UPF0602 protein C4orf47 homolog

Overview
NameUPF0602 protein C4orf47 homolog
Smed IDSMED30035930
Length (bp)1130
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035930

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30035930SMESG000042363.1 Contig47902newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30035930SMESG000042363.1 Contig47902uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Human
Match: C4orf47 (chromosome 4 open reading frame 47 [Source:HGNC Symbol;Acc:HGNC:34346])

HSP 1 Score: 134.035 bits (336), Expect = 9.568e-36
Identity = 104/308 (33.77%), Postives = 148/308 (48.05%), Query Frame = 3
Query:   93 KTDMERVGLFKEMGYHTINDPY-----KPFFYSSRQDIIKGKGFLGDMTRSKAATDDGYFTKPFSRVFEGESETNLMAMRRRWRNQNKEKNVGKTFIMSNPGKKQSGTGSRMGCMDYMIPYFSGITRTVRGKLPNKKNFITNPGKKGSGYGYADVCLNPYPEWKSDVYDGARNMYFRKEMAEHQKRTLNRKEFIPTNAYGSYFYSNPY--EGGMGPYEEKHGKTVNYLQKRPFIPGSYPKILGGNKDGCLTPYPPAFPAEYKDKFTRNLVHDVRNNTNKLYNHTPGSKSCIFQSVLQKNVNFRVNNLN 995
            KTDMER+GLF EM Y T+ D Y     +PF     +   K K  L   ++  +    GYF   F R+FEGE   NL  +RRR   +  +KN+GK F+ SN  KK  G GS  G +   +P+FS  ++         KN  TNPGKKG+GYGYA++ +       +D YD A+  Y  K+  E   R L    F        YF +NPY  E  + P +++  K       +P  PG  P   GG K G   PY    P+   D +   L  ++    +K+++   G KS   +S++  NV   +N+ N
Sbjct:    7 KTDMERIGLFSEMEYITVGDKYVSQFNRPF----NEAASKNKQMLPGGSKEMSDLQAGYFDPHFVRIFEGEGYINLNQVRRRDMVEAAKKNLGKAFLPSNGEKKPCGLGSYYGTIGGPVPFFSAQSKPREKYKAPGKNLYTNPGKKGTGYGYANITIGKQFSHSADFYDAAKLKY--KKANEEHHRLLKGAPFKLNLHPRDYFDANPYFSEESLPPIKKEEKKKTISNTFKPSSPGKKP---GGMKAGTFDPY----PSHSADPYVAKLA-NISGKDDKIFHPPSGPKSRPVESIMTLNVRRALNSKN 300          
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Human
Match: C4orf47 (chromosome 4 open reading frame 47 [Source:HGNC Symbol;Acc:HGNC:34346])

HSP 1 Score: 111.694 bits (278), Expect = 9.898e-29
Identity = 69/175 (39.43%), Postives = 93/175 (53.14%), Query Frame = 3
Query:   93 KTDMERVGLFKEMGYHTINDPY-----KPFFYSSRQDIIKGKGFLGDMTRSKAATDDGYFTKPFSRVFEGESETNLMAMRRRWRNQNKEKNVGKTFIMSNPGKKQSGTGSRMGCMDYMIPYFSGITRTVRGKLPNKKNFITNPGKKGSGYGYADVCLNPYPEWKSDVYDGARNMY 602
            KTDMER+GLF EM Y T+ D Y     +PF     +   K K  L   ++  +    GYF   F R+FEGE   NL  +RRR   +  +KN+GK F+ SN  KK  G GS  G +   +P+FS  ++         KN  TNPGKKG+GYGYA++ +       +D YD A+  Y
Sbjct:    7 KTDMERIGLFSEMEYITVGDKYVSQFNRPF----NEAASKNKQMLPGGSKEMSDLQAGYFDPHFVRIFEGEGYINLNQVRRRDMVEAAKKNLGKAFLPSNGEKKPCGLGSYYGTIGGPVPFFSAQSKPREKYKAPGKNLYTNPGKKGTGYGYANITIGKQFSHSADFYDAAKLKY 177          
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Human
Match: C4orf47 (chromosome 4 open reading frame 47 [Source:HGNC Symbol;Acc:HGNC:34346])

HSP 1 Score: 104.375 bits (259), Expect = 3.033e-26
Identity = 64/157 (40.76%), Postives = 86/157 (54.78%), Query Frame = 3
Query:   93 KTDMERVGLFKEMGYHTINDPY-----KPFFYSSRQDIIKGKGFLGDMTRSKAATDDGYFTKPFSRVFEGESETNLMAMRRRWRNQNKEKNVGKTFIMSNPGKKQSGTGSRMGCMDYMIPYFSGITRTVRGKLPNKKNFITNPGKKGSGYGYADVCL 548
            KTDMER+GLF EM Y T+ D Y     +PF     +   K K  L   ++  +    GYF   F R+FEGE   NL  +RRR   +  +KN+GK F+ SN  KK  G GS  G +   +P+FS  ++         KN  TNPGKKG+GYGYA++ +
Sbjct:    7 KTDMERIGLFSEMEYITVGDKYVSQFNRPF----NEAASKNKQMLPGGSKEMSDLQAGYFDPHFVRIFEGEGYINLNQVRRRDMVEAAKKNLGKAFLPSNGEKKPCGLGSYYGTIGGPVPFFSAQSKPREKYKAPGKNLYTNPGKKGTGYGYANITI 159          
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Zebrafish
Match: zgc:153146 (zgc:153146 [Source:NCBI gene;Acc:751702])

HSP 1 Score: 156.762 bits (395), Expect = 1.557e-44
Identity = 117/317 (36.91%), Postives = 159/317 (50.16%), Query Frame = 3
Query:   93 KTDMERVGLFKEMGYHTINDPYKPFFYSSRQD-IIKGKGFLGDMTRSKAATDDGYFTKPFSRVFEGESETNLMAMRRRWRNQNKEKNVGKTFIMSNPGKKQSGTGSRMGCMDYMIPYFSGITRTVRGKLPNKKNFITNPGKKGSGYGYADVCLNPYPEWKSDVYDGARNMYFRKEMAEHQKRTLNRKEFIPTNAYGSYFYSNPY--EGGMGP---YEEKHGKTVNYLQKRPFIPGSYPKILGGNKDGCLTPYPPAFPAEYKDKFTRNLVHDVRNNTNKLYNHTPGSKSCIFQSVLQKNVNFRVNNLNSHSIRNVMNY 1025
            K+DMER+G+FKEMGY +I D Y  F Y    D   K K  L   T+SK     GYF   F R+FE E+ T+ + + R++R    +KN+GK F+ SN  K   G G+  G     I   S +    +      KNF TNP KKGSGYGY D+ L+    + SD YD A+ M  ++E+  H K  L    F        YF  NPY  +  + P    EEK    V      PF P S  K  GG K G    YP      Y  K T+++V    NN  K+++ +PG KS   +S++  NVN  VN+ N + I +VM++
Sbjct:    6 KSDMERIGVFKEMGYISIGDKYTSFIYRPFNDSAYKNKQMLLGGTKSKCGLQTGYFDTQFKRIFEREAFTDPVRIDRQYRILQAKKNIGKAFLPSNGEKTTCGMGTYYGTFGGPIQAMSALQIPRKQNKSAGKNFYTNPPKKGSGYGYPDITLSKMVSYSSDPYDRAKEM-LKREITAH-KSMLKGGAFRLNLHPNEYFDGNPYKFDKPLPPPKKIEEKKHFAV------PFKPSSPSKKAGGMKAGAFDSYPTYSAEPYGTKKTKSVVA---NNEVKIFHPSPGPKSTPIKSIISLNVNKAVNSTNYNRIPSVMSF 311          
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Zebrafish
Match: C14H4orf47 (zgc:153146 [Source:NCBI gene;Acc:751702])

