SWI/SNF complex subunit SMARCC2

Overview
NameSWI/SNF complex subunit SMARCC2
Smed IDSMED30035929
Length (bp)3897
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SWI/SNF complex subunit SMARCC2 (SMED30035929) t-SNE clustered cells

Violin plots show distribution of expression levels for SWI/SNF complex subunit SMARCC2 (SMED30035929) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SWI/SNF complex subunit SMARCC2 (SMED30035929) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SWI/SNF complex subunit SMARCC2 (SMED30035929) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035929

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 19

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30035929SMESG000031576.1 SMESG000013315.1 SmedASXL_017596SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30035929SMESG000031576.1 SMESG000013315.1 SmedASXL_017596SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30035929SMESG000031576.1 SMESG000013315.1 dd_Smed_v4_1804_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30035929SMESG000031576.1 SMESG000013315.1 dd_Smed_v4_1804_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30035929SMESG000031576.1 SMESG000013315.1 dd_Smed_v4_1804_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30035929SMESG000031576.1 SMESG000013315.1 dd_Smed_v4_1804_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035929SMESG000031576.1 SMESG000013315.1 dd_Smed_v4_1804_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30035929SMESG000031576.1 SMESG000013315.1 dd_Smed_v4_1804_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035929SMESG000031576.1 SMESG000013315.1 dd_Smed_v4_1804_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035929SMESG000031576.1 SMESG000013315.1 dd_Smed_v4_1804_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30035929SMESG000031576.1 SMESG000013315.1 Contig17559uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30035929SMESG000031576.1 SMESG000013315.1 Contig17559newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30035929SMESG000031576.1 SMESG000013315.1 SMU15037683SMUPMID:30237141
Trost et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30035929SMESG000031576.1 SMESG000013315.1 SMU15037683SMUPMID:30237141
Trost et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30035929SMESG000031576.1 SMESG000013315.1 SMU15001981SMUPMID:30237141
Trost et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30035929SMESG000031576.1 SMESG000013315.1 SMU15001981SMUPMID:30237141
Trost et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30035929SMESG000031576.1 SMESG000013315.1 dd_Smed_v6_1804_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035929SMESG000031576.1 SMESG000013315.1 SMED_24609_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30035929SMESG000031576.1 SMESG000013315.1 SMED_24609_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Human
Match: SMARCC2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily c member 2 [Source:HGNC Symbol;Acc:HGNC:11105])

HSP 1 Score: 639.417 bits (1648), Expect = 0.000e+0
Identity = 441/1039 (42.44%), Postives = 598/1039 (57.56%), Query Frame = 3
Query:   24 LFLKKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWI--SNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDFLLPGNQQEFAKQANRKPIISRKCYNGDDLNVMLNVSSQPSSVGXXXXXXXXXXXXXXXXXXXXXXXXNKEDNSGKRRKQNVVRAASLANLRKSKVKEXXXXXXXXXXXXXXXPECPNRVEEVPSNSLGRNTPSRGASAAGNIDNRNNVLYDLDEETQGSGXXXXXXXXXXXXXXXDE-----SFHADMSVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSL------GNQ--ASVVKSQSNNSAIDKQPTVTANPKDLSNSDN---VNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLEE--VAG--KDPIDKAKEGDXXXX----XXXXXXXXXXXXXDSSTSVKSETDNKVXXXXXXXXXXXXRMDS------SENQPAVVEENEIKVESKDEEMQEKPISNEEEIKI-FDKDSNXXXXXXXXXXXXXXXXXXXXYLAQSEEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIXXXXXXXXXXXXXXXXXXXAFHMELLKTVESRAR 3041
            + ++KKDG PN ++YE  + +  FD VR WL +N KKY Q +P TNKSL++L  QLLQ+QEE FGK  +   + KLPI CF DFK GGSL HI +A  K+KSDQG RR+DFQ+PSR +RNVEMFM I+  L  + C  +P ++L P I  + + KL+   ++    + E+ N A+H+++P     L  ++  R VM+  + ++LHW   PDS+D WI  S I +    +P P         +  ++  +W+L T   NEWM         N++++    ++ P+  RK  +   L   +N    P S            +  K         S     + + +K+N  +  S    +  +   +++ ED     D   P  PN VEEV   +L +   ++  S +  +  +   + DLDE+   S           ++    E       H D +VTEQ H IIIPSY+AWFDYNS+H IERRALPEFF GKNKSK+ E+Y+AYRNFMIDTYRLNPQEYLT TACRRNL GDVC+I+RVHAFLEQWGLINYQVD E + T   +GPP TSHFHVL D+ +GL  L      G Q  A     +      D  P       +L  S +   +N   K  +       P+ + ++ L+TD Y      + +V   S            + ++EW++QETLLLLE LEMYKDDWNKV+EHVGSRTQ+ECIL+FLRLPIEDPYLE   A +  L YQPIPFS+SGNP+MSTVAFLAS VDPR+AS AAK+AL EFS++KEEVP  +V+ H  KV  A +     DP  +GLE   +AG   D  ++ +E  N E        + K   KE  +   +++ E   K       + E  +  DS      S+  P V  E E + +   EE+ ++ + +E E K   ++D     L+ AA+ ALAA+A KA++LA  EE+KIK LVA LVE Q+KK+E+KL+ F+ELE I++RE E LE QRQQLL DRQAFHME LK  E RAR
Sbjct:    1 MAVRKKDGGPNVKYYEAADTVTQFDNVRLWLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQEEVFGKHVSNAPLTKLPIKCFLDFKAGGSLCHILAAAYKFKSDQGWRRYDFQNPSRMDRNVEMFMTIEKSLVQNNCLSRPNIFLCPEIEPKLLGKLKDIIKRHQGTVTEDKNNASHVVYPVPGN-LEEEEWVRPVMKRDKQVLLHWGYYPDSYDTWIPASEIEASVEDAPTP--------EKPRKVHAKWILDTDTFNEWM---------NEEDYEVNDDKNPVSRRKKISAKTLTDEVN---SPDS----------DRRDKKGGNYKKRKRSPSPSPTPEAKKKNAKKGPSTPYTKSKRGHREEEQEDLTKDMDEPSP-VPN-VEEV---TLPKTVNTKKDSESAPV--KGGTMTDLDEQEDESMETTGKDEDENSTGNKGEQTKNPDLHED-NVTEQTHHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQVDAESRPTP--MGPPPTSHFHVLADTPSGLVPLQPKTPQGRQVDADTKAGRKGKELDDLVPETAKGKPELQTSASQQMLNFPDKGKEK------PTDMQNFGLRTDMY-----TKKNVPSKSKAAA--------SATREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLEDSEASLGPLAYQPIPFSQSGNPVMSTVAFLASVVDPRVASAAAKSALEEFSKMKEEVPTALVEAHVRKVEEAAKVTGKADP-AFGLESSGIAGTTSDEPERIEESGNDEARVEGQATDEKKEPKEPREGGGAIEEEAKEKTSEAPKKDEEKGKEGDSEKESEKSDGDPIVDPEKEKEPKEGQEEVLKEVVESEGERKTKVERDIGEGNLSTAAAAALAAAAVKAKHLAAVEERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREREALEYQRQQLLADRQAFHMEQLKYAEMRAR 978          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Human
Match: SMARCC2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily c member 2 [Source:HGNC Symbol;Acc:HGNC:11105])

HSP 1 Score: 639.417 bits (1648), Expect = 0.000e+0
Identity = 442/1039 (42.54%), Postives = 598/1039 (57.56%), Query Frame = 3
Query:   24 LFLKKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWI--SNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDFLLPGNQQEFAKQANRKPIISRKCYNGDDLNVMLNVSSQPSSVGXXXXXXXXXXXXXXXXXXXXXXXXNKEDNSGKRRKQNVVRAASLANLRKSKVKEXXXXXXXXXXXXXXXPECPNRVEEVPSNSLGRNTPSRGASAAGNIDNRNNVLYDLDEETQGSGXXXXXXXXXXXXXXXDE-----SFHADMSVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSL------GNQ--ASVVKSQSNNSAIDKQPTVTANPKDLSNSDN---VNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLEE--VAG--KDPIDKAKEGDXXXX----XXXXXXXXXXXXXDSSTSVKSETDNKVXXXXXXXXXXXXRMDS------SENQPAVVEENEIKVESKDEEMQEKPISNEEEIKI-FDKDSNXXXXXXXXXXXXXXXXXXXXYLAQSEEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIXXXXXXXXXXXXXXXXXXXAFHMELLKTVESRAR 3041
            + ++KKDG PN ++YE  + +  FD VR WL +N KKY Q +P TNKSL++L  QLLQ+QEE FGK  +   + KLPI CF DFK GGSL HI +A  K+KSDQG RR+DFQ+PSR +RNVEMFM I+  L  + C  +P ++L P I  + + KL+   ++    + E+ N A+H+++P     L  ++  R VM+  + ++LHW   PDS+D WI  S I +    +P P         +  ++  +W+L T   NEWM+EE         ++    ++ P+  RK  +   L   +N    P S            +  K         S     + + +K+N  +  S    +  +   +++ ED     D   P  PN VEEV   +L +   ++  S +  +  +   + DLDE+   S           ++    E       H D +VTEQ H IIIPSY+AWFDYNS+H IERRALPEFF GKNKSK+ E+Y+AYRNFMIDTYRLNPQEYLT TACRRNL GDVC+I+RVHAFLEQWGLINYQVD E + T   +GPP TSHFHVL D+ +GL  L      G Q  A     +      D  P       +L  S +   +N   K  +       P+ + ++ L+TD Y      + +V   S            + ++EW++QETLLLLE LEMYKDDWNKV+EHVGSRTQ+ECIL+FLRLPIEDPYLE   A +  L YQPIPFS+SGNP+MSTVAFLAS VDPR+AS AAK+AL EFS++KEEVP  +V+ H  KV  A +     DP  +GLE   +AG   D  ++ +E  N E        + K   KE  +   +++ E   K       + E  +  DS      S+  P V  E E + +   EE+ ++ + +E E K   ++D     L+ AA+ ALAA+A KA++LA  EE+KIK LVA LVE Q+KK+E+KL+ F+ELE I++RE E LE QRQQLL DRQAFHME LK  E RAR
Sbjct:    1 MAVRKKDGGPNVKYYEAADTVTQFDNVRLWLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQEEVFGKHVSNAPLTKLPIKCFLDFKAGGSLCHILAAAYKFKSDQGWRRYDFQNPSRMDRNVEMFMTIEKSLVQNNCLSRPNIFLCPEIEPKLLGKLKDIIKRHQGTVTEDKNNASHVVYPVPGN-LEEEEWVRPVMKRDKQVLLHWGYYPDSYDTWIPASEIEASVEDAPTP--------EKPRKVHAKWILDTDTFNEWMNEE---------DYEVNDDKNPVSRRKKISAKTLTDEVN---SPDS----------DRRDKKGGNYKKRKRSPSPSPTPEAKKKNAKKGPSTPYTKSKRGHREEEQEDLTKDMDEPSP-VPN-VEEV---TLPKTVNTKKDSESAPV--KGGTMTDLDEQEDESMETTGKDEDENSTGNKGEQTKNPDLHED-NVTEQTHHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQVDAESRPTP--MGPPPTSHFHVLADTPSGLVPLQPKTPQGRQVDADTKAGRKGKELDDLVPETAKGKPELQTSASQQMLNFPDKGKEK------PTDMQNFGLRTDMY-----TKKNVPSKSKAAA--------SATREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLEDSEASLGPLAYQPIPFSQSGNPVMSTVAFLASVVDPRVASAAAKSALEEFSKMKEEVPTALVEAHVRKVEEAAKVTGKADP-AFGLESSGIAGTTSDEPERIEESGNDEARVEGQATDEKKEPKEPREGGGAIEEEAKEKTSEAPKKDEEKGKEGDSEKESEKSDGDPIVDPEKEKEPKEGQEEVLKEVVESEGERKTKVERDIGEGNLSTAAAAALAAAAVKAKHLAAVEERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREREALEYQRQQLLADRQAFHMEQLKYAEMRAR 978          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Human
Match: SMARCC2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily c member 2 [Source:HGNC Symbol;Acc:HGNC:11105])

HSP 1 Score: 637.106 bits (1642), Expect = 0.000e+0
Identity = 441/1030 (42.82%), Postives = 597/1030 (57.96%), Query Frame = 3
Query:   24 LFLKKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWI--SNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDFLLPGNQQEFAKQANRKPIISRKCYNGDDLNVMLNVSSQPSSVGXXXXXXXXXXXXXXXXXXXXXXXXNKEDNSGKRRKQNVVRAASLANLRKSKVKEXXXXXXXXXXXXXXXPECPNRVEEVPSNSLGRNTPSRGASAAGNIDNRNNVLYDLDE------ETQGSGXXXXXXXXXXXXXXXDESFHADMSVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDN-VNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLEE--VAG--KDPIDKAKEGDXXXX----XXXXXXXXXXXXXDSSTSVKSETDNKVXXXXXXXXXXXXRMDS------SENQPAVVEENEIKVESKDEEMQEKPISNEEEIKI-FDKDSNXXXXXXXXXXXXXXXXXXXXYLAQSEEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIXXXXXXXXXXXXXXXXXXXAFHMELLKTVESRAR 3041
            + ++KKDG PN ++YE  + +  FD VR WL +N KKY Q +P TNKSL++L  QLLQ+QEE FGK  +   + KLPI CF DFK GGSL HI +A  K+KSDQG RR+DFQ+PSR +RNVEMFM I+  L  + C  +P ++L P I  + + KL+   ++    + E+ N A+H+++P     L  ++  R VM+  + ++LHW   PDS+D WI  S I +    +P P         +  ++  +W+L T   NEWM         N++++    ++ P+  RK  +   L   +N    P S            +  K         S     + + +K+N  +  S    +  +   +++ ED     D   P  PN VEEV   +L +   ++  S +  +  +   + DLDE      ET G    + ++  N      +   H D +VTEQ H IIIPSY+AWFDYNS+H IERRALPEFF GKNKSK+ E+Y+AYRNFMIDTYRLNPQEYLT TACRRNL GDVC+I+RVHAFLEQWGLINYQVD E + T   +GPP TSHFHVL D+ +GL  L                  QP     P+  S S   +N   K  +       P+ + ++ L+TD Y      + +V   S            + ++EW++QETLLLLE LEMYKDDWNKV+EHVGSRTQ+ECIL+FLRLPIEDPYLE   A +  L YQPIPFS+SGNP+MSTVAFLAS VDPR+AS AAK+AL EFS++KEEVP  +V+ H  KV  A +     DP  +GLE   +AG   D  ++ +E  N E        + K   KE  +   +++ E   K       + E  +  DS      S+  P V  E E + +   EE+ ++ + +E E K   ++D     L+ AA+ ALAA+A KA++LA  EE+KIK LVA LVE Q+KK+E+KL+ F+ELE I++RE E LE QRQQLL DRQAFHME LK  E RAR
Sbjct:    1 MAVRKKDGGPNVKYYEAADTVTQFDNVRLWLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQEEVFGKHVSNAPLTKLPIKCFLDFKAGGSLCHILAAAYKFKSDQGWRRYDFQNPSRMDRNVEMFMTIEKSLVQNNCLSRPNIFLCPEIEPKLLGKLKDIIKRHQGTVTEDKNNASHVVYPVPGN-LEEEEWVRPVMKRDKQVLLHWGYYPDSYDTWIPASEIEASVEDAPTP--------EKPRKVHAKWILDTDTFNEWM---------NEEDYEVNDDKNPVSRRKKISAKTLTDEVN---SPDS----------DRRDKKGGNYKKRKRSPSPSPTPEAKKKNAKKGPSTPYTKSKRGHREEEQEDLTKDMDEPSP-VPN-VEEV---TLPKTVNTKKDSESAPV--KGGTMTDLDEQEDESMETTGK-DEDENSTGNKGEQTKNPDLHED-NVTEQTHHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQVDAESRPTP--MGPPPTSHFHVLADTPSGLVPL------------------QPKT---PQQTSASQQMLNFPDKGKEK------PTDMQNFGLRTDMY-----TKKNVPSKSKAAA--------SATREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLEDSEASLGPLAYQPIPFSQSGNPVMSTVAFLASVVDPRVASAAAKSALEEFSKMKEEVPTALVEAHVRKVEEAAKVTGKADP-AFGLESSGIAGTTSDEPERIEESGNDEARVEGQATDEKKEPKEPREGGGAIEEEAKEKTSEAPKKDEEKGKEGDSEKESEKSDGDPIVDPEKEKEPKEGQEEVLKEVVESEGERKTKVERDIGEGNLSTAAAAALAAAAVKAKHLAAVEERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREREALEYQRQQLLADRQAFHMEQLKYAEMRAR 947          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Human
Match: SMARCC1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily c member 1 [Source:HGNC Symbol;Acc:HGNC:11104])

HSP 1 Score: 564.688 bits (1454), Expect = 1.563e-180
Identity = 361/830 (43.49%), Postives = 488/830 (58.80%), Query Frame = 3
Query:   33 KKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWISNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDFLLPGNQQEFAKQANRKPIISRKCYNGDDLNVMLNVSSQPSSVGXXXXXXXXXXXXXXXXXXXXXXXXNKEDNSGKRRKQNVVRAASLANLRKSKVKEXXXXXXXXXXXXXXXPECPNRVEEV--PSN----SLGRNTPSRGASAAGNIDNRNNVLYDLDEETQGSGXXXXXXXXXXXXXXXDESFHADMS---VTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDNVNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLEE--VAGKDPIDKAK 2489
            ++KDG P  +F+E+PE ++  D+VR WL ++ KKY   D  TNK+LA L  QLLQ+QE+ FGK     +  KLP  CF DFK GG+L HI  A  KYK++QG RRFD Q+PSR +RNVEMFM I+  L  + C  +P ++L P I  +   KL+   ++      +  ++A+H ++P +S    +++  R VMR+ + +++HW   PDS+D W+ +   D  +   P         + W++  +W+L T   NEWM+EED+ +           NRKP+  R+  +          + +P    +++   A +  + +K     P P+  E     R+K      ASL   R+S+ KE+D+ ED     +   P  PN +EEV  P N        NTP +G + A         L + DEET  +G   +   A       D+S   D+    VTEQ + IIIPSY++WFDYN IHVIERRALPEFF GKNKSK+ E+Y+AYRNFMIDTYRLNPQEYLT TACRRNLTGDVC+++RVHAFLEQWGL+NYQVD E +  A  +GPP T HF+VL D+ +GL  L  ++               P V A  + L      N   K+ +       P  + ++ L+TD Y      +S   + ++ G            +EW++QETLLLLE LEMYKDDWNKV+EHVGSRTQ+ECIL+FLRLPIEDPYLE   A +  L YQP+PFS+SGNP+MSTVAFLAS VDPR+AS AAKAAL EFSR++EEVP  +V+ H  KV  A  +   VDP  YGLE   +AG  P +  K
Sbjct:   32 RRKDGGPATKFWESPETVSQLDSVRVWLGKHYKKYVHADAPTNKTLAGLVVQLLQFQEDAFGKHVTNPAFTKLPAKCFMDFKAGGALCHILGAAYKYKNEQGWRRFDLQNPSRMDRNVEMFMNIEKTLVQNNCLTRPNIYLIPDIDLKLANKLKDIIKRHQGTFTDEKSKASHHIYPYSSS-QDDEEWLRPVMRKEKQVLVHWGFYPDSYDTWVHSNDVDAEIEDPPI------PEKPWKVHVKWILDTDIFNEWMNEEDYEV---------DENRKPVSFRQRIS--------TKNEEPVRSPERRDRKASANARKRKHSPSPPPPTPTE----SRKKSGKKGQASLYGKRRSQ-KEEDEQEDLTKDMEDPTP-VPN-IEEVVLPKNVNLKKDSENTPVKGGTVAD--------LDEQDEETVTAGGKEDEDPAKG-----DQSRSVDLGEDNVTEQTNHIIIPSYASWFDYNCIHVIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLTGDVCAVMRVHAFLEQWGLVNYQVDPESRPMA--MGPPPTPHFNVLADTPSGLVPLHLRS---------------PQVPAAQQML------NFPEKNKEK------PVDLQNFGLRTDIYSKKTLAKS---KGASAG------------REWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLENSDASLGPLAYQPVPFSQSGNPVMSTVAFLASVVDPRVASAAAKAALEEFSRVREEVPLELVEAHVKKVQEAARASGKVDP-TYGLESSCIAGTGPDEPEK 772          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Human
Match: SMARCC2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily c member 2 [Source:HGNC Symbol;Acc:HGNC:11105])

