Usp domain-containing protein

Overview
NameUsp domain-containing protein
Smed IDSMED30035955
Length (bp)592
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035955

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testisSMED30035955h1SMcG0015139 PL08007A2E07smed_ncbi_20240424PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30035955h1SMcG0015139 Contig5606GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
reproductive organSMED30035955h1SMcG0015139 Contig32526uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30035955h1SMcG0015139 Contig32526newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
testisSMED30035955h1SMcG0015142 Contig5606GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Usp domain-containing protein vs. UniProt/SwissProt
Match: sp|A0QZA1|Y3950_MYCS2 (Universal stress protein MSMEG_3950/MSMEI_3859 OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=MSMEG_3950 PE=1 SV=1)

HSP 1 Score: 51.9878 bits (123), Expect = 6.099e-7
Identity = 41/153 (26.80%), Postives = 75/153 (49.02%), Query Frame = 1
Query:   58 KKESERIIIIPIDKSEVSRRALDWYSNNMMKENDVVHLIHIVEPIYNTIAVGIGMEAAWLPMEELDAKIQKQIDKGKALVREYISNLTDKGGKCKGFIRVDSRVGECIISVCHDHLADVILMANRGEGLLRRTFLGSVSDYVLHHADKPVIIV 516
            +  +E  I++ +D S  S  A+ W +      +  + L+H++ P+  +   G  M A  L  +E +A+    I++ + +V + +      G   +  IR +S V   +I       A ++++ NRG G L R  LGS S  +LH+A  PV++V
Sbjct:    3 QSATEYGILVGVDSSAESDAAVRWAAREASLHDAPITLMHVIAPVVVSWPAGPYM-ATVLECQEENAR--HAIEQAQKVVADCLGE--THGLTVQTEIRKES-VARTLIDASKS--AQMVVVGNRGMGALGRVLLGSTSTSLLHYASGPVVVV 147          
BLAST of Usp domain-containing protein vs. TrEMBL
Match: A0A095AGD1 (Universal stress protein OS=Schistosoma haematobium OX=6185 GN=MS3_01105 PE=4 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 2.836e-47
Identity = 77/151 (50.99%), Postives = 104/151 (68.87%), Query Frame = 1
Query:   70 ERIIIIPIDKSEVSRRALDWYSNNMMKENDVVHLIHIVEPIYNTIAVGIGMEAAWLPMEELDAKIQKQIDKGKALVREYISNLTDKGGKCKGFIRVDSRVGECIISVCHDHLADVILMANRGEGLLRRTFLGSVSDYVLHHADKPVIIVPP 522
            +R++++PID SE + RA  WY NNM   ND+V  ++IVEP+YNT AVG+ ME    P+ ++   +Q  IDKGK L ++YIS        C+ F+ VD+R G  I+    DH A++I+M +RG G+LRRTFLGSVSDYVLHHA  PV+IVPP
Sbjct:    8 QRVVLLPIDGSEHAERAFHWYLNNMKSSNDIVKFVNIVEPVYNTPAVGLTMETP--PLTDITKIMQDSIDKGKLLGKKYISEAKKYDINCQAFLHVDNRPGAAILKSIEDHNANLIIMGSRGLGVLRRTFLGSVSDYVLHHAHIPVVIVPP 156          
BLAST of Usp domain-containing protein vs. TrEMBL
Match: A0A430QIP7 (Usp domain-containing protein OS=Schistosoma bovis OX=6184 GN=DC041_0011032 PE=4 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 2.836e-47
Identity = 77/151 (50.99%), Postives = 104/151 (68.87%), Query Frame = 1
Query:   70 ERIIIIPIDKSEVSRRALDWYSNNMMKENDVVHLIHIVEPIYNTIAVGIGMEAAWLPMEELDAKIQKQIDKGKALVREYISNLTDKGGKCKGFIRVDSRVGECIISVCHDHLADVILMANRGEGLLRRTFLGSVSDYVLHHADKPVIIVPP 522