HSP 1 Score: 154.836 bits (390), Expect = 8.577e-44
Identity = 116/317 (36.59%), Postives = 158/317 (49.84%), Query Frame = 3
Query:   93 KTDMERVGLFKEMGYHTINDPYKPFFYSSRQD-IIKGKGFLGDMTRSKAATDDGYFTKPFSRVFEGESETNLMAMRRRWRNQNKEKNVGKTFIMSNPGKKQSGTGSRMGCMDYMIPYFSGITRTVRGKLPNKKNFITNPGKKGSGYGYADVCLNPYPEWKSDVYDGARNMYFRKEMAEHQKRTLNRKEFIPTNAYGSYFYSNPY--EGGMGP---YEEKHGKTVNYLQKRPFIPGSYPKILGGNKDGCLTPYPPAFPAEYKDKFTRNLVHDVRNNTNKLYNHTPGSKSCIFQSVLQKNVNFRVNNLNSHSIRNVMNY 1025
            K+DMER+G+FKEMGY +I D Y  F Y    D   K K  L   T+SK     GYF   F R+FE E+ T+ + + R++R    +KN+GK F+ SN  K   G G+  G     I   S +    +      KNF TNP KKGSGYGY D+ L+    + SD YD A+ M  ++E+  H K  L    F        YF  NPY  +  + P    EEK    V      PF P S  K  GG K G    YP      Y  K  +++V    NN  K+++ +PG KS   +S++  NVN  VN+ N + I +VM++
Sbjct:    6 KSDMERIGVFKEMGYTSIGDKYTSFIYRPFNDSAYKNKQMLLGGTKSKCGLQTGYFDTQFKRIFEREAFTDPVRIDRQYRILQAKKNIGKAFLPSNGEKTTCGMGTYYGTFGGPIQAMSALQIPRKQNKSAGKNFYTNPPKKGSGYGYPDITLSKMVSYSSDPYDRAKEM-LKREITAH-KSMLKGGAFRLNLHPNEYFDGNPYKFDKPLPPPKKIEEKKHFAV------PFKPSSPSKKAGGMKAGAFDSYPTYSAEPYGTKKNKSVVA---NNEVKIFHPSPGPKSTPIKSIISLNVNKAVNSTNYNRIPSVMSF 311          
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Zebrafish
Match: C14H4orf47 (zgc:153146 [Source:NCBI gene;Acc:751702])

HSP 1 Score: 154.836 bits (390), Expect = 8.577e-44
Identity = 116/317 (36.59%), Postives = 158/317 (49.84%), Query Frame = 3
Query:   93 KTDMERVGLFKEMGYHTINDPYKPFFYSSRQD-IIKGKGFLGDMTRSKAATDDGYFTKPFSRVFEGESETNLMAMRRRWRNQNKEKNVGKTFIMSNPGKKQSGTGSRMGCMDYMIPYFSGITRTVRGKLPNKKNFITNPGKKGSGYGYADVCLNPYPEWKSDVYDGARNMYFRKEMAEHQKRTLNRKEFIPTNAYGSYFYSNPY--EGGMGP---YEEKHGKTVNYLQKRPFIPGSYPKILGGNKDGCLTPYPPAFPAEYKDKFTRNLVHDVRNNTNKLYNHTPGSKSCIFQSVLQKNVNFRVNNLNSHSIRNVMNY 1025
            K+DMER+G+FKEMGY +I D Y  F Y    D   K K  L   T+SK     GYF   F R+FE E+ T+ + + R++R    +KN+GK F+ SN  K   G G+  G     I   S +    +      KNF TNP KKGSGYGY D+ L+    + SD YD A+ M  ++E+  H K  L    F        YF  NPY  +  + P    EEK    V      PF P S  K  GG K G    YP      Y  K  +++V    NN  K+++ +PG KS   +S++  NVN  VN+ N + I +VM++
Sbjct:    6 KSDMERIGVFKEMGYTSIGDKYTSFIYRPFNDSAYKNKQMLLGGTKSKCGLQTGYFDTQFKRIFEREAFTDPVRIDRQYRILQAKKNIGKAFLPSNGEKTTCGMGTYYGTFGGPIQAMSALQIPRKQNKSAGKNFYTNPPKKGSGYGYPDITLSKMVSYSSDPYDRAKEM-LKREITAH-KSMLKGGAFRLNLHPNEYFDGNPYKFDKPLPPPKKIEEKKHFAV------PFKPSSPSKKAGGMKAGAFDSYPTYSAEPYGTKKNKSVVA---NNEVKIFHPSPGPKSTPIKSIISLNVNKAVNSTNYNRIPSVMSF 311          
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Xenopus
Match: C4orf47 (chromosome 4 open reading frame 47 [Source:NCBI gene;Acc:100379819])

HSP 1 Score: 126.716 bits (317), Expect = 3.958e-33
Identity = 105/318 (33.02%), Postives = 154/318 (48.43%), Query Frame = 3
Query:   93 KTDMERVGLFKEMGYHTINDPY-----KPFFYSSRQDIIKGKGFLGDMTRSKAATDDGYFTKPFSRVFEGESETNLMAMRRRWRNQNKEKNVGKTFIMSNPGKKQSGTGSRMGCMDYMIPYFSGITRTVRGKLPNKKNFITNPGKKGSGYGYADVCLNPYPEWKSDVYDGARNMYFRKEMAEHQKRTLNRKEFIPTNAYGSYFYSNPY--EGGMGPYEEKHGKTVNYLQKRPFIPGSYPKILGGNKDGCLTPYPPAFPAEYKDKFTRNLVHDVRNNTNKLYNHTPGSKSCIFQSVLQKNVNFRVNNLNSHSIRNVMNY 1025
            +TDMER+GLF EMGY +I D Y     KPF     +   K +  L   ++S A    GYF   F RVFEGES ++++  RR++R Q  +KN+GK F+ S+  KK SG GS  G +   +  FS   +  +      KNF TNP K+GSGYGY  V +     + S+ YD A  +  +KE+  H+ + L    F        +F  NPY  +  + P +    K      ++PF P S  K  GG K G    YP      Y  K  +  + +      K+++   G K+    S+L  NV   V  +N  ++ N+ +Y
Sbjct:    5 RTDMERIGLFSEMGYTSIGDKYAPPGSKPF----NESASKNRQILPGGSKSMANILGGYFDAQFKRVFEGESYSDVLKQRRQYRMQQSKKNLGKPFLPSSGEKKPSGLGSFYGTVGGPVVAFSAELKPRKAYTAPGKNFYTNPPKQGSGYGYTSVTIGKPYLYSSENYDIATEL-IKKEIENHKSK-LKGGPFKLNLHPKDHFNPNPYYTDKPLPPLKVHSQKKET---EKPFKPSSPGKQAGGMKAGTFDTYPTHSNDPYTIKSAKTPIKE-----RKIFHPPGGPKTYPVHSILTSNVIKSVTAVNYKTV-NLTSY 307          
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Mouse
Match: 1700029J07Rik (RIKEN cDNA 1700029J07 gene [Source:MGI Symbol;Acc:MGI:1916729])

HSP 1 Score: 159.844 bits (403), Expect = 1.564e-45
Identity = 111/304 (36.51%), Postives = 153/304 (50.33%), Query Frame = 3
Query:   93 KTDMERVGLFKEMGYHTINDPY-KPFFYSSRQDIIKGKGFLGDMTRSKAATDDGYFTKPFSRVFEGESETNLMAMRRRWRNQNKEKNVGKTFIMSNPGKKQSGTGSRMGCMDYMIPYFSGITRTVRGKLPNKKNFITNPGKKGSGYGYADVCLNPYPEWKSDVYDGARNMYFRKEMAEHQKRTLNRKEFIPTNAYGSYFYSNPY--EGGMGPYEEKHGKTVNYLQKRPFIPGSYPKILGGNKDGCLTPYPPAFPAEYKDKFTRNLVHDVRNNTNKLYNHTPGSKSCIFQSVLQKNVNFRVNNLN 995
            KTDMER+GLF EM Y T+ D Y  PF     +   K +  L   T+  ++   GYF   F+R+FEGE   NL  +RRR+     +KN+GK FI S+  KK SG GS  G +   +P+FS   +      P  KN  TNPGKKG+GYGYA+V +       SD+YD AR  Y +KE  EH  R +    F        YF +NPY  E  + P   +  K V++   +PF P S  K  GG K G   PY    PA   D +   +   + +   ++++   G KS   +S++  NV   +N  N
Sbjct:    7 KTDMERIGLFSEMEYITVGDKYVSPFNRPFNEAASKNRQILPGGTKEMSSLQAGYFDSQFARIFEGEGYVNLNQVRRRYMLAESKKNLGKAFIPSSGEKKPSGLGSYYGTIGGPVPFFSAQIKPKDKYQPPGKNLYTNPGKKGTGYGYANVTIGKQLSHSSDLYDAARQSY-KKESEEHH-RLIKGSPFKLHLHPKDYFDTNPYFLEHHLPPLRREEKKEVSF---KPFKPSSPGKKAGGMKAGAFDPY----PAHSADPYVVKVEKAIPSKGERVFHPPNGPKSRPVESIMALNVKRALNVKN 301          
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Mouse
Match: 1700029J07Rik (RIKEN cDNA 1700029J07 gene [Source:MGI Symbol;Acc:MGI:1916729])