HSP 1 Score: 436.032 bits (1120), Expect = 3.730e-131
Identity = 299/590 (50.68%), Postives = 376/590 (63.73%), Query Frame = 3
Query: 1350 FHADMSVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSL------GNQ--ASVVKSQSNNSAIDKQPTVTANPKDLSNSDN---VNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLEE--VAG--KDPIDKAKEGDXXXX----XXXXXXXXXXXXXDSSTSVKSETDNKVXXXXXXXXXXXXRMDS------SENQPAVVEENEIKVESKDEEMQEKPISNEEEIKI-FDKDSNXXXXXXXXXXXXXXXXXXXXYLAQSEEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIXXXXXXXXXXXXXXXXXXXAFHMELLKTVESRAR 3041
             H D +VTEQ H IIIPSY+AWFDYNS+H IERRALPEFF GKNKSK+ E+Y+AYRNFMIDTYRLNPQEYLT TACRRNL GDVC+I+RVHAFLEQWGLINYQVD E + T   +GPP TSHFHVL D+ +GL  L      G Q  A     +      D  P       +L  S +   +N   K  +       P+ + ++ L+TD Y      + +V   S            + ++EW++QETLLLLE LEMYKDDWNKV+EHVGSRTQ+ECIL+FLRLPIEDPYLE   A +  L YQPIPFS+SGNP+MSTVAFLAS VDPR+AS AAK+AL EFS++KEEVP  +V+ H  KV  A +     DP  +GLE   +AG   D  ++ +E  N E        + K   KE  +   +++ E   K       + E  +  DS      S+  P V  E E + +   EE+ ++ + +E E K   ++D     L+ AA+ ALAA+A KA++LA  EE+KIK LVA LVE Q+KK+E+KL+ F+ELE I++RE E LE QRQQLL DRQAFHME LK  E RAR
Sbjct:  412 LHED-NVTEQTHHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQVDAESRPTP--MGPPPTSHFHVLADTPSGLVPLQPKTPQGRQVDADTKAGRKGKELDDLVPETAKGKPELQTSASQQMLNFPDKGKEK------PTDMQNFGLRTDMY-----TKKNVPSKSKAAA--------SATREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLEDSEASLGPLAYQPIPFSQSGNPVMSTVAFLASVVDPRVASAAAKSALEEFSKMKEEVPTALVEAHVRKVEEAAKVTGKADP-AFGLESSGIAGTTSDEPERIEESGNDEARVEGQATDEKKEPKEPREGGGAIEEEAKEKTSEAPKKDEEKGKEGDSEKESEKSDGDPIVDPEKEKEPKEGQEEVLKEVVESEGERKTKVERDIGEGNLSTAAAAALAAAAVKAKHLAAVEERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREREALEYQRQQLLADRQAFHMEQLKYAEMRAR 978          

HSP 2 Score: 236.498 bits (602), Expect = 1.076e-62
Identity = 114/266 (42.86%), Postives = 165/266 (62.03%), Query Frame = 3
Query:   24 LFLKKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWI--SNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDF 815
            + ++KKDG PN ++YE  + +  FD VR WL +N KKY Q +P TNKSL++L  QLLQ+QEE FGK  +   + KLPI CF DFK GGSL HI +A  K+KSDQG RR+DFQ+PSR +RNVEMFM I+  L  + C  +P ++L P I  + + KL+   ++    + E+ N A+H+++P     L  ++  R VM+  + ++LHW   PDS+D WI  S I +    +P P         +  ++  +W+L T   NEWM+EED+
Sbjct:    1 MAVRKKDGGPNVKYYEAADTVTQFDNVRLWLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQEEVFGKHVSNAPLTKLPIKCFLDFKAGGSLCHILAAAYKFKSDQGWRRYDFQNPSRMDRNVEMFMTIEKSLVQNNCLSRPNIFLCPEIEPKLLGKLKDIIKRHQGTVTEDKNNASHVVYPVPGN-LEEEEWVRPVMKRDKQVLLHWGYYPDSYDTWIPASEIEASVEDAPTP--------EKPRKVHAKWILDTDTFNEWMNEEDY 257          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Celegans
Match: swsn-1 (SWI/SNF nucleosome remodeling complex component; SWI3-like protein [Source:UniProtKB/TrEMBL;Acc:G5EF87])

HSP 1 Score: 335.88 bits (860), Expect = 2.820e-99
Identity = 183/391 (46.80%), Postives = 239/391 (61.13%), Query Frame = 3
Query: 1356 ADMSVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDNVNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLE------------GDAA--LMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDP----DKYGL---EEVAG 2465
            A+ +V EQ H I++PSY+ WFDYN+IH IE+RA+PEFF GKNKSK+ +VY+AYRNFM+DTYRLNP EY++ TACRRNL GDVCSI+R+H+FLEQWGL+NYQVD + +    +     TSHF VL D+ TG+Q +                        NP     S   + +    +   E     SIS   L+ DQY      +  +   + G    PP       ++W++QET LLLE LEM+KDDWNKV +HVG+RTQ EC+L FL+LPI+DPYL             G AA  ++  L +QP+PFS+SGNP+MSTVAFLAS VDP++A+ A KAA+ EF +LKEE+P  + + H+  V    E    VD      K GL   EE AG
Sbjct:   72 AEGNVIEQTHYIVVPSYAGWFDYNAIHQIEKRAMPEFFNGKNKSKTPDVYVAYRNFMVDTYRLNPFEYVSATACRRNLAGDVCSIVRLHSFLEQWGLLNYQVDSDARPAPVAPP--PTSHFMVLADTPTGIQPM------------------------NPPG-KESAGASGEPPKEEIKTEI---ESISTPGLKIDQY-----QKQAIAMRTKGA---PPG------RDWTEQETCLLLEALEMFKDDWNKVCDHVGTRTQHECVLKFLQLPIQDPYLTENLSSDKAEAAPGGAAKEVLGPLAFQPVPFSQSGNPVMSTVAFLASVVDPQVAAAATKAAMEEFGKLKEEIPPLVAEAHEKNVAAMAEKTGQVDGAVGLTKSGLKPAEEAAG 418          

HSP 2 Score: 68.1662 bits (165), Expect = 3.659e-11
Identity = 46/80 (57.50%), Postives = 64/80 (80.00%), Query Frame = 3
Query: 2823 YLAQSEEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIXXXXXXXXXXXXXXXXXXXAFHMELLKTVESRARVVGHNQF 3062
            +LAQ EE++IK LVAQLVE Q+KK+E+KL+ F ELE I+++E E LE QR QL+L+RQAFHM+ LK +E+RA+   H++ 
Sbjct:  463 HLAQIEERRIKSLVAQLVETQMKKLEMKLRHFDELEQIMDKERESLEYQRHQLILERQAFHMDQLKYLENRAKHEAHSRM 542          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Celegans
Match: swsn-1 (SWI/SNF nucleosome remodeling complex component; SWI3-like protein [Source:UniProtKB/TrEMBL;Acc:G5EF87])

HSP 1 Score: 335.109 bits (858), Expect = 5.118e-99
Identity = 183/391 (46.80%), Postives = 239/391 (61.13%), Query Frame = 3
Query: 1356 ADMSVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDNVNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLE------------GDAA--LMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDP----DKYGL---EEVAG 2465
            A+ +V EQ H I++PSY+ WFDYN+IH IE+RA+PEFF GKNKSK+ +VY+AYRNFM+DTYRLNP EY++ TACRRNL GDVCSI+R+H+FLEQWGL+NYQVD + +    +     TSHF VL D+ TG+Q +                        NP     S   + +    +   E     SIS   L+ DQY      +  +   + G    PP       ++W++QET LLLE LEM+KDDWNKV +HVG+RTQ EC+L FL+LPI+DPYL             G AA  ++  L +QP+PFS+SGNP+MSTVAFLAS VDP++A+ A KAA+ EF +LKEE+P  + + H+  V    E    VD      K GL   EE AG
Sbjct:   72 AEGNVIEQTHYIVVPSYAGWFDYNAIHQIEKRAMPEFFNGKNKSKTPDVYVAYRNFMVDTYRLNPFEYVSATACRRNLAGDVCSIVRLHSFLEQWGLLNYQVDSDARPAPVAPP--PTSHFMVLADTPTGIQPM------------------------NPPG-KESAGASGEPPKEEIKTEI---ESISTPGLKIDQY-----QKQAIAMRTKGA---PPG------RDWTEQETCLLLEALEMFKDDWNKVCDHVGTRTQHECVLKFLQLPIQDPYLTENLSSDKAEAAPGGAAKEVLGPLAFQPVPFSQSGNPVMSTVAFLASVVDPQVAAAATKAAMEEFGKLKEEIPPLVAEAHEKNVAAMAEKTGQVDGAVGLTKSGLKPAEEAAG 418          

HSP 2 Score: 68.1662 bits (165), Expect = 3.666e-11
Identity = 46/80 (57.50%), Postives = 64/80 (80.00%), Query Frame = 3
Query: 2823 YLAQSEEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIXXXXXXXXXXXXXXXXXXXAFHMELLKTVESRARVVGHNQF 3062
            +LAQ EE++IK LVAQLVE Q+KK+E+KL+ F ELE I+++E E LE QR QL+L+RQAFHM+ LK +E+RA+   H++ 
Sbjct:  463 HLAQIEERRIKSLVAQLVETQMKKLEMKLRHFDELEQIMDKERESLEYQRHQLILERQAFHMDQLKYLENRAKHEAHSRM 542          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Celegans
Match: swsn-1 (SWI/SNF nucleosome remodeling complex component; SWI3-like protein [Source:UniProtKB/TrEMBL;Acc:G5EF87])

HSP 1 Score: 286.189 bits (731), Expect = 1.082e-82
Identity = 163/358 (45.53%), Postives = 212/358 (59.22%), Query Frame = 3
Query: 1455 LPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDNVNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLE------------GDAA--LMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDP----DKYGL---EEVAG 2465
            +PEFF GKNKSK+ +VY+AYRNFM+DTYRLNP EY++ TACRRNL GDVCSI+R+H+FLEQWGL+NYQVD + +    +     TSHF VL D+ TG+Q +                        NP     S   + +    +   E     SIS   L+ DQY      +  +   + G    PP       ++W++QET LLLE LEM+KDDWNKV +HVG+RTQ EC+L FL+LPI+DPYL             G AA  ++  L +QP+PFS+SGNP+MSTVAFLAS VDP++A+ A KAA+ EF +LKEE+P  + + H+  V    E    VD      K GL   EE AG
Sbjct:    1 MPEFFNGKNKSKTPDVYVAYRNFMVDTYRLNPFEYVSATACRRNLAGDVCSIVRLHSFLEQWGLLNYQVDSDARPAPVAPP--PTSHFMVLADTPTGIQPM------------------------NPPG-KESAGASGEPPKEEIKTEI---ESISTPGLKIDQY-----QKQAIAMRTKGA---PPG------RDWTEQETCLLLEALEMFKDDWNKVCDHVGTRTQHECVLKFLQLPIQDPYLTENLSSDKAEAAPGGAAKEVLGPLAFQPVPFSQSGNPVMSTVAFLASVVDPQVAAAATKAAMEEFGKLKEEIPPLVAEAHEKNVAAMAEKTGQVDGAVGLTKSGLKPAEEAAG 314          

HSP 2 Score: 68.1662 bits (165), Expect = 3.296e-11
Identity = 46/80 (57.50%), Postives = 64/80 (80.00%), Query Frame = 3
Query: 2823 YLAQSEEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIXXXXXXXXXXXXXXXXXXXAFHMELLKTVESRARVVGHNQF 3062
            +LAQ EE++IK LVAQLVE Q+KK+E+KL+ F ELE I+++E E LE QR QL+L+RQAFHM+ LK +E+RA+   H++ 
Sbjct:  359 HLAQIEERRIKSLVAQLVETQMKKLEMKLRHFDELEQIMDKERESLEYQRHQLILERQAFHMDQLKYLENRAKHEAHSRM 438          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Celegans
Match: swsn-1 (SWI/SNF nucleosome remodeling complex component; SWI3-like protein [Source:UniProtKB/TrEMBL;Acc:G5EF87])

HSP 1 Score: 286.189 bits (731), Expect = 1.082e-82
Identity = 163/358 (45.53%), Postives = 212/358 (59.22%), Query Frame = 3
Query: 1455 LPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDNVNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLE------------GDAA--LMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDP----DKYGL---EEVAG 2465
            +PEFF GKNKSK+ +VY+AYRNFM+DTYRLNP EY++ TACRRNL GDVCSI+R+H+FLEQWGL+NYQVD + +    +     TSHF VL D+ TG+Q +                        NP     S   + +    +   E     SIS   L+ DQY      +  +   + G    PP       ++W++QET LLLE LEM+KDDWNKV +HVG+RTQ EC+L FL+LPI+DPYL             G AA  ++  L +QP+PFS+SGNP+MSTVAFLAS VDP++A+ A KAA+ EF +LKEE+P  + + H+  V    E    VD      K GL   EE AG
Sbjct:    1 MPEFFNGKNKSKTPDVYVAYRNFMVDTYRLNPFEYVSATACRRNLAGDVCSIVRLHSFLEQWGLLNYQVDSDARPAPVAPP--PTSHFMVLADTPTGIQPM------------------------NPPG-KESAGASGEPPKEEIKTEI---ESISTPGLKIDQY-----QKQAIAMRTKGA---PPG------RDWTEQETCLLLEALEMFKDDWNKVCDHVGTRTQHECVLKFLQLPIQDPYLTENLSSDKAEAAPGGAAKEVLGPLAFQPVPFSQSGNPVMSTVAFLASVVDPQVAAAATKAAMEEFGKLKEEIPPLVAEAHEKNVAAMAEKTGQVDGAVGLTKSGLKPAEEAAG 314          

HSP 2 Score: 68.1662 bits (165), Expect = 3.296e-11
Identity = 46/80 (57.50%), Postives = 64/80 (80.00%), Query Frame = 3
Query: 2823 YLAQSEEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIXXXXXXXXXXXXXXXXXXXAFHMELLKTVESRARVVGHNQF 3062
            +LAQ EE++IK LVAQLVE Q+KK+E+KL+ F ELE I+++E E LE QR QL+L+RQAFHM+ LK +E+RA+   H++ 
Sbjct:  359 HLAQIEERRIKSLVAQLVETQMKKLEMKLRHFDELEQIMDKERESLEYQRHQLILERQAFHMDQLKYLENRAKHEAHSRM 438          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Celegans
Match: swsn-1 (SWI/SNF nucleosome remodeling complex component; SWI3-like protein [Source:UniProtKB/TrEMBL;Acc:G5EF87])

HSP 1 Score: 285.804 bits (730), Expect = 1.775e-82
Identity = 163/358 (45.53%), Postives = 212/358 (59.22%), Query Frame = 3
Query: 1455 LPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDNVNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYL------------EGDAA--LMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDP----DKYGL---EEVAG 2465
            +PEFF GKNKSK+ +VY+AYRNFM+DTYRLNP EY++ TACRRNL GDVCSI+R+H+FLEQWGL+NYQVD + +    +     TSHF VL D+ TG+Q +                        NP     S   + +    +   E     SIS   L+ DQY      +  +   + G    PP       ++W++QET LLLE LEM+KDDWNKV +HVG+RTQ EC+L FL+LPI+DPYL             G AA  ++  L +QP+PFS+SGNP+MSTVAFLAS VDP++A+ A KAA+ EF +LKEE+P  + + H+  V    E    VD      K GL   EE AG
Sbjct:    1 MPEFFNGKNKSKTPDVYVAYRNFMVDTYRLNPFEYVSATACRRNLAGDVCSIVRLHSFLEQWGLLNYQVDSDARPAPVAPP--PTSHFMVLADTPTGIQPM------------------------NPPG-KESAGASGEPPKEEIKTEI---ESISTPGLKIDQY-----QKQAIAMRTKGA---PPG------RDWTEQETCLLLEALEMFKDDWNKVCDHVGTRTQHECVLKFLQLPIQDPYLTENLSSDKAEAAPGGAAKEVLGPLAFQPVPFSQSGNPVMSTVAFLASVVDPQVAAAATKAAMEEFGKLKEEIPPLVAEAHEKNVAAMAEKTGQVDGAVGLTKSGLKPAEEAAG 314          

HSP 2 Score: 68.1662 bits (165), Expect = 3.509e-11
Identity = 46/80 (57.50%), Postives = 64/80 (80.00%), Query Frame = 3
Query: 2823 YLAQSEEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIXXXXXXXXXXXXXXXXXXXAFHMELLKTVESRARVVGHNQF 3062
            +LAQ EE++IK LVAQLVE Q+KK+E+KL+ F ELE I+++E E LE QR QL+L+RQAFHM+ LK +E+RA+   H++ 
Sbjct:  359 HLAQIEERRIKSLVAQLVETQMKKLEMKLRHFDELEQIMDKERESLEYQRHQLILERQAFHMDQLKYLENRAKHEAHSRM 438          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Fly
Match: mor (gene:FBgn0002783 transcript:FBtr0302550)

