + + +S T+     +   S N  +S   S+DM   L     E      G +V    ++VS          S   H     LIG   +   + W  LD  +R LFKEY+S  DP + LG++ +SI+ Y +G V + S    S   T  + P   +        +N I I L+    ++  +D+L F+TLIPK VL RYV LL EHR +IL GPSGTGKTYLAN+L++HL++   + ++   +  F VDHKS+KEL  YLA +AEQ         C N+     P+VVILDNLHHV SL EIF+   + N Q  PY+IGTM+QA+ S+ NLQ HHNFRWVLCANH+EPVKGFLGR+LRR+LI+ E   +  +  L+  V+WI + WQH+N+FLE+HSSSDVTIGPRLFL CPM +EGS++WFTDLWNYS++PY+LEAVREGLQ +GRR+ WEDP  W++++ PW S+       D   L++LRPEDVG+D 
Sbjct: 1553 STNEEKSQSEIRKLRRELDASQEKVSALTTQLSANAHLVAAFEQSLGNMTLRLKSLTLTAEQKDSELNELRKTIELLKKQ-----NAVAQATINGVINTPELTPKCNRTAGNNGSPQQQQPDL-RIRRQHSSDS--------------VSSVASATSQSSIGSNMDADSKNKKKNKKNWLRSSFKQAFAKKKSPKSASSHSDIEEMTDSSLPSSPKLNHNGASATSHMLRNTHSSSLLSECLDSEAETVMQLRSELREKEMKLTDIRLEALSSAHQLDQLREAMNRMQLEIEKLKAENDRL----KVENQ-GSRTGSQASISSSPSPHTLSQTAVPGPGLSQHSLNLTSSESTSLDML--LDDTGGEGAARKEGRHV---KVVVSLDEGSKWGEGSQSHHF----LIGCIGVCGKTKWDVLDGVVRRLFKEYISHVDPVSQLGLSTDSIQGYNIGEVHRPS--RLSTTSTPELLPCGYL------VGDNSINIQLKGASSDS--VDSLVFETLIPKPVLQRYVFLLKEHRRVILSGPSGTGKTYLANQLSRHLLLLEGRPLTPNAVVTFNVDHKSSKELHQYLAGLAEQ---------CSNVSETDCPLVVILDNLHHVGSLGEIFNGLFNCNHQRCPYIIGTMSQATSSSPNLQLHHNFRWVLCANHVEPVKGFLGRFLRRRLIETEIGSRTRNVELVKIVDWIPRAWQHLNRFLETHSSSDVTIGPRLFLPCPMDVEGSRVWFTDLWNYSIIPYMLEAVREGLQLYGRRAPWEDPTAWVIESCPWSSTPPP---GDWPPLLKLRPEDVGFDG 2310          

HSP 2 Score: 123.25 bits (308), Expect = 1.866e-27
Identity = 54/101 (53.47%), Postives = 74/101 (73.27%), Query Frame = 3
Query:  285 IYTEWANHYLEKAGFNNFVNDLQTDLCDGALLADIIIAVTGEKVPNTKPKPKTQIQQMENLNSCLIFLSNIGVVTEGIQSKDINDGNLKAILGLLFNLSRY 587
            IYT+WANHYL K+G    + DLQTD+ DG LLADII  V  EK+ +    PK++ Q +EN+++CL FL+  GV  +G+ +++I +GNLKAILGL F+LSRY
Sbjct:   18 IYTDWANHYLAKSGHKRLIKDLQTDVTDGVLLADIIQVVANEKIDDINGCPKSRSQMIENIDTCLTFLAAKGVNIQGLSAEEIRNGNLKAILGLFFSLSRY 118          
BLAST of Neuron navigator 2 vs. Ensembl Medaka
Match: nav2a (neuron navigator 2 [Source:NCBI gene;Acc:105356399])

HSP 1 Score: 564.688 bits (1454), Expect = 1.357e-166
Identity = 342/814 (42.01%), Postives = 482/814 (59.21%), Query Frame = 3
Query: 2748 SMSEDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGT--NLNNDNHTTVSLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLEND-PFKKQAKKGWFRSSFGKAFRKKFK------HSDVS-MSD---IEGDYYVHHLADNRSRISNDSQNSSK-NFMLDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTANKVVQYVSEN--TSNCASIDMFSHLFKFSSENEISI-GAYVYFNDIIVS---------PSSVQHITNKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDS 5111
            S +E+K   EIRKLR EL+ +Q+KV  L+++L  NAH+ +AFE SL N+T RL+ L+ T+E+KD EL +LR  IE L++Q     N+  Q T   + N    T    R+     SP   Q  L R++   S+ +               S   ++   + IGS+++ D   KK+ KK W RSSF +AF KK        HSD+  M+D          H+ A   S +  ++ +SS  +  LD+ + T+  L+ +L+E+++KLTD +LEALSSAHQL+QL+E +N M+ E+  L+A+N+RL    ++E+     T        S + + +S T+     +   S N  +S   S+DM   L     E      G +V    ++VS          S   H     LIG   +   + W  LD  +R LFKEY+S  DP + LG++ +SI+ Y +G V + S    S   T  + P   +        +N I I L+    ++  +D+L F+TLIPK VL RYV LL EHR +IL GPSGTGKTYLAN+L++HL++   + ++   +  F VDHKS+KEL  YLA +AEQ         C N+     P+VVILDNLHHV SL EIF+   + N Q  PY+IGTM+QA+ S+ NLQ HHNFRWVLCANH+EPVKGFLGR+LRR+LI+ E   +  +  L+  V+WI + WQH+N+FLE+HSSSDVTIGPRLFL CPM +EGS++WFTDLWNYS++PY+LEAVREGLQ +GRR+ WEDP  W++++ PW S+       D   L++LRPEDVG+D 
Sbjct: 1501 STNEEKSQSEIRKLRRELDASQEKVSALTTQLSANAHLVAAFEQSLGNMTLRLKSLTLTAEQKDSELNELRKTIELLKKQ-----NAVAQATINGVINTPELTPKCNRTAGNNGSPQQQQPDL-RIRRQHSSDS--------------VSSVASATSQSSIGSNMDADSKNKKKNKKNWLRSSFKQAFAKKKSPKSASSHSDIEEMTDSSLPSSPKLNHNGASATSHMLRNTHSSSLLSECLDSEAETVMQLRSELREKEMKLTDIRLEALSSAHQLDQLREAMNRMQLEIEKLKAENDRL----KVENQ-GSRTGSQASISSSPSPHTLSQTAVPGPGLSQHSLNLTSSESTSLDML--LDDTGGEGAARKEGRHV---KVVVSLDEGSKWGEGSQSHHF----LIGCIGVCGKTKWDVLDGVVRRLFKEYISHVDPVSQLGLSTDSIQGYNIGEVHRPS--RLSTTSTPELLPCGYL------VGDNSINIQLKGASSDS--VDSLVFETLIPKPVLQRYVFLLKEHRRVILSGPSGTGKTYLANQLSRHLLLLEGRPLTPNAVVTFNVDHKSSKELHQYLAGLAEQ---------CSNVSETDCPLVVILDNLHHVGSLGEIFNGLFNCNHQRCPYIIGTMSQATSSSPNLQLHHNFRWVLCANHVEPVKGFLGRFLRRRLIETEIGSRTRNVELVKIVDWIPRAWQHLNRFLETHSSSDVTIGPRLFLPCPMDVEGSRVWFTDLWNYSIIPYMLEAVREGLQLYGRRAPWEDPTAWVIESCPWSSTPPP---GDWPPLLKLRPEDVGFDG 2258          

HSP 2 Score: 60.8474 bits (146), Expect = 1.681e-8
Identity = 25/45 (55.56%), Postives = 37/45 (82.22%), Query Frame = 3
Query:  453 QMENLNSCLIFLSNIGVVTEGIQSKDINDGNLKAILGLLFNLSRY 587
            Q+EN+++CL FL+  GV  +G+ +++I +GNLKAILGL F+LSRY
Sbjct:   14 QIENIDTCLTFLAAKGVNIQGLSAEEIRNGNLKAILGLFFSLSRY 58          
BLAST of Neuron navigator 2 vs. Ensembl Medaka
Match: nav2a (neuron navigator 2 [Source:NCBI gene;Acc:105356399])

HSP 1 Score: 565.459 bits (1456), Expect = 1.645e-166
Identity = 342/814 (42.01%), Postives = 482/814 (59.21%), Query Frame = 3
Query: 2748 SMSEDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGT--NLNNDNHTTVSLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLEND-PFKKQAKKGWFRSSFGKAFRKKFK------HSDVS-MSD---IEGDYYVHHLADNRSRISNDSQNSSK-NFMLDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTANKVVQYVSEN--TSNCASIDMFSHLFKFSSENEISI-GAYVYFNDIIVS---------PSSVQHITNKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDS 5111