HSP 1 Score: 159.844 bits (403), Expect = 1.564e-45
Identity = 111/304 (36.51%), Postives = 153/304 (50.33%), Query Frame = 3
Query:   93 KTDMERVGLFKEMGYHTINDPY-KPFFYSSRQDIIKGKGFLGDMTRSKAATDDGYFTKPFSRVFEGESETNLMAMRRRWRNQNKEKNVGKTFIMSNPGKKQSGTGSRMGCMDYMIPYFSGITRTVRGKLPNKKNFITNPGKKGSGYGYADVCLNPYPEWKSDVYDGARNMYFRKEMAEHQKRTLNRKEFIPTNAYGSYFYSNPY--EGGMGPYEEKHGKTVNYLQKRPFIPGSYPKILGGNKDGCLTPYPPAFPAEYKDKFTRNLVHDVRNNTNKLYNHTPGSKSCIFQSVLQKNVNFRVNNLN 995
            KTDMER+GLF EM Y T+ D Y  PF     +   K +  L   T+  ++   GYF   F+R+FEGE   NL  +RRR+     +KN+GK FI S+  KK SG GS  G +   +P+FS   +      P  KN  TNPGKKG+GYGYA+V +       SD+YD AR  Y +KE  EH  R +    F        YF +NPY  E  + P   +  K V++   +PF P S  K  GG K G   PY    PA   D +   +   + +   ++++   G KS   +S++  NV   +N  N
Sbjct:    7 KTDMERIGLFSEMEYITVGDKYVSPFNRPFNEAASKNRQILPGGTKEMSSLQAGYFDSQFARIFEGEGYVNLNQVRRRYMLAESKKNLGKAFIPSSGEKKPSGLGSYYGTIGGPVPFFSAQIKPKDKYQPPGKNLYTNPGKKGTGYGYANVTIGKQLSHSSDLYDAARQSY-KKESEEHH-RLIKGSPFKLHLHPKDYFDTNPYFLEHHLPPLRREEKKEVSF---KPFKPSSPGKKAGGMKAGAFDPY----PAHSADPYVVKVEKAIPSKGERVFHPPNGPKSRPVESIMALNVKRALNVKN 301          
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Mouse
Match: 1700029J07Rik (RIKEN cDNA 1700029J07 gene [Source:MGI Symbol;Acc:MGI:1916729])