HSP 1 Score: 532.332 bits (1370), Expect = 4.358e-168
Identity = 336/830 (40.48%), Postives = 479/830 (57.71%), Query Frame = 3
Query:   36 KKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYW--QNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDF---QSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWISN---IPSDCTLSPE-PAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDFLLPGNQQEFAKQANRKPIISRKCYNGDDLNVMLNVSSQPSSVGXXXXXXXXXXXXXXXXXXXXXXXXNKEDNSGKRRKQNVVRAASLANLRKSKVKEXXXXXXXXXXXXXXXPECPNRVEEVPSNSLGRNT--PSRGASAAGNIDN---RNNVLYDLDEETQG--------SGXXXXXXXXXXXXXXXDESFHA----DM--SVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSA-----IDKQPTVTANPKDLSNSDNV-NLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGK 2423
            KKDG PN  F+++PE +  F+++R WL +NCKKY    ++P+T +SLA L    LQY E   GK + +    ++P+ CF DFK GG L  IFS   +++++Q  ++FDF   ++P+R + N+++ ++I+  L     +  P +++ P I      KLR       ++IV +  +ATH+++P        D+ AR + + G  +MLHW   P+S+D+W  N   +P     +PE PA R        W +   W++   + NEWM+EED+       E  +Q  +K    R     DD+    +   +P++        +    K K++R  SP+ S      GKR++   V      N    +    D  +          P  PN  E   +N+  ++T  P+ G  + G+ D    +   + DLD+E  G        +G   NS     + N   + F +    DM  +VTEQ H II+PSYSAWFDYNSIHVIE+RA+PEFF  KNKSK+ E+YMAYRNFMIDTYRLNP EYLT TACRRNL GDVC+I+RVHAFLEQWGLINYQ+D + + T   +GPP TSHFH+L+D+ +GLQS+  Q    K+Q  ++A     +DK+P       +L +   +  +++++ ++     + S +S + L+ DQY    + +     N T   +         ++EW+DQETLLLLEGLEM+KDDWNKV EHVGSRTQ+ECIL+FLRLPIEDPYLE D   +  L  QPIPFSKSGNPIMSTVAFLAS VDPR+A+ AAKAA+ EF+ +K+EVP  ++  H   V  A   GK
Sbjct:    7 KKDGSPNIDFFQSPETLQGFESIRQWLQKNCKKYLAHSSEPITKESLAQLLIHFLQYVEAKLGKNSADPPATRIPMRCFLDFKSGGGLCIIFSTMFRFRAEQRGKKFDFSIGKNPTRKDPNIQLLIEIEQALVEADLYRIPYIYIRPEIEKGFEGKLREILDNRRVEIVSDEEDATHIVYPVVDP--HPDEYARPIFKRGGHVMLHWYYFPESYDSWAVNNFDLPDHIPENPESPAER--------WRVSASWIVDLEQYNEWMAEEDY-------EVDEQGKKKTHKQRMSI--DDIMSFGDEKKKPAA--------SSGGGKQKRRRSPSPASSASTSKPGKRKRSPAVVHKKSRNDDDDEDLTRDLDDP---------PAEPNVQEVHKANAALQSTASPAPGGKSRGDNDMMPIKGGTMTDLDDEMTGGSAAQAMSTGDGENSQTGKTSDNSNTQEFSSSAKEDMEDNVTEQTHHIIVPSYSAWFDYNSIHVIEKRAMPEFFNSKNKSKTPEIYMAYRNFMIDTYRLNPTEYLTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQIDADVRPTP--MGPPPTSHFHILSDTPSGLQSINPQ----KTQQPSAAKTLLDLDKKPLGKDGGLELGDKSGLTGIKTEALENGAAGGLSSGVSQFGLKLDQY----AKKPAAMRNRTAASM---------AREWTDQETLLLLEGLEMHKDDWNKVCEHVGSRTQDECILHFLRLPIEDPYLEDDGGFLGPLACQPIPFSKSGNPIMSTVAFLASVVDPRVAAAAAKAAMEEFAAIKDEVPATIMDNHLKNVEKASAGGK 781          

HSP 2 Score: 65.4698 bits (158), Expect = 3.594e-10
Identity = 47/80 (58.75%), Postives = 60/80 (75.00%), Query Frame = 3
Query: 2823 YLAQSEEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIXXXXXXXXXXXXXXXXXXXAFHMELLKTVESRARVVGHNQF 3062
            +LA  EE+KIK LVA LVE Q+KK+E+KL+ F+ELEA +ERE E LE QRQQL+ +RQ FH+E LK  E RAR   H++ 
Sbjct:  899 HLAALEERKIKSLVALLVETQMKKLEIKLRHFEELEATMEREREGLEYQRQQLITERQQFHLEQLKAAEFRARQQAHHRL 978          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Fly
Match: mor (gene:FBgn0002783 transcript:FBtr0083238)

HSP 1 Score: 532.717 bits (1371), Expect = 1.181e-167
Identity = 336/830 (40.48%), Postives = 479/830 (57.71%), Query Frame = 3
Query:   36 KKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYW--QNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDF---QSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWISN---IPSDCTLSPE-PAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDFLLPGNQQEFAKQANRKPIISRKCYNGDDLNVMLNVSSQPSSVGXXXXXXXXXXXXXXXXXXXXXXXXNKEDNSGKRRKQNVVRAASLANLRKSKVKEXXXXXXXXXXXXXXXPECPNRVEEVPSNSLGRNT--PSRGASAAGNIDN---RNNVLYDLDEETQG--------SGXXXXXXXXXXXXXXXDESFHA----DM--SVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSA-----IDKQPTVTANPKDLSNSDNV-NLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGK 2423
            KKDG PN  F+++PE +  F+++R WL +NCKKY    ++P+T +SLA L    LQY E   GK + +    ++P+ CF DFK GG L  IFS   +++++Q  ++FDF   ++P+R + N+++ ++I+  L     +  P +++ P I      KLR       ++IV +  +ATH+++P        D+ AR + + G  +MLHW   P+S+D+W  N   +P     +PE PA R        W +   W++   + NEWM+EED+       E  +Q  +K    R     DD+    +   +P++        +    K K++R  SP+ S      GKR++   V      N    +    D  +          P  PN  E   +N+  ++T  P+ G  + G+ D    +   + DLD+E  G        +G   NS     + N   + F +    DM  +VTEQ H II+PSYSAWFDYNSIHVIE+RA+PEFF  KNKSK+ E+YMAYRNFMIDTYRLNP EYLT TACRRNL GDVC+I+RVHAFLEQWGLINYQ+D + + T   +GPP TSHFH+L+D+ +GLQS+  Q    K+Q  ++A     +DK+P       +L +   +  +++++ ++     + S +S + L+ DQY    + +     N T   +         ++EW+DQETLLLLEGLEM+KDDWNKV EHVGSRTQ+ECIL+FLRLPIEDPYLE D   +  L  QPIPFSKSGNPIMSTVAFLAS VDPR+A+ AAKAA+ EF+ +K+EVP  ++  H   V  A   GK
Sbjct:    7 KKDGSPNIDFFQSPETLQGFESIRQWLQKNCKKYLAHSSEPITKESLAQLLIHFLQYVEAKLGKNSADPPATRIPMRCFLDFKSGGGLCIIFSTMFRFRAEQRGKKFDFSIGKNPTRKDPNIQLLIEIEQALVEADLYRIPYIYIRPEIEKGFEGKLREILDNRRVEIVSDEEDATHIVYPVVDP--HPDEYARPIFKRGGHVMLHWYYFPESYDSWAVNNFDLPDHIPENPESPAER--------WRVSASWIVDLEQYNEWMAEEDY-------EVDEQGKKKTHKQRMSI--DDIMSFGDEKKKPAA--------SSGGGKQKRRRSPSPASSASTSKPGKRKRSPAVVHKKSRNDDDDEDLTRDLDDP---------PAEPNVQEVHKANAALQSTASPAPGGKSRGDNDMMPIKGGTMTDLDDEMTGGSAAQAMSTGDGENSQTGKTSDNSNTQEFSSSAKEDMEDNVTEQTHHIIVPSYSAWFDYNSIHVIEKRAMPEFFNSKNKSKTPEIYMAYRNFMIDTYRLNPTEYLTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQIDADVRPTP--MGPPPTSHFHILSDTPSGLQSINPQ----KTQQPSAAKTLLDLDKKPLGKDGGLELGDKSGLTGIKTEALENGAAGGLSSGVSQFGLKLDQY----AKKPAAMRNRTAASM---------AREWTDQETLLLLEGLEMHKDDWNKVCEHVGSRTQDECILHFLRLPIEDPYLEDDGGFLGPLACQPIPFSKSGNPIMSTVAFLASVVDPRVAAAAAKAAMEEFAAIKDEVPATIMDNHLKNVEKASAGGK 781          

HSP 2 Score: 65.4698 bits (158), Expect = 3.217e-10
Identity = 47/80 (58.75%), Postives = 60/80 (75.00%), Query Frame = 3
Query: 2823 YLAQSEEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIXXXXXXXXXXXXXXXXXXXAFHMELLKTVESRARVVGHNQF 3062
            +LA  EE+KIK LVA LVE Q+KK+E+KL+ F+ELEA +ERE E LE QRQQL+ +RQ FH+E LK  E RAR   H++ 
Sbjct:  963 HLAALEERKIKSLVALLVETQMKKLEIKLRHFEELEATMEREREGLEYQRQQLITERQQFHLEQLKAAEFRARQQAHHRL 1042          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Zebrafish
Match: smarcc1a (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1a [Source:ZFIN;Acc:ZDB-GENE-080514-3])

HSP 1 Score: 559.296 bits (1440), Expect = 7.390e-179
Identity = 335/823 (40.70%), Postives = 477/823 (57.96%), Query Frame = 3
Query:   33 KKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWISNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDFLLPGNQQEFAKQANRKPIISR-KCYNGDDLNVMLNVSSQPSSVGXXXXXXXXXXXXXXXXXXXXXXXXNKEDNSGKRRKQNVVRAASLANLRKSKVK---------EXXXXXXXXXXXXXXXPECPNRVEEVPSNSLGRNTPSRGASAAGNIDNRNNVLYDLDEETQGSGXXXXXXXXXXXXXXXDESFHADMSVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDNVNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLEE--VAG 2465
            +KKDG P+ +++E+ E ++  +TVR W+ ++ KK+ Q D  T+K+LA L  QLLQ+QE+ FG+  +  ++ KLP   F DFKPGG+L HI  +  K+KS+QG RRFD Q+PSR +RNVEMFM I+  L  +    +PIV++   +  +   KL+   ++    I E+ ++ATH+++P  ++ +  ++  R VMR+ + +++HW   PDS+D W+S    D  +   P+      S + W +  +W++ T   NEWM+EED+ +           N+KP+  R + + G+      +VSS+                              K   +GK+R+++    ++    RK   K              +D+       D E P+ V  +   +L +N   +  S   N   +  +  DLD++   S  +        +    +    ++ +VTEQ H IIIPSY+AWFDYNSIH IERRALPEFF GKNKSK+ E+Y+AYRNFMIDTYRLNPQEYLT T+CRRNLTGDVC+++RVHAFLEQWGL+NYQVD E +     +GPP TSHF+VL D+ +GL  L ++                      P+       +N   K  D       P+ + ++ L+TD Y    S ++   + + GG            ++W++QETLLLLE LEMYKDDWNKV+EHVGSRTQ+ECIL+FLRLPIED YLE   A +  L YQPIPFS+SGNP+MSTVAFLAS VDPR+A+ AAKAAL+EFSR++EEVP  +V+ H  KV  A  S   VDP  +GLE   +AG
Sbjct:   29 RKKDGGPSSKYWESSETVSQLETVRLWIGKHYKKHVQTDSPTSKTLAALVVQLLQFQEDAFGRRVSNPALTKLPAKSFLDFKPGGALCHILGSAYKFKSEQGWRRFDLQNPSRMDRNVEMFMTIEKTLVQNNSLTRPIVYIVSDVEQKQANKLKDIIKRHQGTITEDKSKATHIIYPSPTQ-MEEEEWLRPVMRKDKQVLVHWGYYPDSYDIWVSTSDVDADVEDPPS------SEKPWRVHAKWVIDTDAFNEWMNEEDYEV---------DENKKPVSFRQRIFPGE------DVSSR-----------------------TPDRKERKSLVAGKKRRRSPSPPSTPVESRKKGKKGNPGSQWRRRGQPIDDEQDEDSTKDLEDPSPVPGMEEVTLPKNVNQKKDSE--NTPVKGGIHNDLDDQEDDSVTSGGKEDDEQSKAEVNRLIDSEDNVTEQTHHIIIPSYAAWFDYNSIHEIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTSCRRNLTGDVCAVMRVHAFLEQWGLVNYQVDAESRPLP--MGPPPTSHFNVLADTPSGLVPLHHRP---------------------PQVPPAQQMLNFPEKGKDK------PTDLQNFGLRTDIY----SKKNLKGKGAAGG------------RDWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDQYLESSDASLGPLAYQPIPFSQSGNPVMSTVAFLASVVDPRVAAAAAKAALDEFSRVREEVPAELVEAHVKKVQEAARSTGKVDP-AFGLESSGIAG 758          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Zebrafish
Match: smarcc2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 [Source:ZFIN;Acc:ZDB-GENE-100728-1])

HSP 1 Score: 434.876 bits (1117), Expect = 8.379e-133
Identity = 293/575 (50.96%), Postives = 370/575 (64.35%), Query Frame = 3
Query: 1350 FHADMSVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDNVNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLE--EVAG------KDPIDKAKEGDXXXXXXXXXXXXXXXXXDSSTSVKSET---DNKVXXXXXXXXXXXXRMDSSENQPAVVEENEIKVESKDEEMQEKPISNEEEIKIFDKDSNXXXXXXXXXXXXXXXXXXXXYLAQSEEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIXXXXXXXXXXXXXXXXXXXAFHMELLKTVESRAR 3041
             H D +VTEQ H IIIPSY+AWFDYNS+H IERRALPEFF GKNKSK+ E+Y+AYRNFMIDTYRLNPQEYLT TACRRNL GDVC+I+RVHAFLEQWGLINYQVD E + T   +GPP TSHFHVL D+ + L  L  +AS  ++ S+   +     V   P DL N                         + L+TD Y    S +S   +N             + ++EW+DQETLLLLEGLEMYKDDWNKV+EHVGSRTQ+ECIL+FLRLPIEDPYLE  +A +  L YQP+PFS++GNP+MSTVAFLAS VDPR+AS AAK+AL EFSR+KEEVP  +V+ H  +V  A  +    DP  YGLE   +AG        P D   E +   E +   +    +      S + E    + K E E   E E     + ++++ A  E+ + + E  +E  ++     E++ K+ ++D     LA AA+ ALAA+A KA++LA  EE+KIK LVA LVE Q+KK+E+KL+ F+ELE I++RE E LE QRQQLL DRQ+FHME LK  E RAR
Sbjct:  410 LHED-NVTEQTHHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQVDSESRPTP--MGPPPTSHFHVLADTPSSLVPLQPKAS--QTSSSQQMLSFPEKVKDKPADLQN-------------------------FGLRTDVY----SKKSGPAKNKNAA---------SATREWTDQETLLLLEGLEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLEDSSASLGPLAYQPVPFSQAGNPVMSTVAFLASVVDPRVASAAAKSALEEFSRMKEEVPAALVEAHVRRVEEAARASGRQDP-LYGLEGSGIAGTGLEDSDKPSDDGGEENKSSEGQPSQEKRDSKESKDGASEEEEKQGENGKKEEERAREVETERETEKTDSEMADGEKEKERKEGSEEAQRDGETEGEKKAKV-ERDVGEGNLATAAASALAAAAVKAKHLAAVEERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREREALEYQRQQLLADRQSFHMEQLKYAEMRAR 939          

HSP 2 Score: 230.335 bits (586), Expect = 2.349e-61
Identity = 107/264 (40.53%), Postives = 167/264 (63.26%), Query Frame = 3
Query:   24 LFLKKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWISNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDF 815
            + ++KKDG PN +++E  + ++ FD VR WL +N KKY Q +P TNKSL++L  QLLQ+QEE FG+  +   + KLP+ CF DFK GG+L HI +A  K+KSDQG RRFDFQ+PSR +RNVEMFM I+  L  + C  +P+++LS  I  + + KL+   ++    + E+   ++H++ P  +  L +++  R VM+  + ++LHW   PDS+D WIS    +  +   PA      + +  ++  +W+L   + NEWM+EED+
Sbjct:    1 MAVRKKDGGPNVKYFEASDTVSQFDNVRVWLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQEEVFGRHVSNPPLTKLPVKCFLDFKAGGALCHILAAAYKFKSDQGWRRFDFQNPSRMDRNVEMFMTIEKSLVQNNCLSRPVIYLSSEIEPKLLGKLKDIIKRHQGSVTEDKLSSSHVVVPIPAS-LEDEEWVRPVMKRDKQMLLHWGYWPDSYDTWISASEVEAAVEDPPA------AEKPRKVHAKWILDLDQFNEWMNEEDY 257          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Zebrafish
Match: BX548005.1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 [Source:NCBI gene;Acc:567476])

HSP 1 Score: 430.254 bits (1105), Expect = 4.534e-131
Identity = 293/576 (50.87%), Postives = 370/576 (64.24%), Query Frame = 3
Query: 1350 FHADMSVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILR-VHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDNVNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLE--EVAG------KDPIDKAKEGDXXXXXXXXXXXXXXXXXDSSTSVKSET---DNKVXXXXXXXXXXXXRMDSSENQPAVVEENEIKVESKDEEMQEKPISNEEEIKIFDKDSNXXXXXXXXXXXXXXXXXXXXYLAQSEEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIXXXXXXXXXXXXXXXXXXXAFHMELLKTVESRAR 3041
             H D +VTEQ H IIIPSY+AWFDYNS+H IERRALPEFF GKNKSK+ E+Y+AYRNFMIDTYRLNPQEYLT TACRRNL GDVC+I+R VHAFLEQWGLINYQVD E + T   +GPP TSHFHVL D+ + L  L  +AS  ++ S+   +     V   P DL N                         + L+TD Y    S +S   +N             + ++EW+DQETLLLLEGLEMYKDDWNKV+EHVGSRTQ+ECIL+FLRLPIEDPYLE  +A +  L YQP+PFS++GNP+MSTVAFLAS VDPR+AS AAK+AL EFSR+KEEVP  +V+ H  +V  A  +    DP  YGLE   +AG        P D   E +   E +   +    +      S + E    + K E E   E E     + ++++ A  E+ + + E  +E  ++     E++ K+ ++D     LA AA+ ALAA+A KA++LA  EE+KIK LVA LVE Q+KK+E+KL+ F+ELE I++RE E LE QRQQLL DRQ+FHME LK  E RAR
Sbjct:  410 LHED-NVTEQTHHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLAGDVCAIMRFVHAFLEQWGLINYQVDSESRPTP--MGPPPTSHFHVLADTPSSLVPLQPKAS--QTSSSQQMLSFPEKVKDKPADLQN-------------------------FGLRTDVY----SKKSGPAKNKNAA---------SATREWTDQETLLLLEGLEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLEDSSASLGPLAYQPVPFSQAGNPVMSTVAFLASVVDPRVASAAAKSALEEFSRMKEEVPAALVEAHVRRVEEAARASGRQDP-LYGLEGSGIAGTGLEDSDKPSDDGGEENKSSEGQPSQEKRDSKESKDGASEEEEKQGENGKKEEERAREVETERETEKTDSEMADGEKEKERKEGSEEAQRDGETEGEKKAKV-ERDVGEGNLATAAASALAAAAVKAKHLAAVEERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREREALEYQRQQLLADRQSFHMEQLKYAEMRAR 940          

HSP 2 Score: 230.335 bits (586), Expect = 2.610e-61
Identity = 107/264 (40.53%), Postives = 167/264 (63.26%), Query Frame = 3
Query:   24 LFLKKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWISNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDF 815
            + ++KKDG PN +++E  + ++ FD VR WL +N KKY Q +P TNKSL++L  QLLQ+QEE FG+  +   + KLP+ CF DFK GG+L HI +A  K+KSDQG RRFDFQ+PSR +RNVEMFM I+  L  + C  +P+++LS  I  + + KL+   ++    + E+   ++H++ P  +  L +++  R VM+  + ++LHW   PDS+D WIS    +  +   PA      + +  ++  +W+L   + NEWM+EED+
Sbjct:    1 MAVRKKDGGPNVKYFEASDTVSQFDNVRVWLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQEEVFGRHVSNPPLTKLPVKCFLDFKAGGALCHILAAAYKFKSDQGWRRFDFQNPSRMDRNVEMFMTIEKSLVQNNCLSRPVIYLSSEIEPKLLGKLKDIIKRHQGSVTEDKLSSSHVVVPIPAS-LEDEEWVRPVMKRDKQMLLHWGYWPDSYDTWISASEVEAAVEDPPA------AEKPRKVHAKWILDLDQFNEWMNEEDY 257          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Zebrafish
Match: smarcc1b (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1b [Source:ZFIN;Acc:ZDB-GENE-060503-273])