            S +E+K   EIRKLR EL+ +Q+KV  L+++L  NAH+ +AFE SL N+T RL+ L+ T+E+KD EL +LR  IE L++Q     N+  Q T   + N    T    R+     SP   Q  L R++   S+ +               S   ++   + IGS+++ D   KK+ KK W RSSF +AF KK        HSD+  M+D          H+ A   S +  ++ +SS  +  LD+ + T+  L+ +L+E+++KLTD +LEALSSAHQL+QL+E +N M+ E+  L+A+N+RL    ++E+     T        S + + +S T+     +   S N  +S   S+DM   L     E      G +V    ++VS          S   H     LIG   +   + W  LD  +R LFKEY+S  DP + LG++ +SI+ Y +G V + S    S   T  + P   +        +N I I L+    ++  +D+L F+TLIPK VL RYV LL EHR +IL GPSGTGKTYLAN+L++HL++   + ++   +  F VDHKS+KEL  YLA +AEQ         C N+     P+VVILDNLHHV SL EIF+   + N Q  PY+IGTM+QA+ S+ NLQ HHNFRWVLCANH+EPVKGFLGR+LRR+LI+ E   +  +  L+  V+WI + WQH+N+FLE+HSSSDVTIGPRLFL CPM +EGS++WFTDLWNYS++PY+LEAVREGLQ +GRR+ WEDP  W++++ PW S+       D   L++LRPEDVG+D 
Sbjct: 1624 STNEEKSQSEIRKLRRELDASQEKVSALTTQLSANAHLVAAFEQSLGNMTLRLKSLTLTAEQKDSELNELRKTIELLKKQ-----NAVAQATINGVINTPELTPKCNRTAGNNGSPQQQQPDL-RIRRQHSSDS--------------VSSVASATSQSSIGSNMDADSKNKKKNKKNWLRSSFKQAFAKKKSPKSASSHSDIEEMTDSSLPSSPKLNHNGASATSHMLRNTHSSSLLSECLDSEAETVMQLRSELREKEMKLTDIRLEALSSAHQLDQLREAMNRMQLEIEKLKAENDRL----KVENQ-GSRTGSQASISSSPSPHTLSQTAVPGPGLSQHSLNLTSSESTSLDML--LDDTGGEGAARKEGRHV---KVVVSLDEGSKWGEGSQSHHF----LIGCIGVCGKTKWDVLDGVVRRLFKEYISHVDPVSQLGLSTDSIQGYNIGEVHRPS--RLSTTSTPELLPCGYL------VGDNSINIQLKGASSDS--VDSLVFETLIPKPVLQRYVFLLKEHRRVILSGPSGTGKTYLANQLSRHLLLLEGRPLTPNAVVTFNVDHKSSKELHQYLAGLAEQ---------CSNVSETDCPLVVILDNLHHVGSLGEIFNGLFNCNHQRCPYIIGTMSQATSSSPNLQLHHNFRWVLCANHVEPVKGFLGRFLRRRLIETEIGSRTRNVELVKIVDWIPRAWQHLNRFLETHSSSDVTIGPRLFLPCPMDVEGSRVWFTDLWNYSIIPYMLEAVREGLQLYGRRAPWEDPTAWVIESCPWSSTPPP---GDWPPLLKLRPEDVGFDG 2381          

HSP 2 Score: 123.635 bits (309), Expect = 1.716e-27
Identity = 54/101 (53.47%), Postives = 74/101 (73.27%), Query Frame = 3
Query:  285 IYTEWANHYLEKAGFNNFVNDLQTDLCDGALLADIIIAVTGEKVPNTKPKPKTQIQQMENLNSCLIFLSNIGVVTEGIQSKDINDGNLKAILGLLFNLSRY 587
            IYT+WANHYL K+G    + DLQTD+ DG LLADII  V  EK+ +    PK++ Q +EN+++CL FL+  GV  +G+ +++I +GNLKAILGL F+LSRY
Sbjct:   74 IYTDWANHYLAKSGHKRLIKDLQTDVTDGVLLADIIQVVANEKIDDINGCPKSRSQMIENIDTCLTFLAAKGVNIQGLSAEEIRNGNLKAILGLFFSLSRY 174          
BLAST of Neuron navigator 2 vs. Planmine SMEST
Match: SMESG000036210.1 (SMESG000036210.1)

HSP 1 Score: 3343.13 bits (8667), Expect = 0.000e+0
Identity = 1738/1794 (96.88%), Postives = 1740/1794 (96.99%), Query Frame = 3
Query:   93 MSDVMKMSTTTDPESELSGLATVSDTSEYQASLLNECKEDVENEMKFDSENSISKTQQANALLTIYTEWANHYLEKAGFNNFVNDLQTDLCDGALLADIIIAVTGEKVPNTKPKPKTQIQQMENLNSCLIFLSNIGVVTEGIQSKDINDGNLKAILGLLFNLSRYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVHKPNRASILRTSTTGIPTLSVKPNELQSPKSVTLRKPDGLVCXXXXXXXXXXXXXXXXXXXXXXXXXXXGIKTKRTDXXXXXXXXXXXXXXXIPLPANISTNNSVKNSPLIGEPSVQNCRSASVSSNSPVLKKSSNPSIDTGNNMFDRFKLFRNSANERINRGSPLHNYPSVTSKDNGSILISDPITQRSMTPFNPRLMHNFNPNLCPPGTPNKLQQVPYSMFDGQSVQQVMQPNFHNFNSNLQDIKFQPTAPVRTESVRQSASSKDSCVQKIQCDQRKARNKESEPIRMETVTNEPSLRSNSRHERQKAKDLYTALKQRDRNKYNFSPQISDNNELNREPVNNKQVRMMSSQEFTQLIQNDPRLRQYVENQSNVKRNMILEATKTTGVISNDSLKKQIIEVKSGSIQTKSLQESANLSADQLKSDVGQLISDKNRRKVIENKTKPIPPNHTDLSNCTSNVMGKKEPLLWLQHRPSMSGTDSSEYSTNYACMRKYASDFEADLELDSSVEISTQTDKSAKMGYYSDSDSILNPRFGKLDHCQNSDLSALISEKLVGYRRLMNTSGMDPATYLSYQKNLMASKRGTPQSADKDRIYGIVLNSNVARSAAGPAPATFEDLQLQSCFSLPSSQNFLRSNSARYTDTISSDKSFPQNIKLPYATNTNSFISKTEIDSSQNNGSSLSLASNESRRSMSEDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGTNLNNDNHTTVSLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAFRKKFKHSDVSMSDIEGDYYVHHLADNRSRISNDSQNSSKNFMLDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTANKVVQYVSENTSNCASIDMFSHLFKFSSENEISIGAYVYFNDIIVSPSSVQHITNKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDSQVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQEAANYSTSPGSNDSDIAXXXXXXXXXXXXXXXXGGQTSQIHKIFKTDIL 5474
            MSDVMKMSTTTDPESELSGLATVSDTSEYQASLLNECKEDVENEMKFDSENSISKTQQANALLTIYTEWANHYLEKAGFNNFVNDLQTDLCDGALLADIIIAVTGEKVPNTKPKPKTQIQQMENLNSCLIFLSNIGVVTEGIQSKDINDGNLKAILGLLFNLSRYKQQLKQQSSSASTPSAVSSNGSTQSGNNNVHKPNRASILRTSTTGIPTLSVKPNELQSPKSVTLRKPDGLVCKKNINNNNNNNSDTSVGSSVVSSKRNSGIKTKRTDSPSNNSSVSSTYSTSIPLPANISTNNSVKNSPLIGEPSVQNCRSASVSSNSPVLKKSSNPSIDTGNNMFDRFKLFRNSANERINRGSPLHNYPSVTSKDNGSILISDPITQRSMTPFNPRLMHNFNPNLCPPGTPNKLQQVPYSMFDGQSVQQVMQPNFHNFNSNLQDIKFQPTAPVRTESVRQSASSKDSCVQKIQCDQRK+RNKESEPIRMETVTNEPSLRSNSRHERQKAKDLYTALKQRDRNKYNFSPQISDNNELNREPVNNKQVRMMSSQEFTQLIQNDPRLRQYVENQSNVKRNMILEATKTTGVISNDSLKKQIIEVKSGS QTKSLQESANLSADQLKSDVGQLISDKNRRKVIENKTKPIPPNHTDLSNCTSNVMGKKEPLLWLQHRPSMSGTDSSEYSTNYACMRKYASDFEADLELDSSVEISTQTDKSAKMGYYSDSDSILNPRFGKLDHCQNSDLSALISEKLVGYRRLMNTSGMDPATYLSYQKNLMASKRGTPQSADKDRIYGIVLNSNVARSAAGPAPATFEDLQLQSCFSLPSSQNFLRSNSARYTDTISSDKSFPQNIKLPYATNTNSFISKTEIDSSQNNGSSLSLASNESRRSMSEDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNN                   RSISATVSPAHFQNSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAFRKKFKHSDVSMSDIEGDYYVHHLADNRSRISNDSQNSSKNFMLDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTANKVVQYVSENTSNCASIDMFSHLFKFSSENEISIGAYVYFNDIIVSPSSVQHITNKVLIGSCHISESSTWSQL+SHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDS                 QSITSSQLIPQSQHSKFLQDSKLLSLSNSSSHRHANSNNTFPRTDPLLNMLIKLQEAANYSTSPGSNDSDI                S GQTSQIHKIFKTDIL