HSP 1 Score: 75.0998 bits (183), Expect = 3.333e-16
Identity = 43/100 (43.00%), Postives = 57/100 (57.00%), Query Frame = 3
Query:   93 KTDMERVGLFKEMGYHTINDPY-KPFFYSSRQDIIKGKGFLGDMTRSKAATDDGYFTKPFSRVFEGESETNLMAMRRRWRNQNKEKNVGKTFIMSNPGKK 389
            KTDMER+GLF EM Y T+ D Y  PF     +   K +  L   T+  ++   GYF   F+R+FEGE   NL  +RRR+     +KN+GK FI S+  KK
Sbjct:    7 KTDMERIGLFSEMEYITVGDKYVSPFNRPFNEAASKNRQILPGGTKEMSSLQAGYFDSQFARIFEGEGYVNLNQVRRRYMLAESKKNLGKAFIPSSGEKK 106          
BLAST of UPF0602 protein C4orf47 homolog vs. UniProt/SwissProt
Match: sp|Q3U1D9|CD047_MOUSE (UPF0602 protein C4orf47 homolog OS=Mus musculus OX=10090 PE=2 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 1.094e-44
Identity = 111/304 (36.51%), Postives = 153/304 (50.33%), Query Frame = 3
Query:   93 KTDMERVGLFKEMGYHTINDPY-KPFFYSSRQDIIKGKGFLGDMTRSKAATDDGYFTKPFSRVFEGESETNLMAMRRRWRNQNKEKNVGKTFIMSNPGKKQSGTGSRMGCMDYMIPYFSGITRTVRGKLPNKKNFITNPGKKGSGYGYADVCLNPYPEWKSDVYDGARNMYFRKEMAEHQKRTLNRKEFIPTNAYGSYFYSNPY--EGGMGPYEEKHGKTVNYLQKRPFIPGSYPKILGGNKDGCLTPYPPAFPAEYKDKFTRNLVHDVRNNTNKLYNHTPGSKSCIFQSVLQKNVNFRVNNLN 995
            KTDMER+GLF EM Y T+ D Y  PF     +   K +  L   T+  ++   GYF   F+R+FEGE   NL  +RRR+     +KN+GK FI S+  KK SG GS  G +   +P+FS   +      P  KN  TNPGKKG+GYGYA+V +       SD+YD AR  Y +KE  EH  R +    F        YF +NPY  E  + P   +  K V++   +PF P S  K  GG K G   PY    PA   D +   +   + +   ++++   G KS   +S++  NV   +N  N
Sbjct:    7 KTDMERIGLFSEMEYITVGDKYVSPFNRPFNEAASKNRQILPGGTKEMSSLQAGYFDSQFARIFEGEGYVNLNQVRRRYMLAESKKNLGKAFIPSSGEKKPSGLGSYYGTIGGPVPFFSAQIKPKDKYQPPGKNLYTNPGKKGTGYGYANVTIGKQLSHSSDLYDAARQSY-KKESEEHH-RLIKGSPFKLHLHPKDYFDTNPYFLEHHLPPLRREEKKEVSF---KPFKPSSPGKKAGGMKAGAFDPY----PAHSADPYVVKVEKAIPSKGERVFHPPNGPKSRPVESIMALNVKRALNVKN 301          
BLAST of UPF0602 protein C4orf47 homolog vs. UniProt/SwissProt
Match: sp|Q0P4C5|CD047_DANRE (UPF0602 protein C4orf47 homolog OS=Danio rerio OX=7955 GN=zgc:153146 PE=2 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 6.979e-42
Identity = 115/317 (36.28%), Postives = 158/317 (49.84%), Query Frame = 3
Query:   93 KTDMERVGLFKEMGYHTINDPYKPFFYSSRQD-IIKGKGFLGDMTRSKAATDDGYFTKPFSRVFEGESETNLMAMRRRWRNQNKEKNVGKTFIMSNPGKKQSGTGSRMGCMDYMIPYFSGITRTVRGKLPNKKNFITNPGKKGSGYGYADVCLNPYPEWKSDVYDGARNMYFRKEMAEHQKRTLNRKEFIPTNAYGSYFYSNPY--EGGMGP---YEEKHGKTVNYLQKRPFIPGSYPKILGGNKDGCLTPYPPAFPAEYKDKFTRNLVHDVRNNTNKLYNHTPGSKSCIFQSVLQKNVNFRVNNLNSHSIRNVMNY 1025
            K+DMER+G+FKEMGY +I D Y  F Y    D   K K  L   T+SK     GYF   F R+FE E+ T+ + + R++R    +KN+GK F+ SN  K   G G+  G     I   S +    +      KNF TNP K+GSGYG  D+ L+    + SD YD A+ M  ++E+  H K  L    F        YF  NPY  +  + P    EEK    V      PF P S  K  GG K G    YP      Y  K T+++V    NN  K+++ +PG KS   +S++  NVN  VN+ N + I +VM++
Sbjct:    6 KSDMERIGVFKEMGYISIGDKYTSFIYRPFNDSAYKNKQMLLGGTKSKCGLQTGYFDTQFKRIFEREAFTDPVRIDRQYRILQAKKNIGKAFLPSNGEKTTCGMGTYYGTFGGPIQAMSALQIPRKQNKSAGKNFYTNPPKEGSGYGCPDITLSKMVSYSSDPYDRAKEM-LKREITAH-KSMLKGGAFRLNLHPNEYFDGNPYKFDKPLPPPKKIEEKKHFAV------PFKPSSPSKKAGGMKAGAFDSYPTYSAEPYGTKKTKSVVA---NNEVKIFHPSPGPKSTPIKSIISLNVNKAVNSTNYNRIPSVMSF 311          
BLAST of UPF0602 protein C4orf47 homolog vs. UniProt/SwissProt
Match: sp|Q5XHC1|CD047_XENLA (UPF0602 protein C4orf47 homolog OS=Xenopus laevis OX=8355 PE=2 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 2.737e-37
Identity = 115/319 (36.05%), Postives = 158/319 (49.53%), Query Frame = 3
Query:   93 KTDMERVGLFKEMGYHTINDPY-----KPFFYSSRQDIIKGKGFLGDMTRSKAATDDGYFTKPFSRVFEGESETNLMAMRRRWRNQNKEKNVGKTFIMSNPGKKQSGTGSRMGCMDYMIPYFSGITRTVRGKLPNKKNFITNPGKKGSGYGYADVCL-NPYPEWKSDVYDGARNMYFRKEMAEHQKRTLNRKEFIPTNAYGSYFYSNPY--EGGMGPYEEKHGKTVNYLQKRPFIPGSYPKILGGNKDGCLTPYPPAFPAEYKDKFTRNLVHDVRNNTNKLYNHTPGSKSCIFQSVLQKNVNFRVNNLNSHSIRNVMNY 1025
            KTDMER+GLF EMGY +I D Y     KPF     +   K +  L   ++S A    GYF   F RVFEGES ++    RR+ R Q  +KN+GK F+ S+  KK+SG GS  G +   +  FS   ++ +      KNF TNP K GSGYGY  V +  PYP + S+ YD +R +  +KE+ EH K  L    F        YF  NPY  +  + P +    K      ++PF P S  K  GG K G   PYP      Y  K ++  V +      K+++   G K+    S+L  NV   V  LN  ++ N+ +Y
Sbjct:    5 KTDMERIGLFSEMGYTSIGDKYAAPGSKPF----NESASKNRQMLPGGSKSMANMLGGYFDGQFKRVFEGESYSDPFKQRRQHRMQQSKKNLGKPFLPSSGEKKRSGLGSFYGTLGGPVVAFSAELKSRKAYTAPGKNFYTNPPKDGSGYGYPSVTIGKPYP-YSSENYDISREL-IKKEI-EHHKSKLKGGAFKLNLHPKDYFEPNPYYTDKTLPPLKVHSQKKET---EKPFKPSSPAKEAGGMKAGTFDPYPTHSNDPYTAKPSKTPVKE-----RKVFHPPGGPKTYPVHSILTSNVIKSVTALNYKTV-NLASY 307          
BLAST of UPF0602 protein C4orf47 homolog vs. UniProt/SwissProt
Match: sp|Q2T9M0|CD047_BOVIN (UPF0602 protein C4orf47 homolog OS=Bos taurus OX=9913 PE=2 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 3.681e-37
Identity = 108/321 (33.64%), Postives = 157/321 (48.91%), Query Frame = 3
Query:   93 KTDMERVGLFKEMGYHTINDPY-----KPFFYSSRQDIIKGKGFLGDMTRSKAATDDGYFTKPFSRVFEGESETNLMAMRRRWRNQNKEKNVGKTFIMSNPGKKQSGTGSRMGCMDYMIPYFSGITRTVRGKLPNKKNFITNPGKKGSGYGYADVCLNPYPEWKSDVYDGARNMYFRKEMAEHQKRTLNRKEFIPTNAYGSYFYSNPYEGGMGPYEEKHGKTVNYLQKR-----PFIPGSYPKILGGNKDGCLTPYPPAFPAEYKDKFTRNLVHDVRNNTNKLYNHTPGSKSCIFQSVLQKNVNFRVNNLNSHSIRNVMNY 1025
            KTDMER+GLF EM Y T+ D Y     +PF     +   K +  L   ++  +    GYF   F R+FEGES  N   +RRR+  +  +KN+ K F+ SN  KK  G GS  G +   +P+FS  ++      P  KN  TNPGKKG+GYGYA++ +       SD+YD A+ +  +KE  EH +R L    F        YF +NPY        EK    +  ++K+     PF P S  K  GG K G   PY    P+   D +   L     + + K+++   G KS   +S++  NV  R  N+ ++   +V +Y
Sbjct:    7 KTDMERIGLFSEMEYITVGDKYVSQFNRPF----NESASKNRQILPGGSKEMSNLQAGYFDPHFVRIFEGESYVNPNQVRRRYMMEEAKKNLSKAFLPSNGEKKPCGLGSYYGTIGGPVPFFSAQSKPKEKYEPPGKNLYTNPGKKGTGYGYANITIGKQFSHSSDLYDAAK-LNNKKENEEH-RRLLKGTAFKLNLYTREYFDTNPY------MSEKPLPPIKKVEKKETVGNPFKPSSPGKKAGGMKAGTFDPY----PSHSADPYVVKL-KSPSSKSAKVFHPPGGPKSRPIESIMALNVK-RALNMKNYKTASVQSY 309          
BLAST of UPF0602 protein C4orf47 homolog vs. UniProt/SwissProt
Match: sp|A7E2U8|CD047_HUMAN (UPF0602 protein C4orf47 OS=Homo sapiens OX=9606 GN=C4orf47 PE=2 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 4.595e-35
Identity = 104/308 (33.77%), Postives = 148/308 (48.05%), Query Frame = 3
Query:   93 KTDMERVGLFKEMGYHTINDPY-----KPFFYSSRQDIIKGKGFLGDMTRSKAATDDGYFTKPFSRVFEGESETNLMAMRRRWRNQNKEKNVGKTFIMSNPGKKQSGTGSRMGCMDYMIPYFSGITRTVRGKLPNKKNFITNPGKKGSGYGYADVCLNPYPEWKSDVYDGARNMYFRKEMAEHQKRTLNRKEFIPTNAYGSYFYSNPY--EGGMGPYEEKHGKTVNYLQKRPFIPGSYPKILGGNKDGCLTPYPPAFPAEYKDKFTRNLVHDVRNNTNKLYNHTPGSKSCIFQSVLQKNVNFRVNNLN 995
            KTDMER+GLF EM Y T+ D Y     +PF     +   K K  L   ++  +    GYF   F R+FEGE   NL  +RRR   +  +KN+GK F+ SN  KK  G GS  G +   +P+FS  ++         KN  TNPGKKG+GYGYA++ +       +D YD A+  Y  K+  E   R L    F        YF +NPY  E  + P +++  K       +P  PG  P   GG K G   PY    P+   D +   L  ++    +K+++   G KS   +S++  NV   +N+ N
Sbjct:    7 KTDMERIGLFSEMEYITVGDKYVSQFNRPF----NEAASKNKQMLPGGSKEMSDLQAGYFDPHFVRIFEGEGYINLNQVRRRDMVEAAKKNLGKAFLPSNGEKKPCGLGSYYGTIGGPVPFFSAQSKPREKYKAPGKNLYTNPGKKGTGYGYANITIGKQFSHSADFYDAAKLKY--KKANEEHHRLLKGAPFKLNLHPRDYFDANPYFSEESLPPIKKEEKKKTISNTFKPSSPGKKP---GGMKAGTFDPY----PSHSADPYVAKLA-NISGKDDKIFHPPSGPKSRPVESIMTLNVRRALNSKN 300          
BLAST of UPF0602 protein C4orf47 homolog vs. TrEMBL
Match: A0A183TR35 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS18933 PE=4 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 5.211e-47
Identity = 115/330 (34.85%), Postives = 168/330 (50.91%), Query Frame = 3
Query:   99 DMERVGLFKEMGYHTINDPY------KPFFYSSRQDIIKGKGFLGDMTRSKAATDDGYFTKPFSRVFEGESETNLMAMRRRWRNQNKEKNVGKTFIMSNPGKKQSGTGSRMGCMDYMIPYFSGITRTVRGKLPNKKNFITNPGKKGSGYGYADVCLNPYPEWKSDVYD-GARNMYFRKEMAEHQKRTLNRKEFIPTNAYGSYFYS------NPYEGGMGPYEEKHGKTV--NYLQKRP-FIPGSYPKILGGNKDGCLTPYPPAFPAEYKDKFTRNLVHDVRNNTN--KLYNHTPGSKSCI---FQSVLQKNVNFRVNNLNSHSIRNVMNY 1025
            D +R+G+FKE+GY TINDPY      K F     +  ++     G  +++KA T DGYF  PF+RVFEGE+ +N++ +RR WR +N  K +   ++ S+P KK+ G GS  GC     P  S   + V  K P   NF TNPGKKG+GYGY DV +NPYPEW +     G+++    K   EH++  L R  F+     G  F        NP   G GP   K G +     L   P F+P S  K  GG KDGCL+ +P      Y D++ R ++  ++ +    +L    P   + +     SV+ +N++  +N        +VM +
Sbjct:   10 DFKRMGIFKELGYTTINDPYTVVRPDKLFRNLQNEPGMRPMILAGGFSKTKADTVDGYFA-PFARVFEGEASSNIIQLRRAWRKENNAKKLAGDWVYSSPAKKRQGVGSPFGCFQEQYPAMSREAKRVE-KEPELHNFYTNPGKKGTGYGYLDVTINPYPEWMAGATTLGSQHEVIMKANEEHKQLCLGRPVFVSQQHSGEAFDPEIINGVNPLAPG-GPVTHKFGNSAADKSLNIGPTFLPSSPAKWDGGCKDGCLSKFPTYIGDPYIDQY-RLMIQKIKKSPEDAQLRPWVPQPPTAVEIPTPSVVNRNIDLAINAKTRKKRLHVMPF 335          
BLAST of UPF0602 protein C4orf47 homolog vs. TrEMBL
Match: A0A267FK75 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016035g1 PE=4 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 9.926e-46
Identity = 108/316 (34.18%), Postives = 171/316 (54.11%), Query Frame = 3
Query:   84 MTEKTDMERVGLFKEMGYHTINDPYK-PFFYSSRQDIIKGKGFLGDMTRSKAATDDGYFTKPFSRVFEGESETNLMAMRRRWRNQNKEKNVGKTFIMSNPGKKQSGTGSRMGCMDYMIPYFSGITRTVRGKLPNKKNFITNPGKKGSGYGYADVCLNPYPEWKSDVYDGARNMYFRKEMAEHQKRTLNRKEFIPTNAYGSYFYSNPYEGGMG-PYEEKHGKTVNYLQKRPFIPGSYPKILGGNKDGCLTPYPPAFPAEYKDKFTRNLVHDVRNNTNKLYNHTPGSKSCIFQSVLQKNVNFRVNNLNSHSIRNVMNY 1025
            M  K+DM+R+G+FKEM YHT+ DPYK P  +       KG+  L   T+ K+    GY ++ F RVFEGE  ++ +  RR+ R +   +N+ +++  ++  K  SGTGS  G     + YF+  + +     P  KN +TNP KKG+GYGYA V LN YP++KSD Y+  +++  ++E  +H+++   +  F  +     +F +NPY+GG      E   + +     RPF P +  K  GG K G    +P     +Y+ K     V  V N++ K +    G K+ +  SVL +NV   VN+ N  S+++VM+Y
Sbjct:    1 MGTKSDMDRIGIFKEMSYHTVGDPYKNPGNFQFNTSAYKGRQMLPGGTKKKSGLSQGYMSE-FGRVFEGEGYSDPIKTRRQERQKASSRNLSRSWNPTSFPKVGSGTGSHYGTFSGPVQYFNAFSSSKGKAAPEGKNILTNPPKKGTGYGYAFVTLNKYPDYKSDTYEKYKDIQ-KRENEQHKQKVAGKGAFKLSTHPADFFDANPYKGGSALTKSEAKAEPI----ARPFKPSNPGKKDGGMKAGTFDSFPTYSSEKYQKKSLTRPVQ-VVNSSGKTFVPNSGPKTTLQTSVLHQNVTRSVNSSNYKSVQSVMSY 309          
BLAST of UPF0602 protein C4orf47 homolog vs. TrEMBL
Match: A0A2C9K232 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106078477 PE=4 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 1.998e-44
Identity = 117/308 (37.99%), Postives = 159/308 (51.62%), Query Frame = 3
Query:   93 KTDMERVGLFKEMGYHTINDPYK-PFFYSSRQDIIKGKGFLGDMTRSKAATDDGYFTKPFSRVFEGESETNLMAMRRRWRNQNKEKNVGKTFIMSNPGKKQSGTGSRMGCMDYMIPYFSGITRTVRGKLPNKKNFITNPGKKGSGYGYADVCLNPYPEWKSDVYDGARNMYFRKEMAEHQKRTLNRKEFIPTNAYGSYFYSNPYEGGM-GPYEEK-HGKTVNYLQKRPFIPGSYPKILGGNKDGCLTPYPPAFPAEYKDKFTRNLVHDVRNNTNKLYNHTPGSKSCIFQSVLQKNVNFRVNNLNSHSI 1007
            K+DMERVGLFKEM Y T+ DPYK P      +   KGK  +   T+ K+A  DGYF   F RVFEGES ++ + +RR+ R    +KN+ K F+ +N  +  +G G+  G +  ++P  S  T     K    KN +TNPGKKG+GYGYA++CLNPYP    D Y+   +MY ++E+ +H K  L    F        YF  NPY   +  P   K  G         PF P +  K L G K G   PYP      Y  K+ R +  +V N   K +   PG KS    S++ +N+   VN+ N  SI
Sbjct:    7 KSDMERVGLFKEMDYVTVGDPYKTPGQGVFNEPAGKGKQMIPGGTKEKSAKSDGYFAD-FGRVFEGESYSDPVKLRRQHRMSESKKNLSKAFVPTNGYRTMNGLGTFYGTLGGVVPALSPATSGGGSKREPLKNILTNPGKKGTGYGYANICLNPYPPHSEDDYNKGISMY-KQELQKH-KAALKAGAFRLNMHPSDYFNGNPYRSDVAAPAARKWAGDLPAKPITTPFRPSNPGKHLAGMKAGTFDPYPSHSADPYGIKYKRPV--NVVNKFGKTFVPPPGPKSTPCNSIINQNIMRSVNSTNYRSI 309          
BLAST of UPF0602 protein C4orf47 homolog vs. TrEMBL
Match: A0A4W4FDP5 (Zgc:153146 OS=Electrophorus electricus OX=8005 PE=4 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 1.783e-43
Identity = 112/320 (35.00%), Postives = 161/320 (50.31%), Query Frame = 3
Query:   93 KTDMERVGLFKEMGYHTINDPYKPFFYSS-RQDIIKGKGFLGDMTRSKAATDDGYFTKPFSRVFEGESETNLMAMRRRWRNQNKEKNVGKTFIMSNPGKKQSGTGSRMGCMDYMIPYFSGITRTVRGKLPNKKNFITNPGKKGSGYGYADVCLNPYPEWKSDVYDGARNMYFRKEMAEHQKRT--------LNRKEFIPTNAYGSYFYSNPYEGGMGPYEEKHGKTVNYLQKRPFIPGSYPKILGGNKDGCLTPYPPAFPAEYKDKFTRNLVHDVRNNTNKLYNHTPGSKSCIFQSVLQKNVNFRVNNLNSHSIRNVMNY 1025
            K+DMERVGLF+EMGY ++ D Y PF Y    +   K K  L + ++ K+A   GYF   F R+FE E+ T+ + ++R+++ Q  +KN+GK F+ SN  KK SG GS  G +   +  FS +    +      KN  T+P KKGSGYG+  V L+    +  D YD AR M  ++E+A H+ +         L+ KE    N Y       P        E+K    V      PF P S  K +GG K G   PYPP     Y    TR       N   K++  +PG KS   +S++  NV+  +N+ N + I++VM Y
Sbjct:   44 KSDMERVGLFREMGYVSVGDKYTPFIYRPFHESAHKDKQMLAEGSKRKSALQAGYFETQFKRIFEKEALTDRIKIQRQYKIQQTKKNLGKAFLPSNGEKKSSGIGSYYGTLGGPVQAFSPLQVPKKPYKAPGKNMYTSPPKKGSGYGFPGVTLSKIDSYSPDPYDRAREM-LKREVAAHKSKLKGGPFHLNLHPKECFDNNPYK---LEKPLPAAKKAEEKKTRFAV------PFKPSSPSKTIGGMKAGTFEPYPPHSADPY---VTRKPSTATTNKDAKIFCPSPGPKSTPVKSIISLNVDKLLNSTNYNQIQSVMAY 350          
BLAST of UPF0602 protein C4orf47 homolog vs. TrEMBL
Match: A0A210QGT9 (UPF0602 protein C4orf47-like OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT05429 PE=4 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 2.450e-43
Identity = 108/311 (34.73%), Postives = 165/311 (53.05%), Query Frame = 3
Query:   93 KTDMERVGLFKEMGYHTINDPYKPFFYSSRQDIIKGKGFLGDMTRSKAATDDGYFTKPFSRVFEGESETNLMAMRRRWRNQNKEKNVGKTFIMSNPGKKQSGTGSRMGCMDYMIPYFSGITRTVRGKLPNKKNFITNPGKKGSGYGYADVCLNPYPEWKSDVYDGARNMYFRKEMAEHQKRTLNRKEFIPTNAYGSYFYSNPYEGG--MGPYEEKHGKTVNYLQKRPFIPGSYPKILGGNKDGCLTPYPPAFPAEYKDKFTRNLVHDVRNNTNKLYNHTPGSKSCIFQSVLQKNVNFRVNNLNSHSIRNVM 1019
            K DM+R+G+F+EMGY TI D YKP          KGK  L   +++++A   GYF + + RV EGE+ ++ + MRR+ R +  ++N+GK F+ S+  KK SG GS  G +   I  FS   R  +G     KNF+TNPGKKG+G+G+ ++ L  YP++++D Y+ AR +  +KE+A H K  +    F        YF  NPY     +G      G +      +PF P S  K   G K G   PYP      YK K + ++  +V N T K +  + G KS    S++ +N+   +N  N  S+ +++
Sbjct:    7 KNDMDRIGVFQEMGYVTIGDRYKPPGIQFNAAASKGKQILPGGSKTRSALQSGYFLEKYGRVMEGEAYSDPIKMRRQHRLKESQRNIGKAFLPSSGEKKPSGLGSHYGTLAGPISAFSPNARPGKGYKSPGKNFLTNPGKKGTGFGFVEITLGSYPKYQADAYERARELT-KKELANH-KNAVKGAAFKLNMHPKPYFDQNPYASDKLLGRRSVSAGVSKKE-DVKPFKPSSPGKKPAGMKAGTFDPYPSHSADPYKIKVSHSV--NVVNKTGKTFMPSQGPKSVPTNSIVNQNILKTINVQNYRSMTSII 312          
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Cavefish
Match: zgc:153146 (chromosome 24 C4orf47 homolog [Source:NCBI gene;Acc:103030756])