HSP 1 Score: 325.865 bits (834), Expect = 5.646e-94
Identity = 197/393 (50.13%), Postives = 249/393 (63.36%), Query Frame = 3
Query: 1203 NTPSRGASAAGNIDNRNNVLYDL-DEETQ---GSGXXXXXXXXXXXXXXXDESFHADMSVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDN-VNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVP 2366
            NTP +G   A   D   ++L  + DEE Q   G G                     + S TEQ H II+P+Y++WFDYN IH IERRALPEFF GKNKSK+ E+Y+AYRNFMIDTYRLNPQEYLT T+ RRNLTGDVC+++RVH+FLEQWGLINYQVD E +          T HF+VLTD+ +GL  L ++                      P  +S S + ++   KS +       PS + ++ L++D Y    + +   ++ ++ G            +EW++QETLLLLE LEMYKDDWNKV+EHVGSRTQ++CIL+FLRLPIEDPYLE   A M  L YQP+PFS+SGNP+MSTVAFLAS VD R+AS AAKAAL EFSR +E+ P
Sbjct:  375 NTPVKGGIMADLDDQEEDLLAGVRDEEEQREFGRG------------------MEGEESATEQTHHIIVPTYASWFDYNCIHQIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTSSRRNLTGDVCALIRVHSFLEQWGLINYQVDAESRPLPMGPP--PTPHFNVLTDAPSGLVPLQHR----------------------PLQVSASQHMLHFPEKSREK------PSDLQNFGLRSDIY----AKKHPKSKGASAG------------REWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDDCILHFLRLPIEDPYLENSEASMGPLAYQPVPFSQSGNPVMSTVAFLASVVDSRVASAAAKAALEEFSRAREDAP 703          

HSP 2 Score: 196.823 bits (499), Expect = 7.432e-51
Identity = 102/277 (36.82%), Postives = 165/277 (59.57%), Query Frame = 3
Query:   33 KKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWI--SNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDFLLP--GNQQEFAKQ 851
            +K DG P  +++ENPEI++  +TVR+W+ ++ KK  Q+D  + KSL  L  QLLQ+QE++FG+  N+ +  KLP  CF D +PGG+L HI  +  K+K++QG RRFD Q+PSR +RN EM   ++  L  +    +P+V+LSP +  +   KL+    + +  + E+ + ATH ++P  S     ++  R VMR  + +M+HW   PDS+D+ I  S++ +D    P P        ++  ++  RW+L T   NEWM+EED+ +   GN   F ++
Sbjct:   26 RKMDGGPCCKYWENPEIMSQMETVRSWIGKHYKKNVQSDAPSCKSLTGLVIQLLQFQEDSFGRRANKPNFTKLPAKCFQDLRPGGALCHILGSVYKFKTEQGWRRFDLQNPSRLDRNTEMLGCVEKTLMQNNLLSRPVVYLSPDLEQKQTSKLKDIILRHNGTVTEDKSLATHQIYP--SSTTDEEEWFRPVMRLDQQVMVHWGMCPDSYDSLISASDVDADVEEPPNP--------DRCLKVSSRWVLDTDTYNEWMNEEDYEIDENGNSLRFRRR 292          

HSP 3 Score: 63.1586 bits (152), Expect = 1.965e-9
Identity = 51/100 (51.00%), Postives = 65/100 (65.00%), Query Frame = 3
Query: 2823 YLAQSEEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIXXXXXXXXXXXXXXXXXXXAFHMELLKTVESRAR----------VVGHNQFHPINNINHQG 3092
            +LA  EE+KIK LVA LVE Q+KK+E+KL+ F+ELE I++RE E LEQQRQQLL +RQ FH+E +K  E + R            G +Q  P  N  HQG
Sbjct:  837 HLAAVEERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREKEALEQQRQQLLSERQTFHLEQVKYAEQKVRQNVEQQQPQQQTGGSQSSPTFNPLHQG 936          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Zebrafish
Match: mysm1 (Myb-like, SWIRM and MPN domains 1 [Source:NCBI gene;Acc:561225])

HSP 1 Score: 65.0846 bits (157), Expect = 5.954e-10
Identity = 36/92 (39.13%), Postives = 53/92 (57.61%), Query Frame = 3
Query: 1398 PSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNL--TGDVCSILRVHAFLEQWGLINYQVDQ 1667
            P      D N+I   E++A+ EFF G+  SK+ E Y+  RN+++D +R +  +YL  T+ R  L   GDV  I R+H +LE  G IN+  DQ
Sbjct:  316 PEQEVELDLNTITEEEKQAISEFFEGR-PSKTPERYLKIRNYILDQWRRSKPKYLNKTSVRPGLKNCGDVNCIGRIHTYLELIGAINFNCDQ 406          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Xenopus
Match: SMARCC2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily c member 2 [Source:NCBI gene;Acc:100101794])

HSP 1 Score: 608.216 bits (1567), Expect = 0.000e+0
Identity = 363/833 (43.58%), Postives = 481/833 (57.74%), Query Frame = 3
Query:   24 LFLKKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWISNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDFLLPGNQQEFAKQANRKPIISRKCYNGDDLNVMLNVSSQPSSVGXXXXXXXXXXXXXXXXXXXXXXXXNKEDNSGKRR-----------KQNVVRAASLANLRKSKVKEXXXXXXXXXXXXXXXPECPNRVEEVPSNSLGRNTPSRGASAAGNIDNRNNVLYDLDEETQGSGXXXXXXXXXXXXXXXDE-----SFHADMSVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDN-VNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLEE--VAG 2465
            + ++KKDG PN +FYE  + +A FD VR WL +N KKY Q +P TNKSL++L  QLLQ+QEE FGK  +   + KLP+ CF DFK  G+LSHI +A  K+KSDQG RRFDFQ+PSR +RNVEMFM I+  L  + C  +P ++L P I ++   KL+   ++    + E+ + A+H++ P  S  L +++  R +++  + ++LHW   PDS+D W+     + ++   P +       +  ++  +W+L T   NEWM+EED+       E   + N  P+  RK  +   L    +  S P S                           K  N  KR+           K+  V+        KSK    ++ ++D      +    PN VEEV   +L +   ++  S +  I  +   + DLDE+   S           +S I  E       H D +VTEQ H IIIPSY+AWFDYNS+H IERRALPEFF GKNKSK+ E+Y+AYRNFMIDTYRLNPQEYLT TACRRNL GDVC+I+RVHAFLEQWGLINYQVD E + T   +GPP TSHFHVL D+ +GL  L                  QP     P+  S S   +N   KS D       PS + ++ L+TD Y     ++ +    S            + ++EW++QETLLLLE LEMYKDDWNKV+EHVGSRTQ+ECIL+FLRLPIEDPYLE   A +  L YQPIPFS+SGNP+MSTVAFLAS VDPR+AS AAK+AL+EFS++KEEVP  +V+ H  KV  A       DP  YGLE   +AG
Sbjct:    1 MAVRKKDGGPNVKFYEASDTVAQFDNVRLWLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQEEVFGKHVSNAPLTKLPMKCFLDFKVSGALSHILAAAYKFKSDQGWRRFDFQNPSRMDRNVEMFMTIEKSLVQNNCLSRPNIYLHPDIDSKLQSKLKDIVKRHQGTVTEDKSHASHIVVPVPSN-LEDEEWVRPILKRDKQVLLHWGYYPDSYDTWVPASEVEASVEDAPTV------EKPRKVHAKWILDTDSFNEWMNEEDY-------ELTDEKN--PVARRKKISAKTLT---DEVSSPDS----------------------DRRDKKGPNYKKRKRSPSPPPSAEAKKKTVKKGPSTPYTKSKRGHREEEQEDLTKDMDEPSPVPN-VEEV---TLPKTVNTKKDSESAPI--KGGTVTDLDEQEDESMDAVTKEEDETSSGIKGEQMKTSDLHED-NVTEQTHHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQVDAESRPTP--MGPPPTSHFHVLADTPSGLVPL------------------QPKT---PQQSSASQQMLNFPDKSKDK------PSDLQNFGLRTDMY-----SKKNTTSKSKAAA--------SATREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLEDSEASLGPLAYQPIPFSQSGNPVMSTVAFLASVVDPRVASAAAKSALDEFSKMKEEVPTALVEAHVRKVEDAARITGKADP-SYGLESSGIAG 742          

HSP 2 Score: 61.2326 bits (147), Expect = 1.128e-8
Identity = 46/68 (67.65%), Postives = 54/68 (79.41%), Query Frame = 3
Query: 2838 EEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIXXXXXXXXXXXXXXXXXXXAFHMELLKTVESRAR 3041
            EE+KIK LVA LVE Q+KK+E+KL+ F+ELE I++RE E LE QRQQLL DRQ FHME LK  E RAR
Sbjct:  885 EERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREREALEYQRQQLLADRQNFHMEQLKYAEIRAR 952          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Xenopus
Match: SMARCC2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily c member 2 [Source:NCBI gene;Acc:100101794])

HSP 1 Score: 607.831 bits (1566), Expect = 0.000e+0
Identity = 363/833 (43.58%), Postives = 481/833 (57.74%), Query Frame = 3
Query:   24 LFLKKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWISNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDFLLPGNQQEFAKQANRKPIISRKCYNGDDLNVMLNVSSQPSSVGXXXXXXXXXXXXXXXXXXXXXXXXNKEDNSGKRR-----------KQNVVRAASLANLRKSKVKEXXXXXXXXXXXXXXXPECPNRVEEVPSNSLGRNTPSRGASAAGNIDNRNNVLYDLDEETQGSGXXXXXXXXXXXXXXXDE-----SFHADMSVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDN-VNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLEE--VAG 2465
            + ++KKDG PN +FYE  + +A FD VR WL +N KKY Q +P TNKSL++L  QLLQ+QEE FGK  +   + KLP+ CF DFK  G+LSHI +A  K+KSDQG RRFDFQ+PSR +RNVEMFM I+  L  + C  +P ++L P I ++   KL+   ++    + E+ + A+H++ P  S  L +++  R +++  + ++LHW   PDS+D W+     + ++   P +       +  ++  +W+L T   NEWM+EED+       E   + N  P+  RK  +   L    +  S P S                           K  N  KR+           K+  V+        KSK    ++ ++D      +    PN VEEV   +L +   ++  S +  I  +   + DLDE+   S           +S I  E       H D +VTEQ H IIIPSY+AWFDYNS+H IERRALPEFF GKNKSK+ E+Y+AYRNFMIDTYRLNPQEYLT TACRRNL GDVC+I+RVHAFLEQWGLINYQVD E + T   +GPP TSHFHVL D+ +GL  L                  QP     P+  S S   +N   KS D       PS + ++ L+TD Y     ++ +    S            + ++EW++QETLLLLE LEMYKDDWNKV+EHVGSRTQ+ECIL+FLRLPIEDPYLE   A +  L YQPIPFS+SGNP+MSTVAFLAS VDPR+AS AAK+AL+EFS++KEEVP  +V+ H  KV  A       DP  YGLE   +AG
Sbjct:    1 MAVRKKDGGPNVKFYEASDTVAQFDNVRLWLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQEEVFGKHVSNAPLTKLPMKCFLDFKVSGALSHILAAAYKFKSDQGWRRFDFQNPSRMDRNVEMFMTIEKSLVQNNCLSRPNIYLHPDIDSKLQSKLKDIVKRHQGTVTEDKSHASHIVVPVPSN-LEDEEWVRPILKRDKQVLLHWGYYPDSYDTWVPASEVEASVEDAPTVE------KPRKVHAKWILDTDSFNEWMNEEDY-------ELTDEKN--PVARRKKISAKTLT---DEVSSPDS----------------------DRRDKKGPNYKKRKRSPSPPPSAEAKKKTVKKGPSTPYTKSKRGHREEEQEDLTKDMDEPSPVPN-VEEV---TLPKTVNTKKDSESAPI--KGGTVTDLDEQEDESMDAVTKEEDETSSGIKGEQMKTSDLHED-NVTEQTHHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQVDAESRPTP--MGPPPTSHFHVLADTPSGLVPL------------------QPKT---PQQSSASQQMLNFPDKSKDK------PSDLQNFGLRTDMY-----SKKNTTSKSKAAA--------SATREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLEDSEASLGPLAYQPIPFSQSGNPVMSTVAFLASVVDPRVASAAAKSALDEFSKMKEEVPTALVEAHVRKVEDAARITGKADP-SYGLESSGIAG 742          

HSP 2 Score: 61.6178 bits (148), Expect = 1.056e-8
Identity = 46/68 (67.65%), Postives = 54/68 (79.41%), Query Frame = 3
Query: 2838 EEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIXXXXXXXXXXXXXXXXXXXAFHMELLKTVESRAR 3041
            EE+KIK LVA LVE Q+KK+E+KL+ F+ELE I++RE E LE QRQQLL DRQ FHME LK  E RAR
Sbjct:  885 EERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREREALEYQRQQLLADRQNFHMEQLKYAEIRAR 952          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Xenopus
Match: SMARCC2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily c member 2 [Source:NCBI gene;Acc:100101794])

HSP 1 Score: 605.52 bits (1560), Expect = 0.000e+0
Identity = 361/837 (43.13%), Postives = 487/837 (58.18%), Query Frame = 3
Query:   24 LFLKKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWISNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDFLLPGNQQEFAKQANRKPIISRKCYNGDDLNVMLNVSSQPSSVGXXXXXXXXXXXXXXXXXXXXXXXXNKEDNSGKRR-----------KQNVVRAASLANLRKSKVKEXXXXXXXXXXXXXXXPECPNRVEEVPSNSLGRNTPSRGASAAGNIDNRNNVLYDLDEETQGSGXXXXXXXXXXXXXXXDE-----SFHADMSVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVK-----SQSNNSAIDKQPTVTANPKDLSNSDNVNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLEE--VAG 2465
            + ++KKDG PN +FYE  + +A FD VR WL +N KKY Q +P TNKSL++L  QLLQ+QEE FGK  +   + KLP+ CF DFK  G+LSHI +A  K+KSDQG RRFDFQ+PSR +RNVEMFM I+  L  + C  +P ++L P I ++   KL+   ++    + E+ + A+H++ P  S  L +++  R +++  + ++LHW   PDS+D W+     + ++   P +       +  ++  +W+L T   NEWM+EED+ L   +   A+   RK I ++          + +  S P S                           K  N  KR+           K+  V+        KSK    ++ ++D      +    PN VEEV   +L +   ++  S +  I  +   + DLDE+   S           +S I  E       H D +VTEQ H IIIPSY+AWFDYNS+H IERRALPEFF GKNKSK+ E+Y+AYRNFMIDTYRLNPQEYLT TACRRNL GDVC+I+RVHAFLEQWGLINYQVD E + T   +GPP TSHFHVL D+ +GL  L  +   V       +S+ S+  +Q               +N   KS D       PS + ++ L+TD Y    S ++  +++             + ++EW++QETLLLLE LEMYKDDWNKV+EHVGSRTQ+ECIL+FLRLPIEDPYLE   A +  L YQPIPFS+SGNP+MSTVAFLAS VDPR+AS AAK+AL+EFS++KEEVP  +V+ H  KV  A       DP  YGLE   +AG
Sbjct:    1 MAVRKKDGGPNVKFYEASDTVAQFDNVRLWLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQEEVFGKHVSNAPLTKLPMKCFLDFKVSGALSHILAAAYKFKSDQGWRRFDFQNPSRMDRNVEMFMTIEKSLVQNNCLSRPNIYLHPDIDSKLQSKLKDIVKRHQGTVTEDKSHASHIVVPVPSN-LEDEEWVRPILKRDKQVLLHWGYYPDSYDTWVPASEVEASVEDAPTV------EKPRKVHAKWILDTDSFNEWMNEEDYELTDEKNPVAR---RKKISAK---------TLTDEVSSPDS----------------------DRRDKKGPNYKKRKRSPSPPPSAEAKKKTVKKGPSTPYTKSKRGHREEEQEDLTKDMDEPSPVPN-VEEV---TLPKTVNTKKDSESAPI--KGGTVTDLDEQEDESMDAVTKEEDETSSGIKGEQMKTSDLHED-NVTEQTHHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQVDAESRPTP--MGPPPTSHFHVLADTPSGLVPLQPKTPQVGMTREMPESHQSSASQQ--------------MLNFPDKSKDK------PSDLQNFGLRTDMY----SKKNTTSKSKAAA---------SATREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLEDSEASLGPLAYQPIPFSQSGNPVMSTVAFLASVVDPRVASAAAKSALDEFSKMKEEVPTALVEAHVRKVEDAARITGKADP-SYGLESSGIAG 753          

HSP 2 Score: 61.2326 bits (147), Expect = 1.168e-8
Identity = 46/68 (67.65%), Postives = 54/68 (79.41%), Query Frame = 3
Query: 2838 EEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIXXXXXXXXXXXXXXXXXXXAFHMELLKTVESRAR 3041
            EE+KIK LVA LVE Q+KK+E+KL+ F+ELE I++RE E LE QRQQLL DRQ FHME LK  E RAR
Sbjct:  892 EERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREREALEYQRQQLLADRQNFHMEQLKYAEIRAR 959          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Xenopus
Match: SMARCC2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily c member 2 [Source:NCBI gene;Acc:100101794])

HSP 1 Score: 605.52 bits (1560), Expect = 0.000e+0
Identity = 361/832 (43.39%), Postives = 483/832 (58.05%), Query Frame = 3
Query:   24 LFLKKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWISNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDFLLPGNQQEFAKQANRKPIISRKCYNGDDLNVMLNVSSQPSSVGXXXXXXXXXXXXXXXXXXXXXXXXNKEDNSGKRR-----------KQNVVRAASLANLRKSKVKEXXXXXXXXXXXXXXXPECPNRVEEVPSNSLGRNTPSRGASAAGNIDNRNNVLYDLDEETQGSGXXXXXXXXXXXXXXXDE-----SFHADMSVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDNVNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLEE--VAG 2465
            + ++KKDG PN +FYE  + +A FD VR WL +N KKY Q +P TNKSL++L  QLLQ+QEE FGK  +   + KLP+ CF DFK  G+LSHI +A  K+KSDQG RRFDFQ+PSR +RNVEMFM I+  L  + C  +P ++L P I ++   KL+   ++    + E+ + A+H++ P  S  L +++  R +++  + ++LHW   PDS+D W+     + ++   P +       +  ++  +W+L T   NEWM+EED+       E   + N  P+  RK  +   L    +  S P S                           K  N  KR+           K+  V+        KSK    ++ ++D      +    PN VEEV   +L +   ++  S +  I  +   + DLDE+   S           +S I  E       H D +VTEQ H IIIPSY+AWFDYNS+H IERRALPEFF GKNKSK+ E+Y+AYRNFMIDTYRLNPQEYLT TACRRNL GDVC+I+RVHAFLEQWGLINYQVD E + T   +GPP TSHFHVL D+ +GL  L                  QP     P+  ++   +N   KS D       PS + ++ L+TD Y    S ++  +++             + ++EW++QETLLLLE LEMYKDDWNKV+EHVGSRTQ+ECIL+FLRLPIEDPYLE   A +  L YQPIPFS+SGNP+MSTVAFLAS VDPR+AS AAK+AL+EFS++KEEVP  +V+ H  KV  A       DP  YGLE   +AG
Sbjct:    1 MAVRKKDGGPNVKFYEASDTVAQFDNVRLWLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQEEVFGKHVSNAPLTKLPMKCFLDFKVSGALSHILAAAYKFKSDQGWRRFDFQNPSRMDRNVEMFMTIEKSLVQNNCLSRPNIYLHPDIDSKLQSKLKDIVKRHQGTVTEDKSHASHIVVPVPSN-LEDEEWVRPILKRDKQVLLHWGYYPDSYDTWVPASEVEASVEDAPTV------EKPRKVHAKWILDTDSFNEWMNEEDY-------ELTDEKN--PVARRKKISAKTLT---DEVSSPDS----------------------DRRDKKGPNYKKRKRSPSPPPSAEAKKKTVKKGPSTPYTKSKRGHREEEQEDLTKDMDEPSPVPN-VEEV---TLPKTVNTKKDSESAPI--KGGTVTDLDEQEDESMDAVTKEEDETSSGIKGEQMKTSDLHED-NVTEQTHHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQVDAESRPTP--MGPPPTSHFHVLADTPSGLVPL------------------QPKT---PQSSASQQMLNFPDKSKDK------PSDLQNFGLRTDMY----SKKNTTSKSKAAA---------SATREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLEDSEASLGPLAYQPIPFSQSGNPVMSTVAFLASVVDPRVASAAAKSALDEFSKMKEEVPTALVEAHVRKVEDAARITGKADP-SYGLESSGIAG 741          