            +R++++PID SE + RA  WY NNM   ND+V  ++IVEP+YNT AVG+ ME    P+ ++   +Q  IDKGK L ++YIS        C+ F+ VD+R G  I+    DH A++I+M +RG G+LRRTFLGSVSDYVLHHA  PV+IVPP
Sbjct:    8 QRVVLLPIDGSEHAERAFHWYLNNMKSSNDIVKFVNIVEPVYNTPAVGLTMETP--PLTDITKIMQDSIDKGKLLGKKYISEAKKYDINCQAFLHVDNRPGAAILKSIEDHNANLIIMGSRGLGVLRRTFLGSVSDYVLHHAHIPVVIVPP 156          
BLAST of Usp domain-containing protein vs. TrEMBL
Match: A0A183JK49 (Usp domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS3077 PE=4 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 2.836e-47
Identity = 77/151 (50.99%), Postives = 104/151 (68.87%), Query Frame = 1
Query:   70 ERIIIIPIDKSEVSRRALDWYSNNMMKENDVVHLIHIVEPIYNTIAVGIGMEAAWLPMEELDAKIQKQIDKGKALVREYISNLTDKGGKCKGFIRVDSRVGECIISVCHDHLADVILMANRGEGLLRRTFLGSVSDYVLHHADKPVIIVPP 522
            +R++++PID SE + RA  WY NNM   ND+V  ++IVEP+YNT AVG+ ME    P+ ++   +Q  IDKGK L ++YIS        C+ F+ VD+R G  I+    DH A++I+M +RG G+LRRTFLGSVSDYVLHHA  PV+IVPP
Sbjct:    8 QRVVLLPIDGSEHAERAFHWYLNNMKSSNDIVKFVNIVEPVYNTPAVGLTMETP--PLTDITKIMQDSIDKGKLLGKKYISEAKKYDINCQAFLHVDNRPGAAILKSIEDHNANLIIMGSRGLGVLRRTFLGSVSDYVLHHAHIPVVIVPP 156          
BLAST of Usp domain-containing protein vs. TrEMBL
Match: A0A183WUS6 (Usp domain-containing protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS15878 PE=4 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 7.775e-47
Identity = 76/153 (49.67%), Postives = 104/153 (67.97%), Query Frame = 1
Query:   64 ESERIIIIPIDKSEVSRRALDWYSNNMMKENDVVHLIHIVEPIYNTIAVGIGMEAAWLPMEELDAKIQKQIDKGKALVREYISNLTDKGGKCKGFIRVDSRVGECIISVCHDHLADVILMANRGEGLLRRTFLGSVSDYVLHHADKPVIIVPP 522
            E+ R++++PID SE ++RA  WY  NM + ND+V  I+IVEP+Y T AVG+ ME    P+ ++   +Q  ID GK L ++YI+     G  C+ F+ VD+R G  ++    DH A+VI+M NRG G +RRTFLGSVS+YVLHHA  PVIIVPP
Sbjct:    6 ETPRVVLMPIDGSEHAQRAFQWYIENMKRPNDIVKFINIVEPVYATPAVGLTMETP--PLTDITKMMQDSIDNGKVLGKKYITEAKQCGVNCQAFLHVDTRPGAALLKSIEDHNANVIIMGNRGLGAIRRTFLGSVSEYVLHHAHIPVIIVPP 156          
BLAST of Usp domain-containing protein vs. TrEMBL
Match: A0A183QK93 (Usp domain-containing protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 1.657e-46
Identity = 76/151 (50.33%), Postives = 103/151 (68.21%), Query Frame = 1
Query:   70 ERIIIIPIDKSEVSRRALDWYSNNMMKENDVVHLIHIVEPIYNTIAVGIGMEAAWLPMEELDAKIQKQIDKGKALVREYISNLTDKGGKCKGFIRVDSRVGECIISVCHDHLADVILMANRGEGLLRRTFLGSVSDYVLHHADKPVIIVPP 522
             R++++PID SE + RA  WY NNM   ND+V  ++IVEP+Y T AVG+ ME    P+ ++   +Q  IDKGK L ++YI+     G  C+ FI VD+R G  ++    DH A++I+M +RG G+LRRTFLGSVSDYVLHHA  PV+IVPP
Sbjct:    8 SRVVLLPIDGSEHAERAFHWYLNNMRSSNDIVTFVNIVEPVYATPAVGLTMETP--PLTDITKIMQDSIDKGKLLGKKYIAEAKKYGINCQAFIHVDNRPGAALLKSIEDHNANLIIMGSRGLGILRRTFLGSVSDYVLHHAHIPVVIVPP 156          
BLAST of Usp domain-containing protein vs. Ensembl Nematostella
Match: EDO45800 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRQ2])