Sbjct:    1 MSDVMKMSTTTDPESELSGLATVSDTSEYQASLLNECKEDVENEMKFDSENSISKTQQANALLTIYTEWANHYLEKAGFNNFVNDLQTDLCDGALLADIIIAVTGEKVPNTKPKPKTQIQQMENLNSCLIFLSNIGVVTEGIQSKDINDGNLKAILGLLFNLSRYKQQLKQQSSSASTPSAVSSNGSTQSGNNNVHKPNRASILRTSTTGIPTLSVKPNELQSPKSVTLRKPDGLVCKKNINNNNNNNSDTSVGSSVVSSKRNSGIKTKRTDSPSNNSSVSSTYSTSIPLPANISTNNSVKNSPLIGEPSVQNCRSASVSSNSPVLKKSSNPSIDTGNNMFDRFKLFRNSANERINRGSPLHNYPSVTSKDNGSILISDPITQRSMTPFNPRLMHNFNPNLCPPGTPNKLQQVPYSMFDGQSVQQVMQPNFHNFNSNLQDIKFQPTAPVRTESVRQSASSKDSCVQKIQCDQRKSRNKESEPIRMETVTNEPSLRSNSRHERQKAKDLYTALKQRDRNKYNFSPQISDNNELNREPVNNKQVRMMSSQEFTQLIQNDPRLRQYVENQSNVKRNMILEATKTTGVISNDSLKKQIIEVKSGSSQTKSLQESANLSADQLKSDVGQLISDKNRRKVIENKTKPIPPNHTDLSNCTSNVMGKKEPLLWLQHRPSMSGTDSSEYSTNYACMRKYASDFEADLELDSSVEISTQTDKSAKMGYYSDSDSILNPRFGKLDHCQNSDLSALISEKLVGYRRLMNTSGMDPATYLSYQKNLMASKRGTPQSADKDRIYGIVLNSNVARSAAGPAPATFEDLQLQSCFSLPSSQNFLRSNSARYTDTISSDKSFPQNIKLPYATNTNSFISKTEIDSSQNNGSSLSLASNESRRSMSEDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNR------------------RSISATVSPAHFQNSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAFRKKFKHSDVSMSDIEGDYYVHHLADNRSRISNDSQNSSKNFMLDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTANKVVQYVSENTSNCASIDMFSHLFKFSSENEISIGAYVYFNDIIVSPSSVQHITNKVLIGSCHISESSTWSQLESHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDS-----------------QSITSSQLIPQSQHSKFLQDSKLLSLSNSSSHRHANSNNTFPRTDPLLNMLIKLQEAANYSTSPGSNDSDIP---------------SSGQTSQIHKIFKTDIL 1744          
BLAST of Neuron navigator 2 vs. Planmine SMEST
Match: SMESG000036210.1 (SMESG000036210.1)

HSP 1 Score: 3330.81 bits (8635), Expect = 0.000e+0
Identity = 1732/1788 (96.87%), Postives = 1734/1788 (96.98%), Query Frame = 3
Query:  111 MSTTTDPESELSGLATVSDTSEYQASLLNECKEDVENEMKFDSENSISKTQQANALLTIYTEWANHYLEKAGFNNFVNDLQTDLCDGALLADIIIAVTGEKVPNTKPKPKTQIQQMENLNSCLIFLSNIGVVTEGIQSKDINDGNLKAILGLLFNLSRYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVHKPNRASILRTSTTGIPTLSVKPNELQSPKSVTLRKPDGLVCXXXXXXXXXXXXXXXXXXXXXXXXXXXGIKTKRTDXXXXXXXXXXXXXXXIPLPANISTNNSVKNSPLIGEPSVQNCRSASVSSNSPVLKKSSNPSIDTGNNMFDRFKLFRNSANERINRGSPLHNYPSVTSKDNGSILISDPITQRSMTPFNPRLMHNFNPNLCPPGTPNKLQQVPYSMFDGQSVQQVMQPNFHNFNSNLQDIKFQPTAPVRTESVRQSASSKDSCVQKIQCDQRKARNKESEPIRMETVTNEPSLRSNSRHERQKAKDLYTALKQRDRNKYNFSPQISDNNELNREPVNNKQVRMMSSQEFTQLIQNDPRLRQYVENQSNVKRNMILEATKTTGVISNDSLKKQIIEVKSGSIQTKSLQESANLSADQLKSDVGQLISDKNRRKVIENKTKPIPPNHTDLSNCTSNVMGKKEPLLWLQHRPSMSGTDSSEYSTNYACMRKYASDFEADLELDSSVEISTQTDKSAKMGYYSDSDSILNPRFGKLDHCQNSDLSALISEKLVGYRRLMNTSGMDPATYLSYQKNLMASKRGTPQSADKDRIYGIVLNSNVARSAAGPAPATFEDLQLQSCFSLPSSQNFLRSNSARYTDTISSDKSFPQNIKLPYATNTNSFISKTEIDSSQNNGSSLSLASNESRRSMSEDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGTNLNNDNHTTVSLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAFRKKFKHSDVSMSDIEGDYYVHHLADNRSRISNDSQNSSKNFMLDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTANKVVQYVSENTSNCASIDMFSHLFKFSSENEISIGAYVYFNDIIVSPSSVQHITNKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDSQVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQEAANYSTSPGSNDSDIAXXXXXXXXXXXXXXXXGGQTSQIHKIFKTDIL 5474
            MSTTTDPESELSGLATVSDTSEYQASLLNECKEDVENEMKFDSENSISKTQQANALLTIYTEWANHYLEKAGFNNFVNDLQTDLCDGALLADIIIAVTGEKVPNTKPKPKTQIQQMENLNSCLIFLSNIGVVTEGIQSKDINDGNLKAILGLLFNLSRYKQQLKQQSSSASTPSAVSSNGSTQSGNNNVHKPNRASILRTSTTGIPTLSVKPNELQSPKSVTLRKPDGLVCKKNINNNNNNNSDTSVGSSVVSSKRNSGIKTKRTDSPSNNSSVSSTYSTSIPLPANISTNNSVKNSPLIGEPSVQNCRSASVSSNSPVLKKSSNPSIDTGNNMFDRFKLFRNSANERINRGSPLHNYPSVTSKDNGSILISDPITQRSMTPFNPRLMHNFNPNLCPPGTPNKLQQVPYSMFDGQSVQQVMQPNFHNFNSNLQDIKFQPTAPVRTESVRQSASSKDSCVQKIQCDQRK+RNKESEPIRMETVTNEPSLRSNSRHERQKAKDLYTALKQRDRNKYNFSPQISDNNELNREPVNNKQVRMMSSQEFTQLIQNDPRLRQYVENQSNVKRNMILEATKTTGVISNDSLKKQIIEVKSGS QTKSLQESANLSADQLKSDVGQLISDKNRRKVIENKTKPIPPNHTDLSNCTSNVMGKKEPLLWLQHRPSMSGTDSSEYSTNYACMRKYASDFEADLELDSSVEISTQTDKSAKMGYYSDSDSILNPRFGKLDHCQNSDLSALISEKLVGYRRLMNTSGMDPATYLSYQKNLMASKRGTPQSADKDRIYGIVLNSNVARSAAGPAPATFEDLQLQSCFSLPSSQNFLRSNSARYTDTISSDKSFPQNIKLPYATNTNSFISKTEIDSSQNNGSSLSLASNESRRSMSEDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNN                   RSISATVSPAHFQNSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAFRKKFKHSDVSMSDIEGDYYVHHLADNRSRISNDSQNSSKNFMLDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTANKVVQYVSENTSNCASIDMFSHLFKFSSENEISIGAYVYFNDIIVSPSSVQHITNKVLIGSCHISESSTWSQL+SHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDS                 QSITSSQLIPQSQHSKFLQDSKLLSLSNSSSHRHANSNNTFPRTDPLLNMLIKLQEAANYSTSPGSNDSDI                S GQTSQIHKIFKTDIL
Sbjct:    1 MSTTTDPESELSGLATVSDTSEYQASLLNECKEDVENEMKFDSENSISKTQQANALLTIYTEWANHYLEKAGFNNFVNDLQTDLCDGALLADIIIAVTGEKVPNTKPKPKTQIQQMENLNSCLIFLSNIGVVTEGIQSKDINDGNLKAILGLLFNLSRYKQQLKQQSSSASTPSAVSSNGSTQSGNNNVHKPNRASILRTSTTGIPTLSVKPNELQSPKSVTLRKPDGLVCKKNINNNNNNNSDTSVGSSVVSSKRNSGIKTKRTDSPSNNSSVSSTYSTSIPLPANISTNNSVKNSPLIGEPSVQNCRSASVSSNSPVLKKSSNPSIDTGNNMFDRFKLFRNSANERINRGSPLHNYPSVTSKDNGSILISDPITQRSMTPFNPRLMHNFNPNLCPPGTPNKLQQVPYSMFDGQSVQQVMQPNFHNFNSNLQDIKFQPTAPVRTESVRQSASSKDSCVQKIQCDQRKSRNKESEPIRMETVTNEPSLRSNSRHERQKAKDLYTALKQRDRNKYNFSPQISDNNELNREPVNNKQVRMMSSQEFTQLIQNDPRLRQYVENQSNVKRNMILEATKTTGVISNDSLKKQIIEVKSGSSQTKSLQESANLSADQLKSDVGQLISDKNRRKVIENKTKPIPPNHTDLSNCTSNVMGKKEPLLWLQHRPSMSGTDSSEYSTNYACMRKYASDFEADLELDSSVEISTQTDKSAKMGYYSDSDSILNPRFGKLDHCQNSDLSALISEKLVGYRRLMNTSGMDPATYLSYQKNLMASKRGTPQSADKDRIYGIVLNSNVARSAAGPAPATFEDLQLQSCFSLPSSQNFLRSNSARYTDTISSDKSFPQNIKLPYATNTNSFISKTEIDSSQNNGSSLSLASNESRRSMSEDKQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNR------------------RSISATVSPAHFQNSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAFRKKFKHSDVSMSDIEGDYYVHHLADNRSRISNDSQNSSKNFMLDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTANKVVQYVSENTSNCASIDMFSHLFKFSSENEISIGAYVYFNDIIVSPSSVQHITNKVLIGSCHISESSTWSQLESHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSNVKTRNSDPSSLIRLRPEDVGYDS-----------------QSITSSQLIPQSQHSKFLQDSKLLSLSNSSSHRHANSNNTFPRTDPLLNMLIKLQEAANYSTSPGSNDSDIP---------------SSGQTSQIHKIFKTDIL 1738          