HSP 2 Score: 61.2326 bits (147), Expect = 1.300e-8
Identity = 46/68 (67.65%), Postives = 54/68 (79.41%), Query Frame = 3
Query: 2838 EEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIXXXXXXXXXXXXXXXXXXXAFHMELLKTVESRAR 3041
            EE+KIK LVA LVE Q+KK+E+KL+ F+ELE I++RE E LE QRQQLL DRQ FHME LK  E RAR
Sbjct:  796 EERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREREALEYQRQQLLADRQNFHMEQLKYAEIRAR 863          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Xenopus
Match: SMARCC2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily c member 2 [Source:NCBI gene;Acc:100101794])

HSP 1 Score: 602.823 bits (1553), Expect = 0.000e+0
Identity = 362/833 (43.46%), Postives = 484/833 (58.10%), Query Frame = 3
Query:   24 LFLKKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWISNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDFLLPGNQQEFAKQANRKPIISRKCYNGDDLNVMLNVSSQPSSVGXXXXXXXXXXXXXXXXXXXXXXXXNKEDNSGKRR-----------KQNVVRAASLANLRKSKVKEXXXXXXXXXXXXXXXPECPNRVEEVPSNSLGRNTPSRGASAAGNIDNRNNVLYDLDEETQGSGXXXXXXXXXXXXXXXDE-----SFHADMSVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDN-VNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLEE--VAG 2465
            + ++KKDG PN +FYE  + +A FD VR WL +N KKY Q +P TNKSL++L  QLLQ+QEE FGK  +   + KLP+ CF DFK  G+LSHI +A  K+KSDQG RRFDFQ+PSR +RNVEMFM I+  L  + C  +P ++L P I ++   KL+   ++    + E+ + A+H++ P  S  L +++  R +++  + ++LHW   PDS+D W+     + ++   P +       +  ++  +W+L T   NEWM+EED+ L   +   A+   RK I ++          + +  S P S                           K  N  KR+           K+  V+        KSK    ++ ++D      +    PN VEEV   +L +   ++  S +  I  +   + DLDE+   S           +S I  E       H D +VTEQ H IIIPSY+AWFDYNS+H IERRALPEFF GKNKSK+ E+Y+AYRNFMIDTYRLNPQEYLT TACRRNL GDVC+I+RVHAFLEQWGLINYQVD E + T   +GPP TSHFHVL D+ +GL  L                  QP     P+  S S   +N   KS D       PS + ++ L+TD Y    S ++  +++             + ++EW++QETLLLLE LEMYKDDWNKV+EHVGSRTQ+ECIL+FLRLPIEDPYLE   A +  L YQPIPFS+SGNP+MSTVAFLAS VDPR+AS AAK+AL+EFS++KEEVP  +V+ H  KV  A       DP  YGLE   +AG
Sbjct:    1 MAVRKKDGGPNVKFYEASDTVAQFDNVRLWLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQEEVFGKHVSNAPLTKLPMKCFLDFKVSGALSHILAAAYKFKSDQGWRRFDFQNPSRMDRNVEMFMTIEKSLVQNNCLSRPNIYLHPDIDSKLQSKLKDIVKRHQGTVTEDKSHASHIVVPVPSN-LEDEEWVRPILKRDKQVLLHWGYYPDSYDTWVPASEVEASVEDAPTV------EKPRKVHAKWILDTDSFNEWMNEEDYELTDEKNPVAR---RKKISAK---------TLTDEVSSPDS----------------------DRRDKKGPNYKKRKRSPSPPPSAEAKKKTVKKGPSTPYTKSKRGHREEEQEDLTKDMDEPSPVPN-VEEV---TLPKTVNTKKDSESAPI--KGGTVTDLDEQEDESMDAVTKEEDETSSGIKGEQMKTSDLHED-NVTEQTHHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQVDAESRPTP--MGPPPTSHFHVLADTPSGLVPL------------------QPKT---PQQSSASQQMLNFPDKSKDK------PSDLQNFGLRTDMY----SKKNTTSKSKAAA---------SATREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLEDSEASLGPLAYQPIPFSQSGNPVMSTVAFLASVVDPRVASAAAKSALDEFSKMKEEVPTALVEAHVRKVEDAARITGKADP-SYGLESSGIAG 742          

HSP 2 Score: 61.2326 bits (147), Expect = 1.191e-8
Identity = 46/68 (67.65%), Postives = 54/68 (79.41%), Query Frame = 3
Query: 2838 EEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIXXXXXXXXXXXXXXXXXXXAFHMELLKTVESRAR 3041
            EE+KIK LVA LVE Q+KK+E+KL+ F+ELE I++RE E LE QRQQLL DRQ FHME LK  E RAR
Sbjct:  816 EERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREREALEYQRQQLLADRQNFHMEQLKYAEIRAR 883          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Mouse
Match: Smarcc2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 [Source:MGI Symbol;Acc:MGI:1915344])

HSP 1 Score: 598.586 bits (1542), Expect = 0.000e+0
Identity = 358/828 (43.24%), Postives = 481/828 (58.09%), Query Frame = 3
Query:   24 LFLKKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWI--SNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDFLLPGNQQEFAKQANRKPIISRKCYNGDDLNVMLNVSSQPSSVGXXXXXXXXXXXXXXXXXXXXXXXXNKEDNSGKRRKQNVVRAASLANLRKSKVKEXXXXXXXXXXXXXXXPECPNRVEEVPSNSLGRNTPSRGASAAGNIDNRNNVLYDLDEETQGSGXXXXXXXXXXXXXXXDE-----SFHADMSVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSL------GNQ--ASVVKSQSNNSAIDKQPTVTANPKDLSNSDN---VNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLE 2453
            + ++KKDG PN ++YE  + +  FD VR WL +N KKY Q +P TNKSL++L  QLLQ+QEE FGK  +   + KLPI CF DFK GGSL HI +A  K+KSDQG RR+DFQ+PSR +RNVEMFM I+  L  + C  +P ++L P I  + + KL+   ++    I E+ + A+H+++P     L  ++  R VM+  + ++LHW   PDS+D WI  S I +    +P P         +  ++  +W+L T   NEWM+EE         ++    ++ P+  RK  +   L   +N    P S            +  K         S     + + +K+N  +  S    +  +   +++ ED     D   P  PN VEEV   +L +   ++  S +  +  +   + DLDE+   S           ++    E       H D +VTEQ H IIIPSY+AWFDYNS+H IERRALPEFF GKNKSK+ E+Y+AYRNFMIDTYRLNPQEYLT TACRRNL GDVC+I+RVHAFLEQWGLINYQVD E + T   +GPP TSHFHVL D+ +GL  L      G Q  A     +      D  P       +L +S +   +N   K  +       P+ + ++ L+TD Y      + +V   S            + ++EW++QETLLLLE LEMYKDDWNKV+EHVGSRTQ+ECIL+FLRLPIEDPYLE   A +  L YQPIPFS+SGNP+MSTVAFLAS VDPR+AS AAK+AL EFS++KEEVP  +V+ H  KV  A +     DP  +GLE
Sbjct:    1 MAVRKKDGGPNVKYYEAADTVTQFDNVRLWLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQEEVFGKHVSNAPLTKLPIKCFLDFKAGGSLCHILAAAYKFKSDQGWRRYDFQNPSRMDRNVEMFMTIEKSLVQNNCLSRPNIFLCPEIEPKLLGKLKDIVKRHQGTISEDKSNASHVVYPVPGN-LEEEEWVRPVMKRDKQVLLHWGYYPDSYDTWIPASEIEASVEDAPTP--------EKPRKVHAKWILDTDTFNEWMNEE---------DYEVSDDKSPVSRRKKISAKTLTDEVN---SPDS----------DRRDKKGGNYKKRKRSPSPSPTPEAKKKNAKKGPSTPYTKSKRGHREEEQEDLTKDMDEPSP-VPN-VEEV---TLPKTVNTKKDSESAPV--KGGTMTDLDEQDDESMETTGKDEDENSTGNKGEQTKNPDLHED-NVTEQTHHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQVDAESRPTP--MGPPPTSHFHVLADTPSGLVPLQPKPPQGRQVDADTKAGRKGKELDDLVPETAKGKPELQSSASQQMLNFPEKGKEK------PADMQNFGLRTDMY-----TKKNVPSKSKAAA--------SATREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLEDSEASLGPLAYQPIPFSQSGNPVMSTVAFLASVVDPRVASAAAKSALEEFSKMKEEVPTALVEAHVRKVEEAAKVTGKADP-AFGLE 767          

HSP 2 Score: 63.5438 bits (153), Expect = 1.707e-9
Identity = 47/68 (69.12%), Postives = 55/68 (80.88%), Query Frame = 3
Query: 2838 EEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIXXXXXXXXXXXXXXXXXXXAFHMELLKTVESRAR 3041
            EE+KIK LVA LVE Q+KK+E+KL+ F+ELE I++RE E LE QRQQLL DRQAFHME LK  E RAR
Sbjct:  911 EERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREREALEYQRQQLLADRQAFHMEQLKYAEMRAR 978          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Mouse
Match: Smarcc2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 [Source:MGI Symbol;Acc:MGI:1915344])

HSP 1 Score: 596.275 bits (1536), Expect = 0.000e+0
Identity = 354/817 (43.33%), Postives = 473/817 (57.89%), Query Frame = 3
Query:   24 LFLKKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWI--SNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDFLLPGNQQEFAKQANRKPIISRKCYNGDDLNVMLNVSSQPSSVGXXXXXXXXXXXXXXXXXXXXXXXXNKEDNSGKRRKQNVVRAASLANLRKSKVKEXXXXXXXXXXXXXXXPECPNRVEEVPSNSLGRNTPSRGASAAGNIDNRNNVLYDLDEETQGSGXXXXXXXXXXXXXXXDE-----SFHADMSVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDNVNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLE 2453
            + ++KKDG PN ++YE  + +  FD VR WL +N KKY Q +P TNKSL++L  QLLQ+QEE FGK  +   + KLPI CF DFK GGSL HI +A  K+KSDQG RR+DFQ+PSR +RNVEMFM I+  L  + C  +P ++L P I  + + KL+   ++    I E+ + A+H+++P     L  ++  R VM+  + ++LHW   PDS+D WI  S I +    +P P         +  ++  +W+L T   NEWM+EED         +    ++ P+  RK  +   L   +N    P S            +  K         S     + + +K+N  +  S    +  +   +++ ED     D   P  PN VEEV   +L +   ++  S +  +  +   + DLDE+   S           ++    E       H D +VTEQ H IIIPSY+AWFDYNS+H IERRALPEFF GKNKSK+ E+Y+AYRNFMIDTYRLNPQEYLT TACRRNL GDVC+I+RVHAFLEQWGLINYQVD E + T   +GPP TSHFHVL D+ +GL  L  +     S S                       +N   K  +       P+ + ++ L+TD Y      + +V   S            + ++EW++QETLLLLE LEMYKDDWNKV+EHVGSRTQ+ECIL+FLRLPIEDPYLE   A +  L YQPIPFS+SGNP+MSTVAFLAS VDPR+AS AAK+AL EFS++KEEVP  +V+ H  KV  A +     DP  +GLE
Sbjct:    1 MAVRKKDGGPNVKYYEAADTVTQFDNVRLWLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQEEVFGKHVSNAPLTKLPIKCFLDFKAGGSLCHILAAAYKFKSDQGWRRYDFQNPSRMDRNVEMFMTIEKSLVQNNCLSRPNIFLCPEIEPKLLGKLKDIVKRHQGTISEDKSNASHVVYPVPGN-LEEEEWVRPVMKRDKQVLLHWGYYPDSYDTWIPASEIEASVEDAPTP--------EKPRKVHAKWILDTDTFNEWMNEED---------YEVSDDKSPVSRRKKISAKTLTDEVN---SPDS----------DRRDKKGGNYKKRKRSPSPSPTPEAKKKNAKKGPSTPYTKSKRGHREEEQEDLTKDMDEPSP-VPN-VEEV---TLPKTVNTKKDSESAPV--KGGTMTDLDEQDDESMETTGKDEDENSTGNKGEQTKNPDLHED-NVTEQTHHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQVDAESRPTP--MGPPPTSHFHVLADTPSGLVPLQPKPPQQSSASQQM--------------------LNFPEKGKEK------PADMQNFGLRTDMY-----TKKNVPSKSKAAA--------SATREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLEDSEASLGPLAYQPIPFSQSGNPVMSTVAFLASVVDPRVASAAAKSALEEFSKMKEEVPTALVEAHVRKVEEAAKVTGKADP-AFGLE 736          

HSP 2 Score: 63.929 bits (154), Expect = 1.596e-9
Identity = 47/68 (69.12%), Postives = 55/68 (80.88%), Query Frame = 3
Query: 2838 EEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIXXXXXXXXXXXXXXXXXXXAFHMELLKTVESRAR 3041
            EE+KIK LVA LVE Q+KK+E+KL+ F+ELE I++RE E LE QRQQLL DRQAFHME LK  E RAR
Sbjct:  880 EERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREREALEYQRQQLLADRQAFHMEQLKYAEMRAR 947          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Mouse
Match: Smarcc1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 [Source:MGI Symbol;Acc:MGI:1203524])

HSP 1 Score: 557.37 bits (1435), Expect = 3.355e-178
Identity = 351/828 (42.39%), Postives = 476/828 (57.49%), Query Frame = 3
Query:   33 KKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWISNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDFLLPGNQQEFAKQANRKPIISRKCYNGDDLNVMLNVSSQPSSVGXXXXXXXXXXXXXXXXXXXXXXXXNKEDNSGKRRKQNVVRAASLANLRKSKVKEXXXXXXXXXXXXXXXPECPNRVEEV--PSN----SLGRNTPSRGASAAGNIDNRNNVLYDLDEETQGSGXXXXXXXXXXXXXXXDESFH-ADMSVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDNVNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLEE--VAGKDPIDKAK 2489
            ++KDG P  +F+E+P+ ++  D+VR WL ++ KKY   D  TNK+LA L  QLLQ+QE+ FGK     +  KLP  CF DFK GG+L HI  A  KYK++QG RRFD Q+PSR +RNVEMFM I+  L  + C  +P ++L P I  +   KL+   ++      +  ++A+H ++P  S    +++  R VMR  + +++HW   PDS+D W+ +   D  +   P         + W++  +W+L T   NEWM+EED+ +           NRKP+  R+  +  +   + +   +        +    S                    +  R+K      ASL   R+S+ KE+D+ ED     +   P  PN +EEV  P N        NTP +G + A           DLDE+ + +         +P+      S    + +VTEQ + IIIPSY++WFDYN IHVIERRALPEFF GKNKSK+ E+Y+AYRNFMIDTYRLNPQEYLT TACRRNLTGDVC+++RVHAFLEQWGL+NYQVD E +  A  +GPP T HF+VL D+ +GL  L  ++               P V A  + L      N   K+ +       P  + ++ L+TD Y      +S   + ++ G            +EW++QETLLLLE LEMYKDDWNKV+EHVGSRTQ+ECIL+FLRLPIEDPYLE   A +  L YQP+PFS+SGNP+MSTVAFLAS VDPR+AS AAKAAL EFSR++EEVP  +V+ H  KV  A  +   VDP  YGLE   +AG  P +  K
Sbjct:   31 RRKDGGPASKFWESPDTVSQLDSVRVWLGKHYKKYVHADAPTNKTLAGLVVQLLQFQEDAFGKHVTNPAFTKLPAKCFMDFKAGGTLCHILGAAYKYKNEQGWRRFDLQNPSRMDRNVEMFMNIEKTLVQNNCLTRPNIYLIPDIDLKLANKLKDIIKRHQGTFTDEKSKASHHIYPYPSS-QEDEEWLRPVMRRDKQVLVHWGFYPDSYDTWVHSNDVDAEIEDAPI------PEKPWKVHVKWILDTDVFNEWMNEEDYEV---------DENRKPVSFRQRISTKNEEPVRSPERRDRKASANSRKRKPSPSPPPPTA------------TESRKKSGKKGQASLYGKRRSQ-KEEDEQEDLTKDMEDPTP-VPN-IEEVVLPKNVNPKKDSENTPVKGGTVA-----------DLDEQDEEAVTTGGKEDEDPSKGDPSRSVDPGEDNVTEQTNHIIIPSYASWFDYNCIHVIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLTGDVCAVMRVHAFLEQWGLVNYQVDPESRPMA--MGPPPTPHFNVLADTPSGLVPLHLRS---------------PQVPAAQQML------NFPEKNKEK------PIDLQNFGLRTDIYSKKTLAKS---KGASAG------------REWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLENSDASLGPLAYQPVPFSQSGNPVMSTVAFLASVVDPRVASAAAKAALEEFSRVREEVPLELVEAHVKKVQEAARASGKVDP-TYGLESSCIAGTGPDEPEK 771          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Mouse
Match: Smarcc1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 [Source:MGI Symbol;Acc:MGI:1203524])