HSP 1 Score: 146.747 bits (369), Expect = 1.067e-40
Identity = 111/319 (34.80%), Postives = 165/319 (51.72%), Query Frame = 3
Query:   93 KTDMERVGLFKEMGYHTINDPYKPFFYSS-RQDIIKGKGFLGDMTRSKAATDDGYFTKPFSRVFEGESETNLMAMRRRWRNQNKEKNVGKTFIMSNPGKKQSGTGSRMGCMDYMIPYFSGITRTVRGKLPNKKNFITNPGKKGSGYGYADVCLNPYPEWKSDVYDGARNMYFRKEMAEHQKRTLNRKEFIPTNAYGSYFYSNPY--EGGMGPYEEKHGKTVNYLQKRPFIPGSYPKILGGNKDGCLTPYP-----PAFPAEYKDKFTRNLVHDVRNNTNKLYNHTPGSKSCIFQSVLQKNVNFRVNNLNSHSIRNVMNY 1025
            K+DMERVGLFKEMGY +I D Y PF Y +  +   K K  L   ++ K+    GYF   F R+FE E+ T+L+ ++R+++ +  ++N+GK F+ S+  KK+SG GS  G +   I   S +    +      KN  T+P KKGSGYGY  V L     + SD YD A+++  ++E+  H K  L    F         F +NPY  +  + P ++   K  ++    PF P S  K +GG K G    YP     P  P + K   T  L     N   K+++ +PG KS   +S++  NVN  VN+ N + I ++M Y
Sbjct:    6 KSDMERVGLFKEMGYISIGDKYTPFLYRAFNESAHKNKQMLVGGSKKKSGLQTGYFDAQFKRIFEKEALTDLIKIQRQYKLEQTKRNLGKAFLPSSGEKKRSGIGSYYGTLGGSIQAMSPLKIPKQPYKSPGKNMYTSPPKKGSGYGYPGVTLGKLDLYSSDPYDRAKDI-VKRELIAH-KSMLKGGPFRLNLHPKECFDANPYKPDKPLPPSKKTEDKKTHF--GVPFKPSSPSKKIGGMKAGTFDLYPTHSVDPYIPHKPK---TAGL-----NKELKIFHPSPGPKSTPVKSIISLNVNKFVNSKNCNQIPSIMAY 312          
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Sea Lamprey
Match: zgc:153146 (pep scaffold:Pmarinus_7.0:GL477013:54605:76454:-1 gene:ENSPMAG00000001809.1 transcript:ENSPMAT00000001995.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:zgc:153146)