HSP 1 Score: 100.138 bits (248), Expect = 4.170e-27
Identity = 63/158 (39.87%), Postives = 89/158 (56.33%), Query Frame = 1
Query:   46 SLEPKKESERIIIIPIDKSEVSRRALDWYSNNMMKENDVVHLIHIVEPIYNTIAVGIGMEAAWLPMEELDAKIQKQIDKGKALVREYISNLTDKGGKCKGFIRVDSRVGECIISVCHDHLADVILMANRGEGLLRRTFLGSVSDYVLHHADKPVIIVP 519
            S EPKK   R I++PID S+ S  A +WY NNM  E D + L+H++    ++ A+   + +  L  +E   ++ K + + KAL  +Y +       K K  +R   + GE I     D   D+ILM +RG G +RRT LGSVSDYVLHHA  P II+P
Sbjct:    3 SEEPKKV--RRILLPIDSSKHSEDAFEWYVNNMHHEEDELILVHVL----DSAAIQTRVSSHGLVDDEFKNEMNKGLKEVKALEEKYKTKAETASLKAKIEVR-GGKPGETICQCSKDEHCDLILMGSRGLGSIRRTILGSVSDYVLHHAHVPTIIIP 153          
BLAST of Usp domain-containing protein vs. Ensembl Nematostella
Match: EDO44746 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUS8])

HSP 1 Score: 93.5893 bits (231), Expect = 1.472e-24
Identity = 53/155 (34.19%), Postives = 84/155 (54.19%), Query Frame = 1
Query:   70 ERIIIIPIDKSEVSRRALDWYSNNMMKENDVVHLIHIVE-PIYNTIAVGIGMEAAWLPMEELDAKIQKQIDKGKALVREYISNLTDKGGKCKGFIRVDSRVGECIISVCHDHLADVILMANRGEGLLRRTFLGSVSDYVLHHADKPVIIVPPLHR 531
            +R ++IP+D S+ S RA +WY  ++ +  D V +IH  E P   +     G     LP +E +  + + I   K L+ EY     ++G  C+ F +   + GE I  +  D  A  ++M +RG G +RRT LGSVSDY +HH+  PV ++PP  +
Sbjct:    6 KRRVVIPVDGSQHSERAFNWYRQHVHEPGDEVLIIHTQEQPTIPSSPYAYG--GTVLP-DEWNKAVDECIVNAKKLIEEYNKKCKEQGMTCRLF-KGSGQPGETICQLAKDLSAKHVVMGSRGCGTIRRTLLGSVSDYCVHHSSVPVTVIPPTKK 156          
BLAST of Usp domain-containing protein vs. Ensembl Nematostella
Match: EDO34658 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNQ5])

HSP 1 Score: 93.2041 bits (230), Expect = 3.507e-24
Identity = 54/161 (33.54%), Postives = 86/161 (53.42%), Query Frame = 1
Query:   61 KESERI-IIIPIDKSEVSRRALDWYSNNMMKENDVVHLIH---IVEPIYNTIAVGIGMEAAWLPMEELDAKIQKQIDKGKALVREYISNLTDKGGKCKGFIRVDSRVGECIISVCHDHLADVILMANRGEGLLRRTFLGSVSDYVLHHADKPVIIVPPLHR 531
            +ES++  ++I +D SE S RA ++YS NM K+ D V LIH   I E        G+     W      D  +++  ++ K ++  +     +    CK F +V +  GE I     +  AD +++  RG+G +RRTF+GSVS+Y +HHA  P+ +VPP  R
Sbjct:    3 QESQKSRVVIAVDGSEHSDRAFEFYSQNMHKKGDEVLLIHANDIAERHIQLHPYGLATVEGW------DKWLERCTEESKKMLSRFEKKCKENKFNCKLFTKVGN-PGEVICDFTEEKNADQVVLGCRGQGTVRRTFMGSVSEYCIHHATTPITVVPPPDR 156          
BLAST of Usp domain-containing protein vs. Ensembl Nematostella
Match: EDO34657 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNQ4])