HSP 1 Score: 557.755 bits (1436), Expect = 3.724e-178
Identity = 358/828 (43.24%), Postives = 484/828 (58.45%), Query Frame = 3
Query:   33 KKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWISNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDFLLPGNQQEFAKQANRKPIISRKCYNGDDLNVMLNVSSQPSSVGXXXXXXXXXXXXXXXXXXXXXXXXNKEDNSGKRRKQNVVRAASLANLRKSKVKEXXXXXXXXXXXXXXXPECPNRVEEV--PSN----SLGRNTPSRGASAAGNIDNRNNVLYDLDEETQGSGXXXXXXXXXXXXXXXDESFH-ADMSVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDNVNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLEE--VAGKDPIDKAK 2489
            ++KDG P  +F+E+P+ ++  D+VR WL ++ KKY   D  TNK+LA L  QLLQ+QE+ FGK     +  KLP  CF DFK GG+L HI  A  KYK++QG RRFD Q+PSR +RNVEMFM I+  L  + C  +P ++L P I  +   KL+   ++      +  ++A+H ++P  S    +++  R VMR  + +++HW   PDS+D W+ +   D  +   P         + W++  +W+L T   NEWM+EED+ +           NRKP+  R+  +        N     S     +++SA S K+        P+ +     SGK+ +      ASL   R+S+ KE+D+ ED     +   P  PN +EEV  P N        NTP +G + A           DLDE+ + +         +P+      S    + +VTEQ + IIIPSY++WFDYN IHVIERRALPEFF GKNKSK+ E+Y+AYRNFMIDTYRLNPQEYLT TACRRNLTGDVC+++RVHAFLEQWGL+NYQVD E +  A  +GPP T HF+VL D+ +GL  L  ++               P V A  + L      N   K+ +       P  + ++ L+TD Y      +S   + ++ G            +EW++QETLLLLE LEMYKDDWNKV+EHVGSRTQ+ECIL+FLRLPIEDPYLE   A +  L YQP+PFS+SGNP+MSTVAFLAS VDPR+AS AAKAAL EFSR++EEVP  +V+ H  KV  A  +   VDP  YGLE   +AG  P +  K
Sbjct:   31 RRKDGGPASKFWESPDTVSQLDSVRVWLGKHYKKYVHADAPTNKTLAGLVVQLLQFQEDAFGKHVTNPAFTKLPAKCFMDFKAGGTLCHILGAAYKYKNEQGWRRFDLQNPSRMDRNVEMFMNIEKTLVQNNCLTRPNIYLIPDIDLKLANKLKDIIKRHQGTFTDEKSKASHHIYPYPSS-QEDEEWLRPVMRRDKQVLVHWGFYPDSYDTWVHSNDVDAEIEDAPI------PEKPWKVHVKWILDTDVFNEWMNEEDYEV---------DENRKPVSFRQRISTK------NEEPVRSPERRDRKASANSRKRKPSPSPPPPTATESRKKSGKKGQ------ASLYGKRRSQ-KEEDEQEDLTKDMEDPTP-VPN-IEEVVLPKNVNPKKDSENTPVKGGTVA-----------DLDEQDEEAVTTGGKEDEDPSKGDPSRSVDPGEDNVTEQTNHIIIPSYASWFDYNCIHVIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLTGDVCAVMRVHAFLEQWGLVNYQVDPESRPMA--MGPPPTPHFNVLADTPSGLVPLHLRS---------------PQVPAAQQML------NFPEKNKEK------PIDLQNFGLRTDIYSKKTLAKS---KGASAG------------REWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLENSDASLGPLAYQPVPFSQSGNPVMSTVAFLASVVDPRVASAAAKAALEEFSRVREEVPLELVEAHVKKVQEAARASGKVDP-TYGLESSCIAGTGPDEPEK 771          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Mouse
Match: Smarcc1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 [Source:MGI Symbol;Acc:MGI:1203524])

HSP 1 Score: 557.37 bits (1435), Expect = 6.921e-178
Identity = 356/828 (43.00%), Postives = 484/828 (58.45%), Query Frame = 3
Query:   33 KKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWISNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDFLLPGNQQEFAKQANRKPIISRKCYNGDDLNVMLNVSSQPSSVGXXXXXXXXXXXXXXXXXXXXXXXXNKEDNSGKRRKQNVVRAASLANLRKSKVKEXXXXXXXXXXXXXXXPECPNRVEEV--PSN----SLGRNTPSRGASAAGNIDNRNNVLYDLDEETQGSGXXXXXXXXXXXXXXXDESFH-ADMSVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDNVNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLEE--VAGKDPIDKAK 2489
            ++KDG P  +F+E+P+ ++  D+VR WL ++ KKY   D  TNK+LA L  QLLQ+QE+ FGK     +  KLP  CF DFK GG+L HI  A  KYK++QG RRFD Q+PSR +RNVEMFM I+  L  + C  +P ++L P I  +   KL+   ++      +  ++A+H ++P  S    +++  R VMR  + +++HW   PDS+D W+ +   D  +   P         + W++  +W+L T   NEWM+EED+ +           NRKP+  R+  +          + +P    +++   A +  + +K     P P+  E     R+K      ASL   R+S+ KE+D+ ED     +   P  PN +EEV  P N        NTP +G + A           DLDE+ + +         +P+      S    + +VTEQ + IIIPSY++WFDYN IHVIERRALPEFF GKNKSK+ E+Y+AYRNFMIDTYRLNPQEYLT TACRRNLTGDVC+++RVHAFLEQWGL+NYQVD E +  A  +GPP T HF+VL D+ +GL  L  ++               P V A  + L      N   K+ +       P  + ++ L+TD Y      +S   + ++ G            +EW++QETLLLLE LEMYKDDWNKV+EHVGSRTQ+ECIL+FLRLPIEDPYLE   A +  L YQP+PFS+SGNP+MSTVAFLAS VDPR+AS AAKAAL EFSR++EEVP  +V+ H  KV  A  +   VDP  YGLE   +AG  P +  K
Sbjct:   31 RRKDGGPASKFWESPDTVSQLDSVRVWLGKHYKKYVHADAPTNKTLAGLVVQLLQFQEDAFGKHVTNPAFTKLPAKCFMDFKAGGTLCHILGAAYKYKNEQGWRRFDLQNPSRMDRNVEMFMNIEKTLVQNNCLTRPNIYLIPDIDLKLANKLKDIIKRHQGTFTDEKSKASHHIYPYPSS-QEDEEWLRPVMRRDKQVLVHWGFYPDSYDTWVHSNDVDAEIEDAPI------PEKPWKVHVKWILDTDVFNEWMNEEDYEV---------DENRKPVSFRQRIS--------TKNEEPVRSPERRDRKASANSRKRKPSPSPPPPTATE----SRKKSGKKGQASLYGKRRSQ-KEEDEQEDLTKDMEDPTP-VPN-IEEVVLPKNVNPKKDSENTPVKGGTVA-----------DLDEQDEEAVTTGGKEDEDPSKGDPSRSVDPGEDNVTEQTNHIIIPSYASWFDYNCIHVIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLTGDVCAVMRVHAFLEQWGLVNYQVDPESRPMA--MGPPPTPHFNVLADTPSGLVPLHLRS---------------PQVPAAQQML------NFPEKNKEK------PIDLQNFGLRTDIYSKKTLAKS---KGASAG------------REWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLENSDASLGPLAYQPVPFSQSGNPVMSTVAFLASVVDPRVASAAAKAALEEFSRVREEVPLELVEAHVKKVQEAARASGKVDP-TYGLESSCIAGTGPDEPEK 771          
BLAST of SWI/SNF complex subunit SMARCC2 vs. UniProt/SwissProt
Match: sp|Q8TAQ2|SMRC2_HUMAN (SWI/SNF complex subunit SMARCC2 OS=Homo sapiens OX=9606 GN=SMARCC2 PE=1 SV=1)

HSP 1 Score: 637.106 bits (1642), Expect = 0.000e+0
Identity = 441/1030 (42.82%), Postives = 597/1030 (57.96%), Query Frame = 3
Query:   24 LFLKKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWI--SNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDFLLPGNQQEFAKQANRKPIISRKCYNGDDLNVMLNVSSQPSSVGXXXXXXXXXXXXXXXXXXXXXXXXNKEDNSGKRRKQNVVRAASLANLRKSKVKEXXXXXXXXXXXXXXXPECPNRVEEVPSNSLGRNTPSRGASAAGNIDNRNNVLYDLDE------ETQGSGXXXXXXXXXXXXXXXDESFHADMSVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDN-VNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLEE--VAG--KDPIDKAKEGDXXXX----XXXXXXXXXXXXXDSSTSVKSETDNKVXXXXXXXXXXXXRMDS------SENQPAVVEENEIKVESKDEEMQEKPISNEEEIKI-FDKDSNXXXXXXXXXXXXXXXXXXXXYLAQSEEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIXXXXXXXXXXXXXXXXXXXAFHMELLKTVESRAR 3041
            + ++KKDG PN ++YE  + +  FD VR WL +N KKY Q +P TNKSL++L  QLLQ+QEE FGK  +   + KLPI CF DFK GGSL HI +A  K+KSDQG RR+DFQ+PSR +RNVEMFM I+  L  + C  +P ++L P I  + + KL+   ++    + E+ N A+H+++P     L  ++  R VM+  + ++LHW   PDS+D WI  S I +    +P P         +  ++  +W+L T   NEWM         N++++    ++ P+  RK  +   L   +N    P S            +  K         S     + + +K+N  +  S    +  +   +++ ED     D   P  PN VEEV   +L +   ++  S +  +  +   + DLDE      ET G    + ++  N      +   H D +VTEQ H IIIPSY+AWFDYNS+H IERRALPEFF GKNKSK+ E+Y+AYRNFMIDTYRLNPQEYLT TACRRNL GDVC+I+RVHAFLEQWGLINYQVD E + T   +GPP TSHFHVL D+ +GL  L                  QP     P+  S S   +N   K  +       P+ + ++ L+TD Y      + +V   S            + ++EW++QETLLLLE LEMYKDDWNKV+EHVGSRTQ+ECIL+FLRLPIEDPYLE   A +  L YQPIPFS+SGNP+MSTVAFLAS VDPR+AS AAK+AL EFS++KEEVP  +V+ H  KV  A +     DP  +GLE   +AG   D  ++ +E  N E        + K   KE  +   +++ E   K       + E  +  DS      S+  P V  E E + +   EE+ ++ + +E E K   ++D     L+ AA+ ALAA+A KA++LA  EE+KIK LVA LVE Q+KK+E+KL+ F+ELE I++RE E LE QRQQLL DRQAFHME LK  E RAR
Sbjct:    1 MAVRKKDGGPNVKYYEAADTVTQFDNVRLWLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQEEVFGKHVSNAPLTKLPIKCFLDFKAGGSLCHILAAAYKFKSDQGWRRYDFQNPSRMDRNVEMFMTIEKSLVQNNCLSRPNIFLCPEIEPKLLGKLKDIIKRHQGTVTEDKNNASHVVYPVPGN-LEEEEWVRPVMKRDKQVLLHWGYYPDSYDTWIPASEIEASVEDAPTP--------EKPRKVHAKWILDTDTFNEWM---------NEEDYEVNDDKNPVSRRKKISAKTLTDEVN---SPDS----------DRRDKKGGNYKKRKRSPSPSPTPEAKKKNAKKGPSTPYTKSKRGHREEEQEDLTKDMDEPSP-VPN-VEEV---TLPKTVNTKKDSESAPV--KGGTMTDLDEQEDESMETTGK-DEDENSTGNKGEQTKNPDLHED-NVTEQTHHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQVDAESRPTP--MGPPPTSHFHVLADTPSGLVPL------------------QPKT---PQQTSASQQMLNFPDKGKEK------PTDMQNFGLRTDMY-----TKKNVPSKSKAAA--------SATREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLEDSEASLGPLAYQPIPFSQSGNPVMSTVAFLASVVDPRVASAAAKSALEEFSKMKEEVPTALVEAHVRKVEEAAKVTGKADP-AFGLESSGIAGTTSDEPERIEESGNDEARVEGQATDEKKEPKEPREGGGAIEEEAKEKTSEAPKKDEEKGKEGDSEKESEKSDGDPIVDPEKEKEPKEGQEEVLKEVVESEGERKTKVERDIGEGNLSTAAAAALAAAAVKAKHLAAVEERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREREALEYQRQQLLADRQAFHMEQLKYAEMRAR 947          
BLAST of SWI/SNF complex subunit SMARCC2 vs. UniProt/SwissProt
Match: sp|Q92922|SMRC1_HUMAN (SWI/SNF complex subunit SMARCC1 OS=Homo sapiens OX=9606 GN=SMARCC1 PE=1 SV=3)

HSP 1 Score: 564.688 bits (1454), Expect = 7.505e-180
Identity = 361/830 (43.49%), Postives = 488/830 (58.80%), Query Frame = 3
Query:   33 KKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWISNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDFLLPGNQQEFAKQANRKPIISRKCYNGDDLNVMLNVSSQPSSVGXXXXXXXXXXXXXXXXXXXXXXXXNKEDNSGKRRKQNVVRAASLANLRKSKVKEXXXXXXXXXXXXXXXPECPNRVEEV--PSN----SLGRNTPSRGASAAGNIDNRNNVLYDLDEETQGSGXXXXXXXXXXXXXXXDESFHADMS---VTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDNVNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLEE--VAGKDPIDKAK 2489
            ++KDG P  +F+E+PE ++  D+VR WL ++ KKY   D  TNK+LA L  QLLQ+QE+ FGK     +  KLP  CF DFK GG+L HI  A  KYK++QG RRFD Q+PSR +RNVEMFM I+  L  + C  +P ++L P I  +   KL+   ++      +  ++A+H ++P +S    +++  R VMR+ + +++HW   PDS+D W+ +   D  +   P         + W++  +W+L T   NEWM+EED+ +           NRKP+  R+  +          + +P    +++   A +  + +K     P P+  E     R+K      ASL   R+S+ KE+D+ ED     +   P  PN +EEV  P N        NTP +G + A         L + DEET  +G   +   A       D+S   D+    VTEQ + IIIPSY++WFDYN IHVIERRALPEFF GKNKSK+ E+Y+AYRNFMIDTYRLNPQEYLT TACRRNLTGDVC+++RVHAFLEQWGL+NYQVD E +  A  +GPP T HF+VL D+ +GL  L  ++               P V A  + L      N   K+ +       P  + ++ L+TD Y      +S   + ++ G            +EW++QETLLLLE LEMYKDDWNKV+EHVGSRTQ+ECIL+FLRLPIEDPYLE   A +  L YQP+PFS+SGNP+MSTVAFLAS VDPR+AS AAKAAL EFSR++EEVP  +V+ H  KV  A  +   VDP  YGLE   +AG  P +  K
Sbjct:   32 RRKDGGPATKFWESPETVSQLDSVRVWLGKHYKKYVHADAPTNKTLAGLVVQLLQFQEDAFGKHVTNPAFTKLPAKCFMDFKAGGALCHILGAAYKYKNEQGWRRFDLQNPSRMDRNVEMFMNIEKTLVQNNCLTRPNIYLIPDIDLKLANKLKDIIKRHQGTFTDEKSKASHHIYPYSSS-QDDEEWLRPVMRKEKQVLVHWGFYPDSYDTWVHSNDVDAEIEDPPI------PEKPWKVHVKWILDTDIFNEWMNEEDYEV---------DENRKPVSFRQRIS--------TKNEEPVRSPERRDRKASANARKRKHSPSPPPPTPTE----SRKKSGKKGQASLYGKRRSQ-KEEDEQEDLTKDMEDPTP-VPN-IEEVVLPKNVNLKKDSENTPVKGGTVAD--------LDEQDEETVTAGGKEDEDPAKG-----DQSRSVDLGEDNVTEQTNHIIIPSYASWFDYNCIHVIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLTGDVCAVMRVHAFLEQWGLVNYQVDPESRPMA--MGPPPTPHFNVLADTPSGLVPLHLRS---------------PQVPAAQQML------NFPEKNKEK------PVDLQNFGLRTDIYSKKTLAKS---KGASAG------------REWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLENSDASLGPLAYQPVPFSQSGNPVMSTVAFLASVVDPRVASAAAKAALEEFSRVREEVPLELVEAHVKKVQEAARASGKVDP-TYGLESSCIAGTGPDEPEK 772          
BLAST of SWI/SNF complex subunit SMARCC2 vs. UniProt/SwissProt
Match: sp|P97496|SMRC1_MOUSE (SWI/SNF complex subunit SMARCC1 OS=Mus musculus OX=10090 GN=Smarcc1 PE=1 SV=2)

HSP 1 Score: 557.37 bits (1435), Expect = 4.841e-177
Identity = 356/828 (43.00%), Postives = 484/828 (58.45%), Query Frame = 3
Query:   33 KKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWISNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDFLLPGNQQEFAKQANRKPIISRKCYNGDDLNVMLNVSSQPSSVGXXXXXXXXXXXXXXXXXXXXXXXXNKEDNSGKRRKQNVVRAASLANLRKSKVKEXXXXXXXXXXXXXXXPECPNRVEEV--PSN----SLGRNTPSRGASAAGNIDNRNNVLYDLDEETQGSGXXXXXXXXXXXXXXXDESFH-ADMSVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDNVNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLEE--VAGKDPIDKAK 2489
            ++KDG P  +F+E+P+ ++  D+VR WL ++ KKY   D  TNK+LA L  QLLQ+QE+ FGK     +  KLP  CF DFK GG+L HI  A  KYK++QG RRFD Q+PSR +RNVEMFM I+  L  + C  +P ++L P I  +   KL+   ++      +  ++A+H ++P  S    +++  R VMR  + +++HW   PDS+D W+ +   D  +   P         + W++  +W+L T   NEWM+EED+ +           NRKP+  R+  +          + +P    +++   A +  + +K     P P+  E     R+K      ASL   R+S+ KE+D+ ED     +   P  PN +EEV  P N        NTP +G + A           DLDE+ + +         +P+      S    + +VTEQ + IIIPSY++WFDYN IHVIERRALPEFF GKNKSK+ E+Y+AYRNFMIDTYRLNPQEYLT TACRRNLTGDVC+++RVHAFLEQWGL+NYQVD E +  A  +GPP T HF+VL D+ +GL  L  ++               P V A  + L      N   K+ +       P  + ++ L+TD Y      +S   + ++ G            +EW++QETLLLLE LEMYKDDWNKV+EHVGSRTQ+ECIL+FLRLPIEDPYLE   A +  L YQP+PFS+SGNP+MSTVAFLAS VDPR+AS AAKAAL EFSR++EEVP  +V+ H  KV  A  +   VDP  YGLE   +AG  P +  K
Sbjct:   31 RRKDGGPASKFWESPDTVSQLDSVRVWLGKHYKKYVHADAPTNKTLAGLVVQLLQFQEDAFGKHVTNPAFTKLPAKCFMDFKAGGTLCHILGAAYKYKNEQGWRRFDLQNPSRMDRNVEMFMNIEKTLVQNNCLTRPNIYLIPDIDLKLANKLKDIIKRHQGTFTDEKSKASHHIYPYPSS-QEDEEWLRPVMRRDKQVLVHWGFYPDSYDTWVHSNDVDAEIEDAPI------PEKPWKVHVKWILDTDVFNEWMNEEDYEV---------DENRKPVSFRQRIS--------TKNEEPVRSPERRDRKASANSRKRKPSPSPPPPTATE----SRKKSGKKGQASLYGKRRSQ-KEEDEQEDLTKDMEDPTP-VPN-IEEVVLPKNVNPKKDSENTPVKGGTVA-----------DLDEQDEEAVTTGGKEDEDPSKGDPSRSVDPGEDNVTEQTNHIIIPSYASWFDYNCIHVIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLTGDVCAVMRVHAFLEQWGLVNYQVDPESRPMA--MGPPPTPHFNVLADTPSGLVPLHLRS---------------PQVPAAQQML------NFPEKNKEK------PIDLQNFGLRTDIYSKKTLAKS---KGASAG------------REWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLENSDASLGPLAYQPVPFSQSGNPVMSTVAFLASVVDPRVASAAAKAALEEFSRVREEVPLELVEAHVKKVQEAARASGKVDP-TYGLESSCIAGTGPDEPEK 771          
BLAST of SWI/SNF complex subunit SMARCC2 vs. UniProt/SwissProt
Match: sp|Q6PDG5|SMRC2_MOUSE (SWI/SNF complex subunit SMARCC2 OS=Mus musculus OX=10090 GN=Smarcc2 PE=1 SV=2)