HSP 1 Score: 139.428 bits (350), Expect = 1.032e-38
Identity = 104/305 (34.10%), Postives = 148/305 (48.52%), Query Frame = 3
Query:   93 KTDMERVGLFKEMGYHTINDPYKPFFYSSRQDII-KGKGFLGDMTRSKAATDDGYFTKPFSRVFEGESETNLMAMRRRWRNQNKEKNVGKTFIMSNPGKKQSGTGSRMGCMDYMIPYFSGITRTVRGKLPNK------KNFITNPGKKGSGYGYADVCLNPYPEWKSDVYDGARNMYFRKEMAEHQKRTLN---RKEFIPTNAYGSYFYSNPYEGGMGPYEEKHGKTVNYLQKRPFIPGSYPKILGGNKDGCLTPYPPAFPAEYKDKFTRNLVHDVRNNTNK--LYNHTPGSKSCIFQSVLQKNV 971
            KTDMERVGLF E+GY +I D YK  F  +      +G+  L +  +S++A   GYF++ F+RV +GE+ ++ + +RR+ R Q  +KN+GK  + S+  KK SG GS  G +   IP  S        +LP K      +NF+TNP KKG+GYGY  V +   P +  D YD A+ +  RKEM  H+K       R    P +     F  NPY     P    H        ++ F P S  K +GG K G    YP      Y  K    L      N     ++  +PG KS   +S++  N+
Sbjct:    6 KTDMERVGLFSELGYISIGDKYKSSFNKAFNAAANRGRQMLTEGPKSRSALPAGYFSQGFTRVMQGEAYSDPIKIRRQRRLQEAKKNLGKALLPSSCPKKPSGLGSYYGTLGGPIPALSP------AQLPKKPYSAPGRNFVTNPPKKGTGYGYPQVMIGSLPPYMPDPYDRAKEIR-RKEMETHKKMVKGAPFRLNLHPLD----IFDVNPYRSDQ-PARATHPPRATKSSEKAFKPSSPAKKMGGMKAGTFDSYPSHSEDAYIVKRASALAGGSSGNKGGGHVFRPSPGPKSTPVRSIIDANI 298          
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Nematostella
Match: EDO34007 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQL2])