BLAST of Neuron navigator 2 vs. Planmine SMEST
Match: SMESG000058374.1 (SMESG000058374.1)

HSP 1 Score: 536.184 bits (1380), Expect = 4.558e-160
Identity = 368/1015 (36.26%), Postives = 535/1015 (52.71%), Query Frame = 3
Query: 2496 AAGPAPATFED---LQLQSC-------FSLPSSQNFLRSNSARYTDT----ISSDKSFPQNIKLPYATNTNSFISKTEIDSSQ--NNGSS---------------------LSLASNESRRSMSED-----------------------KQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGTNLNNDNHTTVSLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAFRKKFKHSDVSMSDIEGDYYVHHLADNRSRISNDSQNSSKNFMLDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTANKVVQYVSENTSNCASIDMFSHLFKFSSENEISIGAYVYFN----DIIVSPSSVQHITNKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNT-NLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRR-SNWEDPVDWILQTWPW--ISSNVKTRN--SDPSSLIRLRPEDVGYDSQVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQE 5330
            AAGP PATFED   L++  C        SLP  Q   RSN+     T    + +   +P  +  P   NTN +       S Q  NNG+S                     +S  S   R  +SED                       +Q+ EIRKLR ELE AQQKV TLS +L  N ++ +AFE SL +++ RLQK + +SE K++E                           LN   +T  SL +   A+ +P     + G++  + S  ++    + N                       E  P     K  W ++S G+AFRKK    D S   I   +   H  DN + IS               S ++  L+++L+E+D +LTD QL+ALS +HQLEQL++LL  MR EMS+L+ADN RLQ ++ + S+            ++ ++  +  T++   + +    NT      D  + L K     +  I   +  N    ++   P S +     + IG   I+  ++WS L++++R L KEY+S  D F++LG+N ESI  Y +      S+       T S+ P  S          +++ + L++   +N + D + FD LIPK +L RY  LLLEH+ +ILCGPSGTGKT+LA KLA+++  R++++ SS+ L +F VD KS KELR+Y+AT+ EQ   S    +       S P+V++LDNLHHV S +EIF+SF S      P+VIGTM+Q++ S+T NLQ HHNFRWVLC NHMEPVKG+LGR+LRR+ ++ + +    +D L   +EWI+ VWQHINKFLES+SS+DVTIGPRLFL+CPM+++ ++ WF DLWNYS+VPY++EAVREGL   GR+ + W+DP DWI+++WPW  + S++   N  +DPS+LIRLRPEDVG+DS     L  A S  +            P S  S    DS   S  +S+  R    ++     +PL+NML+++QE
Sbjct:  766 AAGPTPATFEDDADLRVSECSSNHYRAMSLPGRQK--RSNAWEVDVTSLNRMEASHMYP--LPPPPMNNTNVYYDVPVCRSKQGRNNGNSTPSLMNIRLPYATLSQGVKPSMSTCSLGKRDDVSEDVYDGLGSRLSLLSTSSYRSLNEERQATEIRKLRRELETAQQKVRTLSGQLSNNGNLVTAFESSLQSMSLRLQKFAASSESKENE---------------------------LNELKNTIESLKKQ--ASSNPGQLDPNSGKIYSSSSLTSLISNSNSN-----------------------EKRPEGSNKKSSWLKNSLGRAFRKKSSKDDGSTESINEIHQKQH--DNGNPISQSM----------TESESLHALRKELEEKDARLTDVQLDALSRSHQLEQLRDLLTKMRYEMSSLKADNNRLQSLMTL-SNAGVPAQSMEQSMNNDSLEQLHQTNSLKNMPKIKDLNTK--PKFDFLNGLVKDDPSCQALIVNVILNNKTKFNVSQQPRSPRDEKITIPIGRVGITSMTSWSDLENNLRRLVKEYMSAIDAFSSLGLNGESIARYRINDDAFISVCN-----TGSMRPLTSPLASCSNKSNSKLSLELKNYSYSNSI-DDMVFDCLIPKAILQRYFGLLLEHKRVILCGPSGTGKTFLAFKLAENIASRYNRDPSSSIL-VFNVDQKSTKELRSYMATLTEQLLKSDPQADSTMSPTSSLPLVIVLDNLHHVPSFSEIFNSFFSIQHARSPFVIGTMSQSNSSSTKNLQLHHNFRWVLCTNHMEPVKGYLGRFLRRQFLKHQLETASPNDQLYHVIEWINIVWQHINKFLESYSSADVTIGPRLFLNCPMNVDNAKAWFVDLWNYSIVPYIIEAVREGLTVHGRKQATWDDPTDWIVRSWPWNDLHSSLPISNNPTDPSNLIRLRPEDVGFDS---YQLITAPSDHIG-----------PYSIASHLGLDSLNSSRLSSTYDRRIRHSDKSESNEPLMNMLLRMQE 1688          
BLAST of Neuron navigator 2 vs. Planmine SMEST
Match: SMESG000058374.1 (SMESG000058374.1)

HSP 1 Score: 536.184 bits (1380), Expect = 5.720e-160
Identity = 368/1015 (36.26%), Postives = 535/1015 (52.71%), Query Frame = 3
Query: 2496 AAGPAPATFED---LQLQSC-------FSLPSSQNFLRSNSARYTDT----ISSDKSFPQNIKLPYATNTNSFISKTEIDSSQ--NNGSS---------------------LSLASNESRRSMSED-----------------------KQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGTNLNNDNHTTVSLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAFRKKFKHSDVSMSDIEGDYYVHHLADNRSRISNDSQNSSKNFMLDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTANKVVQYVSENTSNCASIDMFSHLFKFSSENEISIGAYVYFN----DIIVSPSSVQHITNKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNT-NLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRR-SNWEDPVDWILQTWPW--ISSNVKTRN--SDPSSLIRLRPEDVGYDSQVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQE 5330
            AAGP PATFED   L++  C        SLP  Q   RSN+     T    + +   +P  +  P   NTN +       S Q  NNG+S                     +S  S   R  +SED                       +Q+ EIRKLR ELE AQQKV TLS +L  N ++ +AFE SL +++ RLQK + +SE K++E                           LN   +T  SL +   A+ +P     + G++  + S  ++    + N                       E  P     K  W ++S G+AFRKK    D S   I   +   H  DN + IS               S ++  L+++L+E+D +LTD QL+ALS +HQLEQL++LL  MR EMS+L+ADN RLQ ++ + S+            ++ ++  +  T++   + +    NT      D  + L K     +  I   +  N    ++   P S +     + IG   I+  ++WS L++++R L KEY+S  D F++LG+N ESI  Y +      S+       T S+ P  S          +++ + L++   +N + D + FD LIPK +L RY  LLLEH+ +ILCGPSGTGKT+LA KLA+++  R++++ SS+ L +F VD KS KELR+Y+AT+ EQ   S    +       S P+V++LDNLHHV S +EIF+SF S      P+VIGTM+Q++ S+T NLQ HHNFRWVLC NHMEPVKG+LGR+LRR+ ++ + +    +D L   +EWI+ VWQHINKFLES+SS+DVTIGPRLFL+CPM+++ ++ WF DLWNYS+VPY++EAVREGL   GR+ + W+DP DWI+++WPW  + S++   N  +DPS+LIRLRPEDVG+DS     L  A S  +            P S  S    DS   S  +S+  R    ++     +PL+NML+++QE