HSP 1 Score: 393.275 bits (1009), Expect = 2.926e-115
Identity = 212/374 (56.68%), Postives = 254/374 (67.91%), Query Frame = 3
Query: 1350 FHADMSVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDNVNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLEE--VAG 2465
             H D +VTEQ H IIIPSY+AWFDYNS+H IERRALPEFF GKNKSK+ E+Y+AYRNFMIDTYRLNPQEYLT TACRRNL GDVC+I+RVHAFLEQWGLINYQVD E + T   +GPP TSHFHVL D+ +GL  L  +     S S                       +N   K  +       P+ + ++ L+TD Y      + +V   S            + ++EW++QETLLLLE LEMYKDDWNKV+EHVGSRTQ+ECIL+FLRLPIEDPYLE   A +  L YQPIPFS+SGNP+MSTVAFLAS VDPR+AS AAK+AL EFS++KEEVP  +V+ H  KV  A +     DP  +GLE   +AG
Sbjct:  412 LHED-NVTEQTHHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQVDAESRPTP--MGPPPTSHFHVLADTPSGLVPLQPKPPQQSSASQQM--------------------LNFPEKGKEK------PADMQNFGLRTDMY-----TKKNVPSKSKAAA--------SATREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLEDSEASLGPLAYQPIPFSQSGNPVMSTVAFLASVVDPRVASAAAKSALEEFSKMKEEVPTALVEAHVRKVEEAAKVTGKADP-AFGLESSGIAG 742          

HSP 2 Score: 233.802 bits (595), Expect = 3.595e-61
Identity = 114/266 (42.86%), Postives = 165/266 (62.03%), Query Frame = 3
Query:   24 LFLKKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWI--SNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDF 815
            + ++KKDG PN ++YE  + +  FD VR WL +N KKY Q +P TNKSL++L  QLLQ+QEE FGK  +   + KLPI CF DFK GGSL HI +A  K+KSDQG RR+DFQ+PSR +RNVEMFM I+  L  + C  +P ++L P I  + + KL+   ++    I E+ + A+H+++P     L  ++  R VM+  + ++LHW   PDS+D WI  S I +    +P P         +  ++  +W+L T   NEWM+EED+
Sbjct:    1 MAVRKKDGGPNVKYYEAADTVTQFDNVRLWLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQEEVFGKHVSNAPLTKLPIKCFLDFKAGGSLCHILAAAYKFKSDQGWRRYDFQNPSRMDRNVEMFMTIEKSLVQNNCLSRPNIFLCPEIEPKLLGKLKDIVKRHQGTISEDKSNASHVVYPVPGN-LEEEEWVRPVMKRDKQVLLHWGYYPDSYDTWIPASEIEASVEDAPTP--------EKPRKVHAKWILDTDTFNEWMNEEDY 257          

HSP 3 Score: 63.5438 bits (153), Expect = 1.219e-8
Identity = 47/68 (69.12%), Postives = 55/68 (80.88%), Query Frame = 3
Query: 2838 EEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIXXXXXXXXXXXXXXXXXXXAFHMELLKTVESRAR 3041
            EE+KIK LVA LVE Q+KK+E+KL+ F+ELE I++RE E LE QRQQLL DRQAFHME LK  E RAR
Sbjct:  880 EERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREREALEYQRQQLLADRQAFHMEQLKYAEMRAR 947          
BLAST of SWI/SNF complex subunit SMARCC2 vs. UniProt/SwissProt
Match: sp|O14470|SSR2_SCHPO (SWI/SNF and RSC complexes subunit ssr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ssr2 PE=1 SV=3)

HSP 1 Score: 241.506 bits (615), Expect = 7.288e-68
Identity = 146/382 (38.22%), Postives = 213/382 (55.76%), Query Frame = 3
Query: 1368 VTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQ---ASVVKSQSNNSAI---DKQPTVTANPKDLSNSDNVNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGG-------------VIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPY---LEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDP----RIASEAAKAAL-----NEFSRLKEEVPEYMVKE--HKAKVTTAVE 2414
            + EQ + II+PSY+ WFD + IH IERR+ PEFF GK+  K+  +Y  YR+FMI++YRL P EYLT TACRRNL GDVC+I+RVHAFLEQWGLINYQ+D E +  A  L PP + H   ++++    Q +  Q    S V   S+   +   +K  + + N  + ++    + +S      ++ C    +   +     Y N+ + + D+  N                  +D         K WS+QETLLLLE +E Y DDWN++A HVGSRT+E+C+++FL++PIEDPY   L+GD +  +      +PF ++ NP++ST+ +LAS V      R  +E+ K        +EF    E V  Y +K    KAK+  A E
Sbjct:   11 LVEQTYPIIVPSYAGWFDMSKIHDIERRSNPEFFNGKSPLKTPSIYKDYRDFMINSYRLEPNEYLTVTACRRNLVGDVCAIIRVHAFLEQWGLINYQIDPETR-PAFRL-PPISGHVQAISNTPIVTQEMLAQHPPPSTVGGSSSQEFVKLEEKHYSPSLNAMEQTSPKEEDEKSDKVPRVDKVCFTCGV---NCSQTWYHNLKNKKYDICPNCYKQGRFSSSFNSSDFLCMDAIDFNHDEEKPWSNQETLLLLEAIETYGDDWNQIALHVGSRTKEQCLIHFLQIPIEDPYRQKLQGDFSPFKK---GFLPFDENENPVLSTLTYLASIVQQGMKERKQNESVKQGETSFGNSEFKNPLERVAYYALKSAAQKAKLIAAFE 384          
BLAST of SWI/SNF complex subunit SMARCC2 vs. TrEMBL
Match: I1ZI88 (SWI/SNF complex subunit SMARCC-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1083.94 bits (2802), Expect = 0.000e+0
Identity = 754/799 (94.37%), Postives = 764/799 (95.62%), Query Frame = 3
Query: 1398 PSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAY-RNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDNVNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLEEVAGKDPIDKAKEGDXXXXXXXXXXXXXXXXXDSSTSVKSETDNKVXXXXXXXXXXXXRMDSSENQPAVVEENEIKVESKDEEMQEKPISNEEEIKIFDKDSNXXXXXXXXXXXXXXXXXXXXYLAQSEEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIXXXXXXXXXXXXXXXXXXXAFHMELLKTVESRARVVGHNQFHPINNINHQGSYHNASQAISQNPSVQHQQAGTLPTQQFPQNQVIQQHXXXXXXXXXXXXXXXQHNTSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNMQTPQHQSNMAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITQQYSXXXXXXXXXXXXAAYQNVGMSAAAAAARKPTDINFSEQQIPHQQVSNQSLQNTQQMNPIHHLSSQPDPDGNNTNVNIN 3791
            P   A FD  ++     R   +++  +N   + +V   Y  N+     +L   EYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDNVNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLEEVAGKDPIDKAKEGDN E AKEEIKVAVKENIDSSTSVKSETDNKVETESHTESEGTERMDSSENQPAVVEENEIKVESKDEEMQEKPISNEEEIKIFDKDSNSRRLAEAASVALAASATKARYLAQSEEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIEREYEVLEQQRQQLLLDRQAFHMELLKTVESRARVVGHNQFHPINNINHQGSYHNASQAISQNPSVQHQQAGTLPTQQFPQNQVIQQHNPNPVPLQYPPNPMPQHNTSMQSNQIPQHNQSIQQQYPQNLPPPPPQHQSNMQTPQHQSNMAPQHQQNLQPQHQPNMPPIQHQQQLPIPTQTPQNMSSSSSSQHQQNMHTQNITQQYSQGPLPPQTQQQQAAYQNVGMSAAAAAARKPTDINFSEQQIPHQQVSNQSLQNTQQMNPIHHLSSQPDPDGNNTNVNIN
Sbjct:   19 PEIIALFD--TVRTWLTRNCKKYW--QNDPMTNKVLQLYVTNYFSIKRKLLEDEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDNVNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLEEVAGKDPIDKAKEGDNEEGAKEEIKVAVKENIDSSTSVKSETDNKVETESHTESEGTERMDSSENQPAVVEENEIKVESKDEEMQEKPISNEEEIKIFDKDSNSRRLAEAASVALAASATKARYLAQSEEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIEREYEVLEQQRQQLLLDRQAFHMELLKTVESRARVVGHNQFHPINNINHQGSYHNASQAISQNPSVQHQQAGTLPTQQFPQNQVIQQHNPNPVPLQYPPNPMPQHNTSMQSNQIPQHNQSIQQQYPQNLPPPPPQHQSNMQTPQHQSNMAPQHQQNLQPQHQPNMPPIQHQQQLPIPTQTPQNMSSSSSSQHQQNMHTQNITQQYSQGPLPPQTQQQQAAYQNVGMSAAAAAARKPTDINFSEQQIPHQQVSNQSLQNTQQMNPIHHLSSQPDPDGNNTNVNIN 813          

HSP 2 Score: 112.464 bits (280), Expect = 1.205e-26
Identity = 49/50 (98.00%), Postives = 49/50 (98.00%), Query Frame = 3
Query:   21 MLFLKKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSL 170
            MLFLKKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNK L
Sbjct:    1 MLFLKKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKVL 50          

HSP 3 Score: 39.6614 bits (91), Expect = 1.205e-26
Identity = 18/23 (78.26%), Postives = 19/23 (82.61%), Query Frame = 1
Query:  151 P*RTRVLQLYATNYFSIKRKLLE 219
            P   +VLQLY TNYFSIKRKLLE
Sbjct:   44 PMTNKVLQLYVTNYFSIKRKLLE 66          
BLAST of SWI/SNF complex subunit SMARCC2 vs. TrEMBL
Match: A0A5K3FU96 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 652.899 bits (1683), Expect = 0.000e+0
Identity = 461/1089 (42.33%), Postives = 617/1089 (56.66%), Query Frame = 3
Query:   60 RFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLL------FPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWISNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSE------------------EDFLLPGNQQEFAKQANRKPIISRKCYNGDDLNVMLNVSSQPSSVGXXXXXXXXXXXXXXXXXXXXXXXXNKEDNSGKRRKQNVVRAASLANLRKSKVKEXXXXXXXXXXXXXXX------------PECPNRVEEV----PSNSLGRNTPSRGASAAGNIDNRNNVLYDLDEETQGSGXXX-XXXXXXXXXXXXDESFHADMSVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQV-------------DQEGKI-TAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDN-----------VNLQSKSADSNNETCMPS----------SISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAG----LPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPI--------PFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLEE--VAGKDPIDKAKEGDXXXXXXXXXXXXXXXXXDSSTSVKSETDNKVXXXXXXXXXXXXRMDSSENQPAVVEENEIKVESKDEEMQEKPISNEEEIKIFDKD---SNXXXXXXXXXXXXXXXXXXXXYLAQSEEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIXXXXXXXXXXXXXXXXXXXAFHMELLKTVESRARVV 3047
            RFYENPEIIA FD VRTWLTRN KKY Q +P TNKSLA LCY LL +QE+ FGK  N++   KLP   F DFKPGGSL +IF  CLKY+ DQG R+ DF SP R ++ +EMF  I+ EL     W  P ++LS  I    + +++ +  ++   + ++  EATH++      +P +S+   +    R++ +EGRG+++HW+ +P S+DNW +N P +   S EP   P +     W++D RWLL + E+ EWM E                  E+FL   + Q+   QA      S    +    +  ++ +  P++  D      +               SN   NS KRR  ++V + S     K   KED      +  KD +             PE  N+V +V    P     RN+ +  A+A    D+ N+     D    G G +               +    D+SV EQAHCI++PSYSAWFDYN+IH IERR+LPEFF GKNKSK+ E Y+AYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCS+LRVHAFLEQWGLINYQV              +  ++  A SLGPP+T+HF+VLTDSA+GLQ LG+Q     +     A  +Q      P + + +D            V L  + +       +PS          S  D  L++DQY+   +        + G   D          A    W+DQETLLLLE LEMY+DDWNKVAEHVGSRTQ+ECIL+FLRLPIED YLEGD     ++CY  +        PFSKSGNPI+STVAFLA+ VDPR+A+ AA AAL E+++++EEVP  ++ EHKA+V  AV  G+ VDP K+GL+E  +   D   K   G +    +E  + A K   DS  +VKS+  ++        +E      + E +P V E  E +    +E ++ K   +  E      +    N   L  AA+ ALAA+ATKAR+LA  EEK+IKGLVAQLVE QLKK+++KLKQFQELEAI+ERE+E+LEQ RQQL+ DRQAFHME++KT+E++AR +
Sbjct:   14 RFYENPEIIANFDPVRTWLTRNHKKYTQAEPPTNKSLAGLCYNLLIFQEQYFGK--NDMP-TKLPSRLFVDFKPGGSLCYIFLVCLKYRHDQGWRKLDFGSP-RIDKFLEMFDCIRRELAHQHLWSNPCLFLS-GIEEPLLGRVQESILRLGASVAKSPEEATHIIHNPPESWPGDSREDSSCPRFRLIFKEGRGLLIHWLYSPGSYDNWHTNFPVEWPSSIEP--EPRVPGGTPWDVDARWLLYSAEHREWMLEEDFLHNSSSARPRKSYTYEEFLEAASSQQ--TQAPASSWTSSFSASSLSASPHISSTGAPTTPTDLSHKKKRKRSPSPSSESYVGGNSNLSANSKKRRHGSLVPSNSKHGASKKIKKEDYMELTPEDQKDDNTNDTNDLTRNLDDPEPSNKVTQVAPGTPVTMTSRNSRTSLATADLTGDHMNSPAAPTDHTGGGEGESVDVGGGRGSGGGGGGDQMGGDLSVIEQAHCIVMPSYSAWFDYNAIHAIERRSLPEFFNGKNKSKTPETYLAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSVLRVHAFLEQWGLINYQVAAPLLSTGASQMPSEAARLAVAASLGPPSTAHFNVLTDSASGLQPLGSQNQAAMAALAEEAAKQQ---KEQPIESTKTDGDGEVKSGIKPEVGLDGQPSTGQLGQMLPSATPTLGGPPPSTGDPLLRSDQYLTAGNTGGSDAAATGGAAGDIATNQILTKGAMKDGWTDQETLLLLEALEMYRDDWNKVAEHVGSRTQDECILHFLRLPIEDAYLEGDFGSTASVCYSALADASHPQPPFSKSGNPILSTVAFLAAVVDPRVAASAASAALKEYAQMREEVPAGLLHEHKARVEAAVRMGREVDPTKFGLDELGIVKPDESKKTTAGGDEHVKEESSEAAEKSVEDSGDAVKSQMSSEDGKSEGAVAEK-----AHEERPKVGEAPEKERTQSEEVLEAKRKRDAGEKTPAPTNCLPPNPDSLGTAAACALAAAATKARHLASVEEKRIKGLVAQLVETQLKKLDIKLKQFQELEAILEREHEMLEQARQQLMHDRQAFHMEVIKTMENQARAL 1085          
BLAST of SWI/SNF complex subunit SMARCC2 vs. TrEMBL
Match: A0A5E4ASX4 (Uncharacterized protein OS=Marmota monax OX=9995 GN=MONAX_5E017551 PE=4 SV=1)

HSP 1 Score: 647.121 bits (1668), Expect = 0.000e+0
Identity = 439/1036 (42.37%), Postives = 601/1036 (58.01%), Query Frame = 3
Query:   24 LFLKKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWI--SNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDFLLPGNQQEFAKQANRKPIISRKCYNGDDLNVMLNVSSQPSSVGXXXXXXXXXXXXXXXXXXXXXXXXNKEDNSGKRRKQNVVRAASLANLRKSKVKEXXXXXXXXXXXXXXXPECPNRVEEVPSNSLGRNTPSRGASAAGNIDNRNNVLYDLDE-ETQGSGXXXXXXXXXXXXXXXDESFHADM---SVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSL------GNQ--ASVVKSQSNNSAIDKQPTVTANPKDLSNSDN--VNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLEE--VAG-----KDPIDKAKEGDXXXXXXXXXXXXXXXXXDSSTSVKSETDNKVXXXXXXXXXXXXRMDS------SENQPAVVEENEIKVESKDEEMQEKPISNEEEIKI-FDKDSNXXXXXXXXXXXXXXXXXXXXYLAQSEEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIXXXXXXXXXXXXXXXXXXXAFHMELLKTVESRAR 3041
            + ++KKDG PN ++YE  + +  FD VR WL +N KKY Q +P TNKSL++L  QLLQ+QEE FGK  +   + KLPI CF DFK GGSL HI +A  K+KSDQG RR+DFQ+PSR +RNVEMFM I+  L  + C  +P ++L P I  + + KL+   ++    + E+ N A+H+++P     L  ++  R VM+  + ++LHW   PDS+D WI  S I +    +P P         +  ++  +W+L T   NEWM+EED+ +           ++ P+  RK  +   L   +N    P S            +  K         S     + + +K+N  +  S    +  +   +++ ED     D   P  PN VEEV   +L +   ++  S +  +  +   + DLDE E +G          +   N  +++ + D+   +VTEQ H IIIPSY+AWFDYNS+H IERRALPEFF GKNKSK+ E+Y+AYRNFMIDTYRLNPQEYLT TACRRNL GDVC+I+RVHAFLEQWGLINYQVD E + T   +GPP TSHFHVL D+ +GL  L      G Q  A     +      D  P       +LS++    +N   K  +       P+ + ++ L+TD Y      + +V   S            + ++EW++QETLLLLE LEMYKDDWNKV+EHVGSRTQ+ECIL+FLRLPIEDPYLE   A +  L YQPIPFS+SGNP+MSTVAFLAS VDPR+AS AAK+AL EFS++KEEVP  +V+ H  KV  A +     DP  +GLE   +AG      + I+++   +   E +   +    +       V+ E   K       + E  +  DS      S+  P V  E E + +   EE+ ++ + +E E K   ++D     L+ AA+ ALAA+A KA++LA  EE+KIK LVA LVE Q+KK+E+KL+ F+ELE I++RE E LE QRQQLL DRQAFHME LK  E RAR
Sbjct:    1 MAVRKKDGGPNVKYYEAADTVTQFDNVRLWLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQEEVFGKHVSNAPLTKLPIKCFLDFKAGGSLCHILAAAYKFKSDQGWRRYDFQNPSRMDRNVEMFMTIEKSLVQNNCLSRPNIFLCPEIEPKLLGKLKDIIKRHQGTVTEDKNNASHVVYPVPGN-LEEEEWVRPVMKRDKQVLLHWGYYPDSYDTWIPASEIEASVEDAPTP--------EKPRKVHAKWILDTDSFNEWMNEEDYEV---------NDDKNPVSRRKKISAKTLTDEVN---SPDS----------DRRDKKGGNYKKRKRSPSPSPTPEAKKKNAKKGPSTPYTKSKRGHREEEQEDLTKDMDEPSP-VPN-VEEV---TLPKTVNTKKDSESAPV--KGGTMTDLDEQEDEGMETTGKDEDESSTGNKGEQTKNPDLHEDNVTEQTHHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQVDAESRPTP--MGPPPTSHFHVLADTPSGLVPLQPKTPQGRQVDADTKAGRKGKELDDLVPETAKGKPELSSASQQMLNFPDKGKEK------PTDMQNFGLRTDMY-----TKKNVPSKSKAAA--------SATREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLEDSEASLGPLAYQPIPFSQSGNPVMSTVAFLASVVDPRVASAAAKSALEEFSKMKEEVPTALVEAHVRKVEEAAKVTGKADP-AFGLESSGIAGTTSDEPERIEESGTDEARAEGQATDEKKEPKEPREGGVVEEEAKEKTSEAPKKDEEKGKEGDSEKESEKSDGDPIVDSEKEKEPKEGQEEILKEVVESEGERKTKVERDIGEGNLSTAAAAALAAAAVKAKHLAAVEERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREREALEYQRQQLLADRQAFHMEQLKYAEMRAR 976          
BLAST of SWI/SNF complex subunit SMARCC2 vs. TrEMBL
Match: A0A5E4AUD5 (Uncharacterized protein OS=Marmota monax OX=9995 GN=MONAX_5E017551 PE=4 SV=1)