HSP 1 Score: 156.762 bits (395), Expect = 5.502e-45
Identity = 103/303 (33.99%), Postives = 158/303 (52.15%), Query Frame = 3
Query:   93 KTDMERVGLFKEMGYHTINDPYKPFFYSSRQDIIKGKGFLGDMTRSKAATDDGYFTKPFSRVFEGESETNLMAMRRRWRNQNKEKNVGKTFIMSNPGKKQSGTGSRMGCMDYMIPYFSGITRTVRGKLPNKKNFITNPGKKGSGYGYADVCLNPYPEWKSDVYDGARNMYFRKEMAEHQKRTLNRKEFIPTNAYGSYFYSNPYEGG--MGPYEEKHGKTVNYLQKRPFIPGSYPKILGGNKDGCLTPYPPAFPAEYKDKFTRNLVHDVRNNTNKLYNHTPGSKSCIFQSVLQKNVNFRVNNLN 995
            K D+ RVGLF E+GY +I DPYK    +      KGK  L   ++ +++  DGYF + F+RV EGE+ ++ +  RR  R +  + N+GK F+ SN  K  SG G+  G     +P FS +T++    +   KNF+TNP KKG+GYGY  V +   P++ SD YD  R    RK+  +   + +    F       SYF  NPY+    + P ++      ++   +PF P   PK +GG K GC T YP      ++ K  +N      +   K++  + G KS   +S++ +NV+ R+N LN
Sbjct:    9 KNDLNRVGLFSELGYISIGDPYKIQNGNFNLAAHKGKQMLPGGSKIRSSKQDGYFDQKFNRVMEGEAFSDPVKRRRLDRLKATKLNIGKAFVPSNGDKLPSGIGNHYGTFAGAVPAFSPVTKSKSAHVSPGKNFLTNPPKKGTGYGYLQVTIGASPKYMSDAYD--RGKELRKKEMDTSGKQMKGGAFKLNLHPKSYFDGNPYKSDRPLPPVKDGRKAKPDF---KPFKPSHPPKEIGGMKAGCFTSYPSHSEDPFQPKKKKN-----GDGERKIFRPSQGPKSTPMKSIINQNVDRRINRLN 301          
BLAST of UPF0602 protein C4orf47 homolog vs. Planmine SMEST
Match: SMESG000042363.1 (SMESG000042363.1)

HSP 1 Score: 652.514 bits (1682), Expect = 0.000e+0
Identity = 314/314 (100.00%), Postives = 314/314 (100.00%), Query Frame = 3
Query:   84 MTEKTDMERVGLFKEMGYHTINDPYKPFFYSSRQDIIKGKGFLGDMTRSKAATDDGYFTKPFSRVFEGESETNLMAMRRRWRNQNKEKNVGKTFIMSNPGKKQSGTGSRMGCMDYMIPYFSGITRTVRGKLPNKKNFITNPGKKGSGYGYADVCLNPYPEWKSDVYDGARNMYFRKEMAEHQKRTLNRKEFIPTNAYGSYFYSNPYEGGMGPYEEKHGKTVNYLQKRPFIPGSYPKILGGNKDGCLTPYPPAFPAEYKDKFTRNLVHDVRNNTNKLYNHTPGSKSCIFQSVLQKNVNFRVNNLNSHSIRNVMNY 1025
            MTEKTDMERVGLFKEMGYHTINDPYKPFFYSSRQDIIKGKGFLGDMTRSKAATDDGYFTKPFSRVFEGESETNLMAMRRRWRNQNKEKNVGKTFIMSNPGKKQSGTGSRMGCMDYMIPYFSGITRTVRGKLPNKKNFITNPGKKGSGYGYADVCLNPYPEWKSDVYDGARNMYFRKEMAEHQKRTLNRKEFIPTNAYGSYFYSNPYEGGMGPYEEKHGKTVNYLQKRPFIPGSYPKILGGNKDGCLTPYPPAFPAEYKDKFTRNLVHDVRNNTNKLYNHTPGSKSCIFQSVLQKNVNFRVNNLNSHSIRNVMNY
Sbjct:    1 MTEKTDMERVGLFKEMGYHTINDPYKPFFYSSRQDIIKGKGFLGDMTRSKAATDDGYFTKPFSRVFEGESETNLMAMRRRWRNQNKEKNVGKTFIMSNPGKKQSGTGSRMGCMDYMIPYFSGITRTVRGKLPNKKNFITNPGKKGSGYGYADVCLNPYPEWKSDVYDGARNMYFRKEMAEHQKRTLNRKEFIPTNAYGSYFYSNPYEGGMGPYEEKHGKTVNYLQKRPFIPGSYPKILGGNKDGCLTPYPPAFPAEYKDKFTRNLVHDVRNNTNKLYNHTPGSKSCIFQSVLQKNVNFRVNNLNSHSIRNVMNY 314          
BLAST of UPF0602 protein C4orf47 homolog vs. Planmine SMEST
Match: SMESG000078789.1 (SMESG000078789.1)

HSP 1 Score: 191.045 bits (484), Expect = 7.136e-58
Identity = 123/317 (38.80%), Postives = 179/317 (56.47%), Query Frame = 3
Query:   84 MTEKTDMERVGLFKEMGYHTINDPYKPFFYSS-RQDIIKGKGFLGDMTRSKAATDDGYFTKPFSRVFEGESETNLMAMRRRWRNQNKEKNVGKTFIMSNPGKKQSGTGSRMGCMDYMIPYFSGITRTVRGKLPNKKNFITNPGKKGSGYGYADVCLNPYPEWKSDVYDGARNMYFRKEMAEHQKRTLNRKEFIPTNAYGSYFYSNPYEGGMGPYEEKHGKTVNYLQK--RPFIPGSYPKILGGNKDGCLTPYPPAFPAEYKDKFTRNLVHDVRNNTNKLYNHTPGSKSCIFQSVLQKNVNFRVNNLNSHSIRNVMNY 1025
            MT KTDMERVGLFKE+GYHTI DPYK        Q   KGK  L    +SK+A++ GYF + F+R+F+GES ++ + + R+ RN++ +K +GK ++  N  K+  G+G+  G     IP+F  I++  R K    KNF TNP KKG GYG+  V LN YPE++S+ YD ++++  ++E  EH+ +  +R  F        YF  NPY    GP E+    +VN   +  + F P S  K+ GG K GC   +P      YK K  +  V +V N++ + +    G KS    SVLQ+N+   +   N   I++VMNY
Sbjct:    1 MTSKTDMERVGLFKELGYHTIGDPYKSSALQQFNQSASKGKQVLPGGEKSKSASNVGYFQE-FTRIFDGESYSDPIKLMRKRRNESSKKKLGKNWVPVNGIKESCGSGTYYGTFSGAIPHFEAISKEQRAKGIQGKNFYTNPAKKGVGYGFVGVTLNKYPEYQSEKYDRSKDIT-KQENEEHKSKLHSRGVFRLGMHLRDYFDMNPYS---GPSEKYRVTSVNSKSQNFKTFKPSSPSKLDGGMKAGCFGSFPEYSSETYKAKIPKRPV-NVVNSSGRTFIPPIGPKSRPVNSVLQQNIIRTITPANYRQIQSVMNY 311          
BLAST of UPF0602 protein C4orf47 homolog vs. Planmine SMEST
Match: SMESG000033217.1 (SMESG000033217.1)