Sbjct:  784 AAGPTPATFEDDADLRVSECSSNHYRAMSLPGRQK--RSNAWEVDVTSLNRMEASHMYP--LPPPPMNNTNVYYDVPVCRSKQGRNNGNSTPSLMNIRLPYATLSQGVKPSMSTCSLGKRDDVSEDVYDGLGSRLSLLSTSSYRSLNEERQATEIRKLRRELETAQQKVRTLSGQLSNNGNLVTAFESSLQSMSLRLQKFAASSESKENE---------------------------LNELKNTIESLKKQ--ASSNPGQLDPNSGKIYSSSSLTSLISNSNSN-----------------------EKRPEGSNKKSSWLKNSLGRAFRKKSSKDDGSTESINEIHQKQH--DNGNPISQSM----------TESESLHALRKELEEKDARLTDVQLDALSRSHQLEQLRDLLTKMRYEMSSLKADNNRLQSLMTL-SNAGVPAQSMEQSMNNDSLEQLHQTNSLKNMPKIKDLNTK--PKFDFLNGLVKDDPSCQALIVNVILNNKTKFNVSQQPRSPRDEKITIPIGRVGITSMTSWSDLENNLRRLVKEYMSAIDAFSSLGLNGESIARYRINDDAFISVCN-----TGSMRPLTSPLASCSNKSNSKLSLELKNYSYSNSI-DDMVFDCLIPKAILQRYFGLLLEHKRVILCGPSGTGKTFLAFKLAENIASRYNRDPSSSIL-VFNVDQKSTKELRSYMATLTEQLLKSDPQADSTMSPTSSLPLVIVLDNLHHVPSFSEIFNSFFSIQHARSPFVIGTMSQSNSSSTKNLQLHHNFRWVLCTNHMEPVKGYLGRFLRRQFLKHQLETASPNDQLYHVIEWINIVWQHINKFLESYSSADVTIGPRLFLNCPMNVDNAKAWFVDLWNYSIVPYIIEAVREGLTVHGRKQATWDDPTDWIVRSWPWNDLHSSLPISNNPTDPSNLIRLRPEDVGFDS---YQLITAPSDHIG-----------PYSIASHLGLDSLNSSRLSSTYDRRIRHSDKSESNEPLMNMLLRMQE 1706          
BLAST of Neuron navigator 2 vs. Planmine SMEST
Match: SMESG000058374.1 (SMESG000058374.1)

HSP 1 Score: 536.184 bits (1380), Expect = 6.187e-160
Identity = 368/1015 (36.26%), Postives = 535/1015 (52.71%), Query Frame = 3
Query: 2496 AAGPAPATFED---LQLQSC-------FSLPSSQNFLRSNSARYTDT----ISSDKSFPQNIKLPYATNTNSFISKTEIDSSQ--NNGSS---------------------LSLASNESRRSMSED-----------------------KQSQEIRKLRHELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDHELLQLRNIIESLRQQGFTNNNSNEQGTNLNNDNHTTVSLGRSISATVSPAHFQNSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLENDPFKKQAKKGWFRSSFGKAFRKKFKHSDVSMSDIEGDYYVHHLADNRSRISNDSQNSSKNFMLDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQLKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAINDISATSTANKVVQYVSENTSNCASIDMFSHLFKFSSENEISIGAYVYFN----DIIVSPSSVQHITNKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFANLGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQIKIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTGKTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQSSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVIGTMTQASFSNT-NLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQEKKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGSQIWFTDLWNYSLVPYLLEAVREGLQTFGRR-SNWEDPVDWILQTWPW--ISSNVKTRN--SDPSSLIRLRPEDVGYDSQVPLNLTVASSSSLSNCQSITSSQLIPQSQHSKFLQDXXXXXXXXXXXXXXXXXXXTFPRTDPLLNMLIKLQE 5330
            AAGP PATFED   L++  C        SLP  Q   RSN+     T    + +   +P  +  P   NTN +       S Q  NNG+S                     +S  S   R  +SED                       +Q+ EIRKLR ELE AQQKV TLS +L  N ++ +AFE SL +++ RLQK + +SE K++E                           LN   +T  SL +   A+ +P     + G++  + S  ++    + N                       E  P     K  W ++S G+AFRKK    D S   I   +   H  DN + IS               S ++  L+++L+E+D +LTD QL+ALS +HQLEQL++LL  MR EMS+L+ADN RLQ ++ + S+            ++ ++  +  T++   + +    NT      D  + L K     +  I   +  N    ++   P S +     + IG   I+  ++WS L++++R L KEY+S  D F++LG+N ESI  Y +      S+       T S+ P  S          +++ + L++   +N + D + FD LIPK +L RY  LLLEH+ +ILCGPSGTGKT+LA KLA+++  R++++ SS+ L +F VD KS KELR+Y+AT+ EQ   S    +       S P+V++LDNLHHV S +EIF+SF S      P+VIGTM+Q++ S+T NLQ HHNFRWVLC NHMEPVKG+LGR+LRR+ ++ + +    +D L   +EWI+ VWQHINKFLES+SS+DVTIGPRLFL+CPM+++ ++ WF DLWNYS+VPY++EAVREGL   GR+ + W+DP DWI+++WPW  + S++   N  +DPS+LIRLRPEDVG+DS     L  A S  +            P S  S    DS   S  +S+  R    ++     +PL+NML+++QE
Sbjct:  784 AAGPTPATFEDDADLRVSECSSNHYRAMSLPGRQK--RSNAWEVDVTSLNRMEASHMYP--LPPPPMNNTNVYYDVPVCRSKQGRNNGNSTPSLMNIRLPYATLSQGVKPSMSTCSLGKRDDVSEDVYDGLGSRLSLLSTSSYRSLNEERQATEIRKLRRELETAQQKVRTLSGQLSNNGNLVTAFESSLQSMSLRLQKFAASSESKENE---------------------------LNELKNTIESLKKQ--ASSNPGQLDPNSGKIYSSSSLTSLISNSNSN-----------------------EKRPEGSNKKSSWLKNSLGRAFRKKSSKDDGSTESINEIHQKQH--DNGNPISQSM----------TESESLHALRKELEEKDARLTDVQLDALSRSHQLEQLRDLLTKMRYEMSSLKADNNRLQSLMTL-SNAGVPAQSMEQSMNNDSLEQLHQTNSLKNMPKIKDLNTK--PKFDFLNGLVKDDPSCQALIVNVILNNKTKFNVSQQPRSPRDEKITIPIGRVGITSMTSWSDLENNLRRLVKEYMSAIDAFSSLGLNGESIARYRINDDAFISVCN-----TGSMRPLTSPLASCSNKSNSKLSLELKNYSYSNSI-DDMVFDCLIPKAILQRYFGLLLEHKRVILCGPSGTGKTFLAFKLAENIASRYNRDPSSSIL-VFNVDQKSTKELRSYMATLTEQLLKSDPQADSTMSPTSSLPLVIVLDNLHHVPSFSEIFNSFFSIQHARSPFVIGTMSQSNSSSTKNLQLHHNFRWVLCTNHMEPVKGYLGRFLRRQFLKHQLETASPNDQLYHVIEWINIVWQHINKFLESYSSADVTIGPRLFLNCPMNVDNAKAWFVDLWNYSIVPYIIEAVREGLTVHGRKQATWDDPTDWIVRSWPWNDLHSSLPISNNPTDPSNLIRLRPEDVGFDS---YQLITAPSDHIG-----------PYSIASHLGLDSLNSSRLSSTYDRRIRHSDKSESNEPLMNMLLRMQE 1706          
The following BLAST results are available for this feature:
BLAST of Neuron navigator 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NAV31.231e-16939.91neuron navigator 3 [Source:HGNC Symbol;Acc:HGNC:15... [more]
NAV35.102e-16740.36neuron navigator 3 [Source:HGNC Symbol;Acc:HGNC:15... [more]
NAV34.184e-16439.91neuron navigator 3 [Source:HGNC Symbol;Acc:HGNC:15... [more]
NAV32.879e-16238.94neuron navigator 3 [Source:HGNC Symbol;Acc:HGNC:15... [more]
NAV22.737e-15840.83neuron navigator 2 [Source:HGNC Symbol;Acc:HGNC:15... [more]
back to top
BLAST of Neuron navigator 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-538.334e-5727.77Adapter protein unc-53 [Source:UniProtKB/Swiss-Pr... [more]
unc-533.332e-5627.81Adapter protein unc-53 [Source:UniProtKB/Swiss-Pr... [more]
unc-533.643e-5627.77Adapter protein unc-53 [Source:UniProtKB/Swiss-Pr... [more]
unc-534.426e-5627.77Adapter protein unc-53 [Source:UniProtKB/Swiss-Pr... [more]