HSP 1 Score: 92.0485 bits (227), Expect = 7.810e-24
Identity = 59/165 (35.76%), Postives = 87/165 (52.73%), Query Frame = 1
Query:   43 ISLEPKKESERIIIIPIDKSEVSRRALDWYSNNMMKENDVVHLIHIVEPIYNTIAVGIGMEAAW--LPMEELDAKIQKQIDKGKALVREYISNLTDKGGKCKGFIRVDSRVGECIISVCHDHLADVILMANRGEGLLRRTFLGSVSDYVLHHADKPVIIVPPLHR 531
            +S EPKK     ++I +D SE S RA D+YS +M +++D V LIH      N  A     E       +E LD  +++   + K L+  +     +    CK F ++  + GE I     +  AD I++  RG+  LRRT +GSVSDY + HA KPV +VPP +R
Sbjct:    1 MSEEPKKSR---VVIAVDGSEHSDRAFDFYSKSMHRKDDEVLLIHA-----NDFADRHTQEHHHNVATVESLDRWLERCTKESKKLLSSFEKKCKENKFNCKLFTKI-GKPGEVICEFMEEKNADQIVLGCRGQDTLRRTLMGSVSDYCIRHATKPVTVVPPPNR 156          
BLAST of Usp domain-containing protein vs. Ensembl Nematostella
Match: EDO33143 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST34])

HSP 1 Score: 90.8929 bits (224), Expect = 1.557e-23
Identity = 50/149 (33.56%), Postives = 83/149 (55.70%), Query Frame = 1
Query:   73 RIIIIPIDKSEVSRRALDWYSNNMMKENDVVHLIHIVEPIYNTIAVGIGMEAAWLPMEELDAKIQKQIDKGKALVREYISNLTDKGGKCKGFIRVDSRVGECIISVCHDHLADVILMANRGEGLLRRTFLGSVSDYVLHHADKPVIIVP 519
            R I+IP+D SE S RA DWY+  +    D V ++H +E     + +       +   EE  A +++  ++ +A++R Y     +K    +  + V    G+ I  V  D  A++I++  RG+G++RRT LGSVSDYV+HH+  PV ++P
Sbjct:    4 RKILIPVDGSEHSERAFDWYAELLHSPGDEVLVVHCIE--LPPVPLEHQFPFVFAYYEEWSAMVKETREQHEAMLRSYEDICKEKKLHYEIMMVVGKPAGDVICQVARDVSANLIVLGTRGQGMIRRTILGSVSDYVVHHSHLPVAVIP 150          
BLAST of Usp domain-containing protein vs. Planmine SMEST
Match: SMESG000020882.1 (SMESG000020882.1)

HSP 1 Score: 350.517 bits (898), Expect = 3.384e-125
Identity = 171/171 (100.00%), Postives = 171/171 (100.00%), Query Frame = 1
Query:   19 MTDSEQSKISLEPKKESERIIIIPIDKSEVSRRALDWYSNNMMKENDVVHLIHIVEPIYNTIAVGIGMEAAWLPMEELDAKIQKQIDKGKALVREYISNLTDKGGKCKGFIRVDSRVGECIISVCHDHLADVILMANRGEGLLRRTFLGSVSDYVLHHADKPVIIVPPLHR 531
            MTDSEQSKISLEPKKESERIIIIPIDKSEVSRRALDWYSNNMMKENDVVHLIHIVEPIYNTIAVGIGMEAAWLPMEELDAKIQKQIDKGKALVREYISNLTDKGGKCKGFIRVDSRVGECIISVCHDHLADVILMANRGEGLLRRTFLGSVSDYVLHHADKPVIIVPPLHR
Sbjct:    1 MTDSEQSKISLEPKKESERIIIIPIDKSEVSRRALDWYSNNMMKENDVVHLIHIVEPIYNTIAVGIGMEAAWLPMEELDAKIQKQIDKGKALVREYISNLTDKGGKCKGFIRVDSRVGECIISVCHDHLADVILMANRGEGLLRRTFLGSVSDYVLHHADKPVIIVPPLHR 171          
BLAST of Usp domain-containing protein vs. Planmine SMEST
Match: SMESG000020884.1 (SMESG000020884.1)

HSP 1 Score: 266.159 bits (679), Expect = 1.718e-92
Identity = 129/130 (99.23%), Postives = 130/130 (100.00%), Query Frame = 1
Query:  142 MMKENDVVHLIHIVEPIYNTIAVGIGMEAAWLPMEELDAKIQKQIDKGKALVREYISNLTDKGGKCKGFIRVDSRVGECIISVCHDHLADVILMANRGEGLLRRTFLGSVSDYVLHHADKPVIIVPPLHR 531
            MM+ENDVVHLIHIVEPIYNTIAVGIGMEAAWLPMEELDAKIQKQIDKGKALVREYISNLTDKGGKCKGFIRVDSRVGECIISVCHDHLADVILMANRGEGLLRRTFLGSVSDYVLHHADKPVIIVPPLHR
Sbjct:    1 MMRENDVVHLIHIVEPIYNTIAVGIGMEAAWLPMEELDAKIQKQIDKGKALVREYISNLTDKGGKCKGFIRVDSRVGECIISVCHDHLADVILMANRGEGLLRRTFLGSVSDYVLHHADKPVIIVPPLHR 130          
BLAST of Usp domain-containing protein vs. Planmine SMEST
Match: SMESG000020952.1 (SMESG000020952.1)