HSP 1 Score: 110.923 bits (276), Expect = 1.035e-27
Identity = 95/315 (30.16%), Postives = 151/315 (47.94%), Query Frame = 3
Query:   90 EKTDMERVGLFKEMGYHTINDPYK-PFFYSSRQDIIKGKGFLGDMTRSKAATDDGYFTKPFSRVFEGESETNLMAMRRRWRNQNKEKNVGKTFIMSNPGKKQSGTGSRMGCMDYMIPYFSGIT-RTVRGKLPNKKNFITNPGKKGSGYGYADVCLNPYPEWKSDVYDGARNMYFRKEMAEHQKRTLNRKEFIPTNAYGSYFYSNPYEGGMGPYEEKHGKTVNYLQKRPFIPGSYPKILGGNKDGCLTPYPPAFPAEYKDKFTRNL--VHDVRNNTNKLYNHTPGSKSCIFQSVLQKNVNFRVNNLNSHSIRNVMN 1022
            +K D+E+ GLF+E  Y +  D YK P  +       KGK  + +  ++K+A + GYF+  F R FEGE+ ++ + +RR     NKEK  GK F + +  K   G GS  G     IP   G T +  +     K+NF TN  KKG+GYGY  +  N YPE+KS+ Y   ++     E  E+Q +  +  + +       +F SNPY+G +  + E   K V    K   +  S+              +P      Y +K  RNL  + +V N++ + +   PG K+    S+L KN+   +N  N  ++ +V +
Sbjct:    5 KKNDLEKFGLFQEFPYQS--DLYKTPGNFEFNASSAKGKQIVIESNKTKSALNHGYFSN-FLRTFEGEAYSDPIKIRRELNRPNKEKLAGKVFHLPSIPKNPEGLGSYYGTFSGPIPAMLGETIQFSKSDEIKKRNFYTNCSKKGTGYGYVGLTFNKYPEYKSEPYGILKS----SEEKENQNKPFHTVKSL------DFFDSNPYKGSI--FSEGKEKPVKENLKSFHVNTSH-------LSNSFNAFPKYENDVYDEKLKRNLPYIKNVMNDSKRTFGAIPGPKTMRTFSILNKNIERSINAQNYGTVGSVFS 297          
The following BLAST results are available for this feature:
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
C4orf479.568e-3633.77chromosome 4 open reading frame 47 [Source:HGNC Sy... [more]
C4orf479.898e-2939.43chromosome 4 open reading frame 47 [Source:HGNC Sy... [more]
C4orf473.033e-2640.76chromosome 4 open reading frame 47 [Source:HGNC Sy... [more]
back to top
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
zgc:1531461.557e-4436.91zgc:153146 [Source:NCBI gene;Acc:751702][more]
C14H4orf478.577e-4436.59zgc:153146 [Source:NCBI gene;Acc:751702][more]
C14H4orf478.577e-4436.59zgc:153146 [Source:NCBI gene;Acc:751702][more]
back to top
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
C4orf473.958e-3333.02chromosome 4 open reading frame 47 [Source:NCBI ge... [more]
back to top
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
1700029J07Rik1.564e-4536.51RIKEN cDNA 1700029J07 gene [Source:MGI Symbol;Acc:... [more]
1700029J07Rik1.564e-4536.51RIKEN cDNA 1700029J07 gene [Source:MGI Symbol;Acc:... [more]
1700029J07Rik3.333e-1643.00RIKEN cDNA 1700029J07 gene [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of UPF0602 protein C4orf47 homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3U1D9|CD047_MOUSE1.094e-4436.51UPF0602 protein C4orf47 homolog OS=Mus musculus OX... [more]
sp|Q0P4C5|CD047_DANRE6.979e-4236.28UPF0602 protein C4orf47 homolog OS=Danio rerio OX=... [more]
sp|Q5XHC1|CD047_XENLA2.737e-3736.05UPF0602 protein C4orf47 homolog OS=Xenopus laevis ... [more]
sp|Q2T9M0|CD047_BOVIN3.681e-3733.64UPF0602 protein C4orf47 homolog OS=Bos taurus OX=9... [more]
sp|A7E2U8|CD047_HUMAN4.595e-3533.77UPF0602 protein C4orf47 OS=Homo sapiens OX=9606 GN... [more]
back to top
BLAST of UPF0602 protein C4orf47 homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183TR355.211e-4734.85Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A267FK759.926e-4634.18Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A2C9K2321.998e-4437.99Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A4W4FDP51.783e-4335.00Zgc:153146 OS=Electrophorus electricus OX=8005 PE=... [more]
A0A210QGT92.450e-4334.73UPF0602 protein C4orf47-like OS=Mizuhopecten yesso... [more]
back to top
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
zgc:1531461.067e-4034.80chromosome 24 C4orf47 homolog [Source:NCBI gene;Ac... [more]
back to top
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
zgc:1531461.032e-3834.10pep scaffold:Pmarinus_7.0:GL477013:54605:76454:-1 ... [more]
back to top
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO340075.502e-4533.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UPF0602 protein C4orf47 homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000042363.10.000e+0100.00SMESG000042363.1[more]
SMESG000078789.17.136e-5838.80SMESG000078789.1[more]
SMESG000033217.11.035e-2730.16SMESG000033217.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035930 ID=SMED30035930|Name=UPF0602 protein C4orf47 homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=1130bp
GTTTTAGACAATAAAATGAAATAAGTGATATAAACCCTCTTTTTTATTAT
ATTAGTTTACTGAATTTATAATATTTTTTTAAAATGACTGAAAAAACTGA
CATGGAGCGGGTTGGATTGTTCAAAGAAATGGGATATCACACAATTAATG
ACCCATACAAACCGTTTTTCTATTCTTCTCGTCAGGATATCATTAAGGGA
AAAGGATTTTTAGGAGATATGACAAGATCTAAAGCTGCAACTGACGATGG
ATATTTCACTAAACCATTTTCAAGAGTATTCGAAGGAGAAAGTGAGACTA
ATCTAATGGCAATGAGAAGACGATGGAGAAATCAAAATAAAGAAAAAAAC
GTTGGTAAAACATTCATTATGTCAAATCCAGGAAAAAAGCAAAGTGGAAC
TGGATCAAGAATGGGTTGCATGGATTACATGATACCCTATTTTTCTGGAA
TAACTAGAACAGTTCGTGGTAAATTACCTAATAAAAAGAATTTTATAACC
AACCCAGGTAAGAAAGGTTCAGGGTATGGTTATGCTGATGTCTGTTTAAA
TCCATATCCTGAATGGAAGTCTGATGTTTATGACGGTGCTAGAAACATGT
ATTTTCGAAAAGAAATGGCTGAACATCAGAAAAGAACATTAAACCGAAAA
GAATTCATTCCAACAAATGCTTATGGAAGCTACTTTTATAGCAATCCTTA
TGAAGGAGGTATGGGACCTTATGAAGAAAAGCATGGTAAAACAGTAAACT
ATCTTCAGAAACGTCCATTTATTCCAGGCAGTTATCCAAAGATTTTAGGT
GGTAACAAAGATGGTTGTCTAACACCTTATCCCCCGGCATTTCCTGCCGA
GTACAAAGATAAATTTACTCGTAATTTGGTCCATGACGTTCGGAACAACA
CAAACAAGTTATACAATCATACACCTGGTTCAAAATCATGTATTTTTCAG
TCTGTTCTTCAAAAGAACGTTAATTTCCGTGTCAATAATCTCAACTCTCA
TTCAATAAGAAATGTTATGAACTATTAAACAAATTTTTGAAAAGAATTTT
ATGGAATGGATTCAAATTGAACTTGAAAAGCAACTAGTTTTGCTTGAATT
TTAAAGAAATCTCTTAAGCAGTCTTTAGTA
back to top

protein sequence of SMED30035930-orf-1

>SMED30035930-orf-1 ID=SMED30035930-orf-1|Name=SMED30035930-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=315bp
MTEKTDMERVGLFKEMGYHTINDPYKPFFYSSRQDIIKGKGFLGDMTRSK
AATDDGYFTKPFSRVFEGESETNLMAMRRRWRNQNKEKNVGKTFIMSNPG
KKQSGTGSRMGCMDYMIPYFSGITRTVRGKLPNKKNFITNPGKKGSGYGY
ADVCLNPYPEWKSDVYDGARNMYFRKEMAEHQKRTLNRKEFIPTNAYGSY
FYSNPYEGGMGPYEEKHGKTVNYLQKRPFIPGSYPKILGGNKDGCLTPYP
PAFPAEYKDKFTRNLVHDVRNNTNKLYNHTPGSKSCIFQSVLQKNVNFRV
NNLNSHSIRNVMNY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR029358DUF4586
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005815microtubule organizing center
GO:0005856cytoskeleton
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR029358Protein of unknown function DUF4586PFAMPF15239DUF4586coord: 5..297
e-value: 5.5E-63
score: 214.0
IPR029358Protein of unknown function DUF4586PANTHERPTHR31144FAMILY NOT NAMEDcoord: 3..302