unc-534.822e-5627.77Adapter protein unc-53 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Neuron navigator 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sick1.178e-11343.50gene:FBgn0263873 transcript:FBtr0329844[more]
sick1.178e-11343.50gene:FBgn0263873 transcript:FBtr0329839[more]
sick5.431e-11343.09gene:FBgn0263873 transcript:FBtr0332236[more]
sick5.623e-11243.09gene:FBgn0263873 transcript:FBtr0329843[more]
sick5.623e-11243.09gene:FBgn0263873 transcript:FBtr0329840[more]
back to top
BLAST of Neuron navigator 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nav2b2.718e-16338.41neuron navigator 2b [Source:ZFIN;Acc:ZDB-GENE-0612... [more]
nav34.468e-15138.83neuron navigator 3 [Source:NCBI gene;Acc:567779][more]
NAV11.664e-11231.04neuron navigator 1a [Source:NCBI gene;Acc:10053628... [more]
nav1b3.289e-11133.83neuron navigator 1b [Source:ZFIN;Acc:ZDB-GENE-1202... [more]
NAV13.464e-11130.73neuron navigator 1a [Source:NCBI gene;Acc:10053628... [more]
back to top
BLAST of Neuron navigator 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npffr1.14.047e-16238.34neuropeptide FF receptor 1, gene 1 [Source:Xenbase... [more]
npffr1.15.914e-16238.34neuropeptide FF receptor 1, gene 1 [Source:Xenbase... [more]
npffr1.15.947e-16238.34neuropeptide FF receptor 1, gene 1 [Source:Xenbase... [more]
npffr1.16.469e-15938.49neuropeptide FF receptor 1, gene 1 [Source:Xenbase... [more]
npffr1.11.274e-15637.51neuropeptide FF receptor 1, gene 1 [Source:Xenbase... [more]
back to top
BLAST of Neuron navigator 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nav38.182e-16639.91neuron navigator 3 [Source:MGI Symbol;Acc:MGI:2183... [more]
Nav25.384e-16538.36neuron navigator 2 [Source:MGI Symbol;Acc:MGI:2183... [more]
Nav26.504e-16538.36neuron navigator 2 [Source:MGI Symbol;Acc:MGI:2183... [more]
Nav27.770e-16538.36neuron navigator 2 [Source:MGI Symbol;Acc:MGI:2183... [more]
Nav34.937e-16339.46neuron navigator 3 [Source:MGI Symbol;Acc:MGI:2183... [more]
back to top
BLAST of Neuron navigator 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q80TN7|NAV3_MOUSE5.962e-16439.91Neuron navigator 3 OS=Mus musculus OX=10090 GN=Nav... [more]
sp|Q8IVL0|NAV3_HUMAN1.383e-16138.94Neuron navigator 3 OS=Homo sapiens OX=9606 GN=NAV3... [more]
sp|Q8IVL1|NAV2_HUMAN4.631e-15240.66Neuron navigator 2 OS=Homo sapiens OX=9606 GN=NAV2... [more]
sp|Q5TZ18|NAV3_DANRE3.373e-15038.83Neuron navigator 3 OS=Danio rerio OX=7955 GN=nav3 ... [more]
sp|Q9VIQ9|SICK_DROME1.857e-11043.09Protein sickie OS=Drosophila melanogaster OX=7227 ... [more]
back to top
BLAST of Neuron navigator 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1Z5LEM20.000e+041.44Neuron navigator 2 (Fragment) OS=Ornithodoros moub... [more]
A0A1S3J6D71.105e-2843.09neuron navigator 2 isoform X8 OS=Lingula unguis OX... [more]
V3ZVA50.000e+042.86AAA domain-containing protein (Fragment) OS=Lottia... [more]
A0A2J7PBH50.000e+040.26AAA domain-containing protein OS=Cryptotermes secu... [more]
A0A2J7PBH00.000e+040.26AAA domain-containing protein OS=Cryptotermes secu... [more]
back to top
BLAST of Neuron navigator 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nav31.794e-16339.15neuron navigator 3 [Source:NCBI gene;Acc:103044466... [more]
nav31.229e-16239.01neuron navigator 3 [Source:NCBI gene;Acc:103044466... [more]
nav31.307e-16239.01neuron navigator 3 [Source:NCBI gene;Acc:103044466... [more]
nav32.930e-16239.01neuron navigator 3 [Source:NCBI gene;Acc:103044466... [more]
nav33.139e-16239.01neuron navigator 3 [Source:NCBI gene;Acc:103044466... [more]
back to top
BLAST of Neuron navigator 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000554.12.064e-14842.70pep scaffold:Pmarinus_7.0:GL476467:19579:154902:-1... [more]
ENSPMAT00000005258.11.405e-6028.80pep scaffold:Pmarinus_7.0:GL479251:795:35698:-1 ge... [more]
ENSPMAT00000005257.14.292e-6028.45pep scaffold:Pmarinus_7.0:GL479251:795:35698:-1 ge... [more]
ENSPMAT00000005268.11.548e-5828.97pep scaffold:Pmarinus_7.0:GL479251:795:35698:-1 ge... [more]
ENSPMAT00000008111.12.980e-931.82pep scaffold:Pmarinus_7.0:GL478136:8967:48859:1 ge... [more]
back to top
BLAST of Neuron navigator 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neuron navigator 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO397464.875e-3623.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO315881.798e-1338.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495765.603e-1136.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO291011.573e-1035.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
ALPHA-ACTININ2.605e-930.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Neuron navigator 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nav2a6.921e-16742.01neuron navigator 2 [Source:NCBI gene;Acc:105356399... [more]
nav2a7.411e-16742.01neuron navigator 2 [Source:NCBI gene;Acc:105356399... [more]
nav2a1.254e-16642.01neuron navigator 2 [Source:NCBI gene;Acc:105356399... [more]
nav2a1.357e-16642.01neuron navigator 2 [Source:NCBI gene;Acc:105356399... [more]
nav2a1.645e-16642.01neuron navigator 2 [Source:NCBI gene;Acc:105356399... [more]
back to top
BLAST of Neuron navigator 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000036210.10.000e+096.88SMESG000036210.1[more]