HSP 1 Score: 224.942 bits (572), Expect = 9.166e-76
Identity = 98/155 (63.23%), Postives = 133/155 (85.81%), Query Frame = 1
Query:   64 ESERIIIIPIDKSEVSRRALDWYSNNMMKENDVVHLIHIVEPIYNTIAVGIGMEAAWLPMEELDAKIQKQIDKGKALVREYISNLTDKGGKCKGFIRVDSRVGECIISVCHDHLADVILMANRGEGLLRRTFLGSVSDYVLHHADKPVIIVPPLH 528
            E ER+I++P+D+SE + RA+DWY  N+MK ND+V +IHIVEP+Y + AVGIGME A+LP+E+L++KI+KQ+DKGK+LV+++   L +KGG+ KG++ VDS+VGE II VCH H  D+I++ANRGEGL+RRTFLGSVSDYVLHHAD+PV+I+PP H
Sbjct:    8 EVERVILMPVDRSEHTERAIDWYVENLMKPNDLVQMIHIVEPMYTSTAVGIGMEVAFLPVEDLESKIKKQLDKGKSLVKKFTHELQEKGGRAKGYVIVDSKVGEAIIKVCHTHKVDLIIVANRGEGLIRRTFLGSVSDYVLHHADRPVVIIPPKH 162          
BLAST of Usp domain-containing protein vs. Planmine SMEST
Match: SMESG000020955.1 (SMESG000020955.1)

HSP 1 Score: 221.476 bits (563), Expect = 2.445e-74
Identity = 101/156 (64.74%), Postives = 130/156 (83.33%), Query Frame = 1
Query:   64 ESERIIIIPIDKSEVSRRALDWYSNNMMKENDVVHLIHIVEPIYNTIAVGIGMEAAWLPM-EELDAKIQKQIDKGKALVREYISNLTDKGGKCKGFIRVDSRVGECIISVCHDHLADVILMANRGEGLLRRTFLGSVSDYVLHHADKPVIIVPPLH 528
            E+ER+I+IPID SE + R +DWY  N+MK +D+VH+++IVEPI+N+ + G+ MEAA L M E+ + KI+KQIDKGK LV+ YI  L DKGGK KG+IRVDS VGE I+ VCH+H AD++L++NRGEG++RRTFLGSVSDYVLHH D+PVIIVPPLH
Sbjct:    9 ETERVIVIPIDNSEYTERTVDWYVENIMKPHDMVHMVNIVEPIFNSFSAGLAMEAAILTMSEDAETKIKKQIDKGKQLVKRYIHELRDKGGKGKGYIRVDSNVGEAIVKVCHEHKADIVLLSNRGEGIIRRTFLGSVSDYVLHHVDRPVIIVPPLH 164          
BLAST of Usp domain-containing protein vs. Planmine SMEST
Match: SMESG000020954.1 (SMESG000020954.1)