SMESG000036210.10.000e+096.87SMESG000036210.1[more]
SMESG000058374.14.558e-16036.26SMESG000058374.1[more]
SMESG000058374.15.720e-16036.26SMESG000058374.1[more]
SMESG000058374.16.187e-16036.26SMESG000058374.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035965 ID=SMED30035965|Name=Neuron navigator 2|organism=Schmidtea mediterranea sexual|type=transcript|length=5705bp
TCTTCCGATCTCTGAAATTCGATATCGTGCCTACTCCGAGCTCATGTAGA
AATTGGGAAATTTAAACCAAATAAATAAACCATTATACAAGGATGTCTGA
CGTCATGAAAATGAGCACAACAACAGATCCCGAATCGGAATTGAGTGGTT
TAGCGACAGTTTCCGACACATCCGAGTATCAGGCTAGTCTTTTGAATGAG
TGCAAAGAAGATGTTGAAAACGAAATGAAATTTGACAGTGAAAATTCTAT
TTCGAAGACTCAACAAGCCAATGCTTTGTTGACAATTTACACAGAATGGG
CGAATCATTATTTGGAAAAGGCTGGATTCAACAATTTTGTCAATGATTTG
CAGACCGATCTATGCGATGGTGCCTTATTGGCAGACATCATAATAGCCGT
GACTGGTGAAAAAGTGCCAAACACAAAACCTAAACCAAAGACTCAAATTC
AACAAATGGAGAATCTGAATTCATGTTTGATTTTTCTATCAAATATCGGT
GTCGTGACTGAAGGCATTCAATCAAAAGATATTAACGATGGAAATTTGAA
AGCGATATTGGGTTTGCTGTTTAATTTGTCTCGGTATAAGCAGCAGTTGA
AACAACAGTCGTCTTCGGCAAGCACTCCGTCGGCAGTCTCGAGCAACGGT
TCAACCCAGAGCGGAAACAACAATGTCCATAAACCCAACCGAGCTTCGAT
TCTCAGAACCTCAACAACCGGTATTCCAACTTTGTCAGTTAAACCGAACG
AATTACAATCTCCAAAATCTGTAACTTTAAGAAAACCAGATGGACTAGTA
TGCAAGAAGAATATTAACAACAACAATAATAACAATTCCGATACCTCAGT
AGGCAGCAGCGTTGTTTCATCGAAACGAAATTCTGGAATAAAAACGAAAC
GAACTGATTCACCAAGTAACAATTCTTCAGTCAGCTCGACTTATTCAACC
AGTATTCCTCTACCTGCCAACATTTCTACCAATAATAGTGTGAAAAATTC
ACCATTAATTGGTGAACCATCTGTCCAAAACTGTCGATCGGCCAGTGTTT
CTAGTAATTCTCCGGTATTAAAAAAATCTTCCAATCCATCAATTGATACC
GGAAACAATATGTTTGATCGTTTTAAACTATTCCGAAACAGTGCAAATGA
AAGAATAAATAGAGGATCACCGTTGCATAATTATCCTTCTGTGACATCGA
AAGATAATGGGTCAATTTTAATAAGTGATCCGATCACTCAGCGATCAATG
ACACCTTTTAATCCAAGATTGATGCATAATTTCAATCCAAATCTATGTCC
ACCAGGAACTCCTAATAAATTACAACAAGTTCCTTATTCAATGTTTGACG
GTCAATCAGTGCAACAAGTCATGCAACCGAATTTTCACAATTTCAATTCC
AATCTTCAAGACATTAAATTCCAGCCAACCGCTCCAGTACGAACGGAATC
AGTACGGCAAAGTGCATCATCTAAAGATTCCTGTGTTCAAAAAATTCAGT
GCGATCAAAGAAAAGCAAGAAACAAAGAATCCGAACCAATTAGAATGGAA
ACTGTTACTAATGAACCTTCATTAAGGAGCAATAGTCGCCATGAACGCCA
GAAAGCCAAAGATCTTTATACAGCATTAAAACAACGAGATAGAAATAAAT
ACAATTTCTCACCTCAAATATCAGACAATAATGAACTAAACCGAGAACCA
GTGAATAACAAACAAGTCCGAATGATGTCGAGTCAAGAATTTACACAATT
GATCCAAAATGATCCTCGACTAAGGCAGTATGTTGAGAATCAGTCAAATG
TCAAAAGAAACATGATACTAGAAGCAACAAAAACGACTGGAGTAATTTCA
AATGATTCTCTAAAAAAGCAAATTATTGAAGTTAAATCTGGATCAATCCA
AACAAAATCGCTTCAAGAATCTGCCAATCTATCAGCAGACCAACTGAAAT
CGGACGTCGGACAATTAATAAGTGACAAAAATCGAAGAAAAGTTATAGAA
AACAAAACGAAACCTATACCTCCAAACCATACAGATCTTTCTAACTGCAC
TTCAAATGTAATGGGTAAAAAAGAACCATTACTTTGGCTTCAACATCGCC
CTTCAATGAGTGGTACAGATTCAAGTGAATACTCTACTAATTATGCTTGT
ATGCGAAAATATGCATCTGACTTCGAAGCAGATTTAGAGCTAGACTCATC
AGTTGAGATCTCAACTCAAACTGACAAATCTGCCAAAATGGGATATTACT
CTGATTCTGATTCAATTTTAAATCCTCGCTTCGGAAAATTGGATCACTGT
CAAAACTCTGATTTGTCAGCATTAATCAGTGAGAAATTAGTCGGATATCG
CCGATTAATGAATACATCAGGGATGGATCCGGCAACATATTTGTCGTATC
AGAAAAATTTAATGGCAAGTAAACGAGGAACTCCTCAATCTGCAGATAAA
GATCGTATTTATGGAATTGTATTAAATTCTAATGTTGCTCGATCAGCTGC
TGGGCCCGCTCCGGCTACATTTGAAGACTTACAATTACAAAGTTGCTTTT
CTCTGCCATCATCACAAAATTTTCTCAGATCTAACAGTGCCAGATATACT
GATACTATTTCTAGCGATAAATCGTTTCCGCAAAATATCAAATTGCCTTA
TGCTACCAATACAAATAGTTTCATTAGCAAAACCGAGATAGATTCATCGC
AAAACAATGGATCAAGTCTTTCTCTCGCATCAAATGAATCCCGTCGATCA
ATGTCCGAAGACAAACAATCACAAGAGATCAGGAAATTGCGTCACGAATT
GGAGATGGCTCAACAAAAAGTAATAACACTCTCCAGTCGTCTCAAAACAA
ATGCTCACATGGCGTCGGCTTTTGAACTTAGTCTAATGAATGTCACAGAG
AGACTCCAAAAGTTATCAGAAACTTCTGAACGAAAAGATCATGAATTACT
GCAATTGCGGAATATCATTGAATCCTTGCGACAACAAGGTTTCACTAACA
ATAATAGTAATGAACAAGGAACAAACTTAAATAATGATAATCATACTACG
GTTTCATTAGGGCGGAGTATAAGTGCAACAGTAAGTCCAGCACATTTTCA
GAATTCTTTGGGCCGTGTAAAAGGAAATGAGTCTAATAAAAATGTAGCTG
AATATGATTCCATTAATAATATTGGACTGATTGGTTCATCTGAATCTTGT
ACAAGTTTGGTTAGCACAGACATTGGAAGTTCCTTAGAAAATGATCCATT
CAAAAAACAAGCTAAGAAAGGATGGTTTCGAAGCTCATTCGGAAAAGCTT
TCCGTAAAAAGTTTAAACATTCTGATGTATCCATGTCAGATATTGAAGGG
GATTATTACGTTCATCATTTAGCAGACAATAGATCTCGAATTTCCAACGA
TAGTCAAAACAGTTCGAAAAACTTCATGCTAGACGCTTCTTCAAATACAA
TTGAGAATTTGAAACAACAACTTCAAGAAAGAGATTTAAAATTAACAGAT
GCGCAACTTGAAGCTCTTTCAAGTGCTCATCAGTTAGAGCAACTCAAAGA
ATTGTTAAATGCAATGAGGTGTGAAATGTCAACTCTTCGAGCGGACAACG
AACGTTTACAAAAAATGGTCCGCATTGAATCTGATCCAAATGAAGAAACG
AATTATAATACAGGTGATGAAGACAGTAGTGCGATTAATGATATTTCTGC
TACTTCAACAGCGAATAAAGTTGTTCAATATGTTTCAGAAAACACTAGCA
ATTGTGCTTCAATTGATATGTTCAGTCATTTATTCAAATTTTCTAGTGAA
AACGAGATTAGTATAGGAGCATATGTCTATTTTAATGATATTATTGTATC
CCCGTCGAGTGTTCAACACATTACTAACAAGGTCCTAATTGGATCTTGTC
ACATATCAGAAAGTTCTACGTGGTCACAGTTGGATTCACATATCAGATGC
CTTTTCAAAGAATATTTATCTTTTAATGATCCGTTTGCTAATCTTGGAAT
CAATCCAGAAAGTATTGAACACTATACTTTGGGATCTGTACAAAAGCGTT
CAATCAATGAAGAAAGTCAAAATGAGACCGATTCTATTACTCCCTATCAA
TCAATAAATAACATTGATTTAGAAGCAGAAGAAAATCAAATAAAAATTAT
TTTGAGAAGCACAAAGTTAAATAATCCAGTCTTAGATGCACTTGCTTTTG
ATACACTTATTCCTAAAACTGTTCTTCATCGATATGTATCGCTTCTATTA
GAACATCGACTTATTATTTTATGTGGGCCCTCAGGGACTGGCAAAACTTA
TCTGGCTAACAAATTGGCGAAACATCTTATAATCAGACATGATCAGGAAG
TTTCATCAACAACACTGGCAATGTTTACAGTCGATCACAAGTCCAACAAA
GAACTTAGAACGTATTTAGCTACTATAGCTGAGCAATCTCAGTCTAGTTT
TGACAATAACAATTGTCGAAACCTTGTTTGTCGCAGTCCTCCGATTGTTG
TAATTTTAGATAATTTACATCATGTTAATTCTCTTGCTGAAATTTTCGAC
AGCTTTCTTAGTTCCAATATACAAAACAGGCCTTATGTTATTGGAACGAT
GACCCAAGCGTCCTTTTCGAATACTAATCTTCAAGCTCATCACAACTTTA
GATGGGTTTTGTGTGCAAATCATATGGAACCTGTTAAAGGATTTTTGGGA
CGATACCTTCGAAGAAAACTCATTCAAGCAGAGTGGCAGGAGAAAAAACA
TGATGATTCGTTGCTAGCAACTGTTGAATGGATATCAAAAGTCTGGCAGC
ATATAAATAAGTTTTTAGAAAGCCACAGTTCATCAGACGTGACGATAGGT
CCAAGATTATTTCTTTCGTGTCCAATGAGTATGGAAGGATCTCAAATATG
GTTTACCGATCTTTGGAATTACTCACTCGTTCCATATTTATTGGAAGCTG
TTCGTGAGGGGTTACAGACATTTGGTCGTCGATCAAATTGGGAAGATCCA
GTTGATTGGATATTACAAACTTGGCCATGGATATCTTCTAATGTGAAAAC
AAGAAATTCAGATCCAAGTTCATTGATCAGATTGCGACCTGAGGATGTTG
GATATGATAGTCAAGTACCTCTTAATTTAACTGTCGCTTCGTCATCATCT
TTATCTAATTGTCAGTCTATTACTTCATCGCAATTAATACCACAAAGCCA
ACATTCAAAATTTCTACAGGATTCAAAGCTGCTTTCCTTATCAAATTCGT
CATCGCATAGACACGCCAATTCTAATAACACTTTCCCTCGTACTGATCCT
TTACTTAACATGCTGATAAAACTCCAGGAAGCTGCAAACTATTCGACCAG
TCCTGGCAGTAATGATAGTGACATCGCTTCCAGTAAATCTAATTCTTTAT
CCAGGATTAATTCATCAGTCAATTCAGGTGGCCAGACATCACAGATACAT
AAAATTTTCAAAACCGATATTCTATGATTTACTTATAAATATTATTGTAA
ACAATGAAGATAGCTTTTAGAATGAAAACTTTTATACGTAAACTATTGTT
TGTCAAATACGATTTGTACATTTATTTCCCCAAGATTTCGGTAGAAACGC
AGCTCTCATTTTTGCTCATGATAGTTTATTATCACTGTTGATAATTCTGA
CAATATCTGACAATAATGTTATTAATATTTACCATTATTATTATTATTAT
TATTA
back to top

protein sequence of SMED30035965-orf-1

>SMED30035965-orf-1 ID=SMED30035965-orf-1|Name=SMED30035965-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1795bp
MSDVMKMSTTTDPESELSGLATVSDTSEYQASLLNECKEDVENEMKFDSE
NSISKTQQANALLTIYTEWANHYLEKAGFNNFVNDLQTDLCDGALLADII
IAVTGEKVPNTKPKPKTQIQQMENLNSCLIFLSNIGVVTEGIQSKDINDG
NLKAILGLLFNLSRYKQQLKQQSSSASTPSAVSSNGSTQSGNNNVHKPNR
ASILRTSTTGIPTLSVKPNELQSPKSVTLRKPDGLVCKKNINNNNNNNSD
TSVGSSVVSSKRNSGIKTKRTDSPSNNSSVSSTYSTSIPLPANISTNNSV
KNSPLIGEPSVQNCRSASVSSNSPVLKKSSNPSIDTGNNMFDRFKLFRNS
ANERINRGSPLHNYPSVTSKDNGSILISDPITQRSMTPFNPRLMHNFNPN
LCPPGTPNKLQQVPYSMFDGQSVQQVMQPNFHNFNSNLQDIKFQPTAPVR
TESVRQSASSKDSCVQKIQCDQRKARNKESEPIRMETVTNEPSLRSNSRH
ERQKAKDLYTALKQRDRNKYNFSPQISDNNELNREPVNNKQVRMMSSQEF
TQLIQNDPRLRQYVENQSNVKRNMILEATKTTGVISNDSLKKQIIEVKSG
SIQTKSLQESANLSADQLKSDVGQLISDKNRRKVIENKTKPIPPNHTDLS
NCTSNVMGKKEPLLWLQHRPSMSGTDSSEYSTNYACMRKYASDFEADLEL
DSSVEISTQTDKSAKMGYYSDSDSILNPRFGKLDHCQNSDLSALISEKLV
GYRRLMNTSGMDPATYLSYQKNLMASKRGTPQSADKDRIYGIVLNSNVAR
SAAGPAPATFEDLQLQSCFSLPSSQNFLRSNSARYTDTISSDKSFPQNIK
LPYATNTNSFISKTEIDSSQNNGSSLSLASNESRRSMSEDKQSQEIRKLR
HELEMAQQKVITLSSRLKTNAHMASAFELSLMNVTERLQKLSETSERKDH
ELLQLRNIIESLRQQGFTNNNSNEQGTNLNNDNHTTVSLGRSISATVSPA
HFQNSLGRVKGNESNKNVAEYDSINNIGLIGSSESCTSLVSTDIGSSLEN
DPFKKQAKKGWFRSSFGKAFRKKFKHSDVSMSDIEGDYYVHHLADNRSRI
SNDSQNSSKNFMLDASSNTIENLKQQLQERDLKLTDAQLEALSSAHQLEQ
LKELLNAMRCEMSTLRADNERLQKMVRIESDPNEETNYNTGDEDSSAIND
ISATSTANKVVQYVSENTSNCASIDMFSHLFKFSSENEISIGAYVYFNDI
IVSPSSVQHITNKVLIGSCHISESSTWSQLDSHIRCLFKEYLSFNDPFAN
LGINPESIEHYTLGSVQKRSINEESQNETDSITPYQSINNIDLEAEENQI
KIILRSTKLNNPVLDALAFDTLIPKTVLHRYVSLLLEHRLIILCGPSGTG
KTYLANKLAKHLIIRHDQEVSSTTLAMFTVDHKSNKELRTYLATIAEQSQ
SSFDNNNCRNLVCRSPPIVVILDNLHHVNSLAEIFDSFLSSNIQNRPYVI
GTMTQASFSNTNLQAHHNFRWVLCANHMEPVKGFLGRYLRRKLIQAEWQE
KKHDDSLLATVEWISKVWQHINKFLESHSSSDVTIGPRLFLSCPMSMEGS
QIWFTDLWNYSLVPYLLEAVREGLQTFGRRSNWEDPVDWILQTWPWISSN
VKTRNSDPSSLIRLRPEDVGYDSQVPLNLTVASSSSLSNCQSITSSQLIP
QSQHSKFLQDSKLLSLSNSSSHRHANSNNTFPRTDPLLNMLIKLQEAANY
STSPGSNDSDIASSKSNSLSRINSSVNSGGQTSQIHKIFKTDIL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0022008neurogenesis
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036872CH_dom_sf
IPR039041Nav/unc-53
IPR001715CH-domain
IPR003593AAA+_ATPase
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005524ATP binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 889..916
NoneNo IPR availableCOILSCoilCoilcoord: 1113..1140
NoneNo IPR availableCOILSCoilCoilcoord: 945..965
NoneNo IPR availableCOILSCoilCoilcoord: 1148..1175
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1375..1520
e-value: 2.7E-10
score: 42.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1750..1781
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 449..504
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 865..895
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 170..285
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 170..226
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 449..466
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 238..285
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 467..485
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 865..883
NoneNo IPR availablePANTHERPTHR12784:SF18NEURON NAVIGATOR 3coord: 871..1676
NoneNo IPR availablePANTHERPTHR12784:SF18NEURON NAVIGATOR 3coord: 28..230
NoneNo IPR availableCDDcd00009AAAcoord: 1391..1502
e-value: 3.11706E-7
score: 49.8371
IPR003593AAA+ ATPase domainSMARTSM00382AAA_5coord: 1387..1532
e-value: 9.4E-5
score: 31.8
IPR003593AAA+ ATPase domainPFAMPF13401AAA_22coord: 1388..1486
e-value: 5.3E-7
score: 30.0
IPR001715Calponin homology domainSMARTSM00033ch_5coord: 62..165
e-value: 1.5E-13
score: 61.0
IPR001715Calponin homology domainPFAMPF00307CHcoord: 66..167
e-value: 3.1E-16
score: 59.5
IPR001715Calponin homology domainPROSITEPS50021CHcoord: 60..167
score: 18.971
IPR001715Calponin homology domainCDDcd00014CHcoord: 67..167
e-value: 2.53674E-17
score: 77.3511
IPR036872CH domain superfamilyGENE3DG3DSA:1.10.418.10coord: 50..172
e-value: 4.5E-29
score: 102.8
IPR036872CH domain superfamilySUPERFAMILYSSF47576Calponin-homology domain, CH-domaincoord: 64..174
IPR039041Nav/unc-53 familyPANTHERPTHR12784STEERINcoord: 28..230
coord: 871..1676
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 1356..1521
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 1390..1585