HSP 1 Score: 154.451 bits (389), Expect = 6.359e-48
Identity = 69/153 (45.10%), Postives = 105/153 (68.63%), Query Frame = 1
Query:   70 ERIIIIPIDKSEVSRRALDWYSNNMMKENDVVHLIHIVEPIYNTIAVGIGMEAAW-LPMEELDAKIQKQIDKGKALVREYISNLTDKGGKCKGFIRVDSRVGECIISVCHDHLADVILMANRGEGLLRRTFLGSVSDYVLHHADKPVIIVPPL 525
            ERIIIIPID  + S+R+L WY +NMMK ND VH+I++++P YN   VG+  + +   P+   D+K+ K+I+ GK LVR YI+ LT +G K  G+IR+  +VG+ ++ VC++HL D I++  R +   +    GS+S YV  H+++PVI+VPPL
Sbjct:    8 ERIIIIPIDNRDASKRSLAWYLDNMMKPNDTVHIIYVIKPKYNLSTVGLVYKISLATPIGNSDSKLHKRIEDGKELVRSYINELTTRGAKGTGYIRIHPKVGQTVVDVCNEHLGDYIIITKRKKSSFKENLFGSISHYVFSHSNRPVIMVPPL 160          
The following BLAST results are available for this feature:
BLAST of Usp domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Usp domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Usp domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Usp domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Usp domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Usp domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Usp domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|A0QZA1|Y3950_MYCS26.099e-726.80Universal stress protein MSMEG_3950/MSMEI_3859 OS=... [more]
back to top
BLAST of Usp domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A095AGD12.836e-4750.99Universal stress protein OS=Schistosoma haematobiu... [more]
A0A430QIP72.836e-4750.99Usp domain-containing protein OS=Schistosoma bovis... [more]
A0A183JK492.836e-4750.99Usp domain-containing protein OS=Schistosoma curas... [more]
A0A183WUS67.775e-4749.67Usp domain-containing protein OS=Trichobilharzia r... [more]
A0A183QK931.657e-4650.33Usp domain-containing protein OS=Schistosoma rodha... [more]
back to top
BLAST of Usp domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Usp domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Usp domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Usp domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO458004.170e-2739.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447461.472e-2434.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO346583.507e-2433.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO346577.810e-2435.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO331431.557e-2333.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Usp domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Usp domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020882.13.384e-125100.00SMESG000020882.1[more]
SMESG000020884.11.718e-9299.23SMESG000020884.1[more]
SMESG000020952.19.166e-7663.23SMESG000020952.1[more]
SMESG000020955.12.445e-7464.74SMESG000020955.1[more]
SMESG000020954.16.359e-4845.10SMESG000020954.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035955 ID=SMED30035955|Name=Usp domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=592bp
GCCAACGAAATTTAAAAAATGACAGATTCGGAACAATCAAAGATCTCGTT
GGAACCGAAGAAAGAATCAGAAAGGATCATAATCATTCCGATCGACAAAA
GTGAAGTCAGCCGACGAGCATTGGATTGGTATTCAAACAACATGATGAAG
GAAAATGATGTCGTTCATTTGATTCACATAGTTGAGCCCATATACAACAC
GATAGCTGTAGGAATCGGAATGGAGGCGGCCTGGCTGCCGATGGAAGAGC
TGGATGCGAAAATTCAAAAGCAAATTGACAAAGGAAAAGCTTTAGTGAGA
GAATATATAAGTAATTTAACCGACAAAGGTGGAAAATGCAAAGGCTTTAT
TCGAGTGGATTCGAGAGTTGGAGAATGCATAATCTCTGTTTGCCACGATC
ATCTGGCTGATGTCATACTAATGGCGAATCGAGGAGAGGGTTTATTAAGG
CGAACATTTCTGGGAAGTGTAAGTGATTACGTCCTCCATCATGCCGATAA
GCCAGTCATTATTGTGCCACCTTTGCATCGTTAGCAATTTTTCATTTTTT
TGATATTCTGATTATTATTCCAATAAAATTATGAGAAATTAC
back to top

protein sequence of SMED30035955-orf-1

>SMED30035955-orf-1 ID=SMED30035955-orf-1|Name=SMED30035955-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=172bp
MTDSEQSKISLEPKKESERIIIIPIDKSEVSRRALDWYSNNMMKENDVVH
LIHIVEPIYNTIAVGIGMEAAWLPMEELDAKIQKQIDKGKALVREYISNL
TDKGGKCKGFIRVDSRVGECIISVCHDHLADVILMANRGEGLLRRTFLGS
VSDYVLHHADKPVIIVPPLHR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR006015Universal_stress_UspA
IPR014729Rossmann-like_a/b/a_fold
IPR006016UspA
Vocabulary: biological process
TermDefinition
GO:0006950response to stress
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006015Universal stress protein A familyPRINTSPR01438UNVRSLSTRESScoord: 127..139
score: 28.31
coord: 145..167
score: 41.74
coord: 18..36
score: 29.89
IPR006016UspAPFAMPF00582Uspcoord: 19..167
e-value: 1.0E-20
score: 74.7
IPR014729Rossmann-like alpha/beta/alpha sandwich foldGENE3DG3DSA:3.40.50.620coord: 4..171
e-value: 6.3E-30
score: 106.6
NoneNo IPR availablePANTHERPTHR46989FAMILY NOT NAMEDcoord: 21..168
NoneNo IPR availableCDDcd00293USP_Likecoord: 21..166
e-value: 1.74778E-23
score: 87.8106
NoneNo IPR availableSUPERFAMILYSSF52402Adenine nucleotide alpha hydrolases-likecoord: 21..167