HSP 1 Score: 646.351 bits (1666), Expect = 0.000e+0
Identity = 440/1033 (42.59%), Postives = 598/1033 (57.89%), Query Frame = 3
Query:   24 LFLKKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWI--SNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDFLLPGNQQEFAKQANRKPIISRKCYNGDDLNVMLNVSSQPSSVGXXXXXXXXXXXXXXXXXXXXXXXXNKEDNSGKRRKQNVVRAASLANLRKSKVKEXXXXXXXXXXXXXXXPECPNRVEEVPSNSLGRNTPSRGASAAGNIDNRNNVLYDLDE-ETQGSGXXXXXXXXXXXXXXXDESFHADM---SVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSL------GNQASV-VKSQSNNSAIDKQPTVTANPKDLSNSDNVNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLEE--VAG-----KDPIDKAKEGDXXXXXXXXXXXXXXXXXDSSTSVKSETDNKVXXXXXXXXXXXXRMDS------SENQPAVVEENEIKVESKDEEMQEKPISNEEEIKI-FDKDSNXXXXXXXXXXXXXXXXXXXXYLAQSEEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIXXXXXXXXXXXXXXXXXXXAFHMELLKTVESRAR 3041
            + ++KKDG PN ++YE  + +  FD VR WL +N KKY Q +P TNKSL++L  QLLQ+QEE FGK  +   + KLPI CF DFK GGSL HI +A  K+KSDQG RR+DFQ+PSR +RNVEMFM I+  L  + C  +P ++L P I  + + KL+   ++    + E+ N A+H+++P     L  ++  R VM+  + ++LHW   PDS+D WI  S I +    +P P         +  ++  +W+L T   NEWM+EED+ +           ++ P+  RK  +   L   +N    P S            +  K         S     + + +K+N  +  S    +  +   +++ ED     D   P  PN VEEV   +L +   ++  S +  +  +   + DLDE E +G          +   N  +++ + D+   +VTEQ H IIIPSY+AWFDYNS+H IERRALPEFF GKNKSK+ E+Y+AYRNFMIDTYRLNPQEYLT TACRRNL GDVC+I+RVHAFLEQWGLINYQVD E + T   +GPP TSHFHVL D+ +GL  L      G Q     K+      +D     TA  K    S          D   E   P+ + ++ L+TD Y      + +V   S            + ++EW++QETLLLLE LEMYKDDWNKV+EHVGSRTQ+ECIL+FLRLPIEDPYLE   A +  L YQPIPFS+SGNP+MSTVAFLAS VDPR+AS AAK+AL EFS++KEEVP  +V+ H  KV  A +     DP  +GLE   +AG      + I+++   +   E +   +    +       V+ E   K       + E  +  DS      S+  P V  E E + +   EE+ ++ + +E E K   ++D     L+ AA+ ALAA+A KA++LA  EE+KIK LVA LVE Q+KK+E+KL+ F+ELE I++RE E LE QRQQLL DRQAFHME LK  E RAR
Sbjct:    1 MAVRKKDGGPNVKYYEAADTVTQFDNVRLWLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQEEVFGKHVSNAPLTKLPIKCFLDFKAGGSLCHILAAAYKFKSDQGWRRYDFQNPSRMDRNVEMFMTIEKSLVQNNCLSRPNIFLCPEIEPKLLGKLKDIIKRHQGTVTEDKNNASHVVYPVPGN-LEEEEWVRPVMKRDKQVLLHWGYYPDSYDTWIPASEIEASVEDAPTP--------EKPRKVHAKWILDTDSFNEWMNEEDYEV---------NDDKNPVSRRKKISAKTLTDEVN---SPDS----------DRRDKKGGNYKKRKRSPSPSPTPEAKKKNAKKGPSTPYTKSKRGHREEEQEDLTKDMDEPSP-VPN-VEEV---TLPKTVNTKKDSESAPV--KGGTMTDLDEQEDEGMETTGKDEDESSTGNKGEQTKNPDLHEDNVTEQTHHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQVDAESRPTP--MGPPPTSHFHVLADTPSGLVPLQPKTPQGRQVDADTKAGRKGKELDDLVPETAKGKPELQSSASQQMLNFPDKGKEK--PTDMQNFGLRTDMY-----TKKNVPSKSKAAA--------SATREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLEDSEASLGPLAYQPIPFSQSGNPVMSTVAFLASVVDPRVASAAAKSALEEFSKMKEEVPTALVEAHVRKVEEAAKVTGKADP-AFGLESSGIAGTTSDEPERIEESGTDEARAEGQATDEKKEPKEPREGGVVEEEAKEKTSEAPKKDEEKGKEGDSEKESEKSDGDPIVDSEKEKEPKEGQEEILKEVVESEGERKTKVERDIGEGNLSTAAAAALAAAAVKAKHLAAVEERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREREALEYQRQQLLADRQAFHMEQLKYAEMRAR 977          
BLAST of SWI/SNF complex subunit SMARCC2 vs. TrEMBL
Match: A0A5E4AVC8 (Uncharacterized protein OS=Marmota monax OX=9995 GN=MONAX_5E017551 PE=4 SV=1)

HSP 1 Score: 646.351 bits (1666), Expect = 0.000e+0
Identity = 443/1033 (42.88%), Postives = 602/1033 (58.28%), Query Frame = 3
Query:   24 LFLKKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWI--SNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDFLLPGNQQEFAKQANRKPIISRKCYNGDDLNVMLNVSSQPSSVGXXXXXXXXXXXXXXXXXXXXXXXXNKEDNSGKRRKQNVVRAASLANLRKSKVKEXXXXXXXXXXXXXXXPECPNRVEEVPSNSLGRNTPSRGASAAGNIDNRNNVLYDLDE-ETQGSGXXXXXXXXXXXXXXXDESFHADM---SVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSL------GNQASV-VKSQSNNSAIDKQPTVTANPKDLSNSDNVNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLEE--VAG----------KDPIDKAK-EGDXXXXXXXXXXXXXXXXXDSSTSVKSETDNKVXXXXXXXXXXXXRMDSSENQPAVVEENEIKVESKDEEMQEKPISNEEEIKI-FDKDSNXXXXXXXXXXXXXXXXXXXXYLAQSEEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIXXXXXXXXXXXXXXXXXXXAFHMELLKTVESRAR 3041
            + ++KKDG PN ++YE  + +  FD VR WL +N KKY Q +P TNKSL++L  QLLQ+QEE FGK  +   + KLPI CF DFK GGSL HI +A  K+KSDQG RR+DFQ+PSR +RNVEMFM I+  L  + C  +P ++L P I  + + KL+   ++    + E+ N A+H+++P     L  ++  R VM+  + ++LHW   PDS+D WI  S I +    +P P         +  ++  +W+L T   NEWM+EED+ +           ++ P+  RK  +   L   +N    P S            +  K         S     + + +K+N  +  S    +  +   +++ ED     D   P  PN VEEV   +L +   ++  S +  +  +   + DLDE E +G          +   N  +++ + D+   +VTEQ H IIIPSY+AWFDYNS+H IERRALPEFF GKNKSK+ E+Y+AYRNFMIDTYRLNPQEYLT TACRRNL GDVC+I+RVHAFLEQWGLINYQVD E + T   +GPP TSHFHVL D+ +GL  L      G Q     K+      +D     TA  K    S          D   E   P+ + ++ L+TD Y      + +V   S            + ++EW++QETLLLLE LEMYKDDWNKV+EHVGSRTQ+ECIL+FLRLPIEDPYLE   A +  L YQPIPFS+SGNP+MSTVAFLAS VDPR+AS AAK+AL EFS++KEEVP  +V+ H  KV  A +     DP  +GLE   +AG          +   D+A+ EG   +E KE  +      ++     K+    K + E   E +  +  + S+  P V  E E + +   EE+ ++ + +E E K   ++D     L+ AA+ ALAA+A KA++LA  EE+KIK LVA LVE Q+KK+E+KL+ F+ELE I++RE E LE QRQQLL DRQAFHME LK  E RAR
Sbjct:    1 MAVRKKDGGPNVKYYEAADTVTQFDNVRLWLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQEEVFGKHVSNAPLTKLPIKCFLDFKAGGSLCHILAAAYKFKSDQGWRRYDFQNPSRMDRNVEMFMTIEKSLVQNNCLSRPNIFLCPEIEPKLLGKLKDIIKRHQGTVTEDKNNASHVVYPVPGN-LEEEEWVRPVMKRDKQVLLHWGYYPDSYDTWIPASEIEASVEDAPTP--------EKPRKVHAKWILDTDSFNEWMNEEDYEV---------NDDKNPVSRRKKISAKTLTDEVN---SPDS----------DRRDKKGGNYKKRKRSPSPSPTPEAKKKNAKKGPSTPYTKSKRGHREEEQEDLTKDMDEPSP-VPN-VEEV---TLPKTVNTKKDSESAPV--KGGTMTDLDEQEDEGMETTGKDEDESSTGNKGEQTKNPDLHEDNVTEQTHHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQVDAESRPTP--MGPPPTSHFHVLADTPSGLVPLQPKTPQGRQVDADTKAGRKGKELDDLVPETAKGKPELQSSASQQMLNFPDKGKEK--PTDMQNFGLRTDMYT-----KKNVPSKSKAAA--------SATREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLEDSEASLGPLAYQPIPFSQSGNPVMSTVAFLASVVDPRVASAAAKSALEEFSKMKEEVPTALVEAHVRKVEEAAKVTGKADP-AFGLESSGIAGTTSDEPERIEESGTDEARAEGQATDEKKEPKEPREGGVVEEEAKEKTSEAPKKDEEKGKEGDSEKESEKSDGDPIVDSEKEKEPKEGQEEILKEVVESEGERKTKVERDIGEGNLSTAAAAALAAAAVKAKHLAAVEERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREREALEYQRQQLLADRQAFHMEQLKYAEMRAR 977          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Cavefish
Match: smarcc2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 [Source:ZFIN;Acc:ZDB-GENE-100728-1])

HSP 1 Score: 396.356 bits (1017), Expect = 1.116e-118
Identity = 212/368 (57.61%), Postives = 253/368 (68.75%), Query Frame = 3
Query: 1350 FHADMSVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDNVNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLE 2453
             H D +VTEQ H IIIPSY+AWFDYNS+H IERRALPEFF GKNKSK+ E+Y+AYRNFMIDTYRLNPQEYLT TACRRNL GDVC+I+RVHAFLEQWGLINYQVD E + T   +GPP TSHFHVL D+ + L  L  +AS  ++ S+   +    TV   P DL N                         + L+TD Y   + +    N  S              ++EW++QETLLLLEGLEMYKDDWNKV+EHVGSRTQ+ECIL+FLRLPIEDPYLE  ++ +  L YQP+PFS++GNP+MSTVAFLAS VDPR+AS AAK+AL EFSR+KEEVP  +V+ H  +V  A       DP  YGLE
Sbjct:  408 LHED-NVTEQTHHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQVDSESRPTP--MGPPPTSHFHVLADTPSSLVPLQPKAS--QTPSSQQMLSFPDTVKDKPTDLQN-------------------------FGLRTDMYSKKSGSAKGKNAASA-------------TREWTEQETLLLLEGLEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLEDSSSTLGPLAYQPVPFSQAGNPVMSTVAFLASVVDPRVASAAAKSALEEFSRMKEEVPAALVEAHVRRVEEAARVSGRPDP-LYGLE 731          

HSP 2 Score: 224.557 bits (571), Expect = 1.346e-59
Identity = 110/287 (38.33%), Postives = 172/287 (59.93%), Query Frame = 3
Query:   24 LFLKKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWISNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDFLLPGNQQEFAKQANRKPIISRKC 884
            + ++KKDG PN +++E  + ++ FD VR WL +N KKY Q +P TNKSL++L  QLLQ+QEE FG+  +   + KLP+  F DFK GG+L HI +A  K+KSDQG RRFDFQ+PSR +RNVEMFM I+  L  + C  +P+++LS  I  + + KL+   ++    + E+   ++H++ P  +  L +++  R VM+  + ++LHW   PDS+D WIS    +  +   P+        +  ++  +W+L   + NEWM+EED+       E  +   R+  IS K 
Sbjct:    1 MAVRKKDGGPNVKYFEASDTVSQFDNVRVWLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQEEVFGRHVSNPPLTKLPMKSFLDFKAGGALCHILAAAYKFKSDQGWRRFDFQNPSRMDRNVEMFMTIEKSLVQNNCLARPVIYLSSEIEPKLLGKLKDIIKRHQGSVTEDKPSSSHVVVPIPAS-LEDEEWVRPVMKRDKQMLLHWGYWPDSYDTWISASEVEAVVEDAPS------PEKPRKVHAKWILDLDQYNEWMNEEDY-------EVGEGGTRRKRISAKT 273          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Cavefish
Match: smarcc1a (SWI/SNF complex subunit SMARCC1 [Source:NCBI gene;Acc:103036726])

HSP 1 Score: 366.696 bits (940), Expect = 2.120e-107
Identity = 218/427 (51.05%), Postives = 267/427 (62.53%), Query Frame = 3
Query: 1203 NTPSRGASAAGNIDNRNNVLYDLDEETQGSGXXXXXXXXXXXXXXXDESFHA-DMSVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDNVNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLEE--VAGKDP 2474
            N P +G + A           DLDE+  GS  +      +      +    + + +VTEQ H IIIPSYSAWFDYNSIH IERRALPEFF GKNKSKS E+Y+AYRNFMIDTYRLNPQEYLT T+CRRNLTGDVC+++RVHAFLEQWGLINYQVD E +          T HF+VL D+ +GL  L ++   V                           +N   K  D       P+ + ++ L+TD Y    S +S   + S              ++EW++QETLLLLE LEMYKDDWNKV+EHVGSRTQ+ECIL+FLRLPIEDPYLE   A +  L YQP+PFS+SGNP+MSTVAFLAS VDPR+A+ AAKAAL EFSR++EEVP  +V+ H  KV  A  +   VDP  +GLE   +AG  P
Sbjct:  399 NAPVKGGTVA-----------DLDEQENGSVASGGKDDEDQAKAEVNRLIDSGEDNVTEQTHHIIIPSYSAWFDYNSIHEIERRALPEFFNGKNKSKSPEIYLAYRNFMIDTYRLNPQEYLTSTSCRRNLTGDVCAVMRVHAFLEQWGLINYQVDAESRPLPMGPP--PTPHFNVLADTPSGLVPLHHRPPQVPPAQQM---------------------LNFPEKGKDK------PTDLQNFGLRTDMY----SKKSTKGKGSG-------------TREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLESSEATLGPLAYQPVPFSQSGNPVMSTVAFLASVVDPRVAAAAAKAALEEFSRVREEVPAELVEAHVKKVQEAARNTGKVDP-AFGLESSGIAGTAP 767          

HSP 2 Score: 207.608 bits (527), Expect = 5.267e-54
Identity = 99/268 (36.94%), Postives = 162/268 (60.45%), Query Frame = 3
Query:   33 KKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWISNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDFLLPGNQQ 836
            +KKDG P  +F+E+ E +A  + VR W++++ KK+ Q D  + K+LA L  QLLQ+QE+ FG+  +  ++ KLP   F DFKP G+L HI  +  K+KS+QG RRFD Q+PSR +RNVEMFM I+  L  + C  +P+V+++  +  +   KL+   ++    I ++ ++ATH + P  S+   +++  R VMR+ + +++HW   PDS+D W+     D  +   P       S + W +  +W+L T   NEWM+EED+ +  N++
Sbjct:   34 RKKDGGPAGKFWESGETVAQLEAVRQWISKHYKKHVQADSPSCKTLAGLVVQLLQFQEDAFGRRVSNPALTKLPAKSFLDFKPAGALCHILGSAYKFKSEQGWRRFDLQNPSRMDRNVEMFMNIEKTLAQNNCLTRPVVYIASDVDQKQASKLKDIIKRHQGSITDDKSKATHHICPSPSQP-EDEEWLRPVMRKDKQVLVHWGSYPDSYDTWVPVSDVDAEIEDPP------NSEKPWRVHAKWVLDTDAFNEWMNEEDYEVDENRK 294          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Cavefish
Match: smarcc1a (SWI/SNF complex subunit SMARCC1 [Source:NCBI gene;Acc:103036726])

HSP 1 Score: 366.696 bits (940), Expect = 3.145e-107
Identity = 218/427 (51.05%), Postives = 268/427 (62.76%), Query Frame = 3
Query: 1203 NTPSRGASAAGNIDNRNNVLYDLDEETQGSGXXXXXXXXXXXXXXXDESFHA-DMSVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDNVNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLEE--VAGKDP 2474
            N P +G + A           DLDE+  GS  +      +      +    + + +VTEQ H IIIPSYSAWFDYNSIH IERRALPEFF GKNKSKS E+Y+AYRNFMIDTYRLNPQEYLT T+CRRNLTGDVC+++RVHAFLEQWGLINYQVD E +          T HF+VL D+ +GL  L ++                      P+       +N   K  D       P+ + ++ L+TD Y    S +S   + S              ++EW++QETLLLLE LEMYKDDWNKV+EHVGSRTQ+ECIL+FLRLPIEDPYLE   A +  L YQP+PFS+SGNP+MSTVAFLAS VDPR+A+ AAKAAL EFSR++EEVP  +V+ H  KV  A  +   VDP  +GLE   +AG  P
Sbjct:  399 NAPVKGGTVA-----------DLDEQENGSVASGGKDDEDQAKAEVNRLIDSGEDNVTEQTHHIIIPSYSAWFDYNSIHEIERRALPEFFNGKNKSKSPEIYLAYRNFMIDTYRLNPQEYLTSTSCRRNLTGDVCAVMRVHAFLEQWGLINYQVDAESRPLPMGPP--PTPHFNVLADTPSGLVPLHHRP---------------------PQVPPAQQMLNFPEKGKDK------PTDLQNFGLRTDMY----SKKSTKGKGSG-------------TREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLESSEATLGPLAYQPVPFSQSGNPVMSTVAFLASVVDPRVAAAAAKAALEEFSRVREEVPAELVEAHVKKVQEAARNTGKVDP-AFGLESSGIAGTAP 767          

HSP 2 Score: 207.223 bits (526), Expect = 7.391e-54
Identity = 99/268 (36.94%), Postives = 162/268 (60.45%), Query Frame = 3
Query:   33 KKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWISNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDFLLPGNQQ 836
            +KKDG P  +F+E+ E +A  + VR W++++ KK+ Q D  + K+LA L  QLLQ+QE+ FG+  +  ++ KLP   F DFKP G+L HI  +  K+KS+QG RRFD Q+PSR +RNVEMFM I+  L  + C  +P+V+++  +  +   KL+   ++    I ++ ++ATH + P  S+   +++  R VMR+ + +++HW   PDS+D W+     D  +   P       S + W +  +W+L T   NEWM+EED+ +  N++
Sbjct:   34 RKKDGGPAGKFWESGETVAQLEAVRQWISKHYKKHVQADSPSCKTLAGLVVQLLQFQEDAFGRRVSNPALTKLPAKSFLDFKPAGALCHILGSAYKFKSEQGWRRFDLQNPSRMDRNVEMFMNIEKTLAQNNCLTRPVVYIASDVDQKQASKLKDIIKRHQGSITDDKSKATHHICPSPSQP-EDEEWLRPVMRKDKQVLVHWGSYPDSYDTWVPVSDVDAEIEDPP------NSEKPWRVHAKWVLDTDAFNEWMNEEDYEVDENRK 294          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Cavefish
Match: smarcc1b (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1b [Source:ZFIN;Acc:ZDB-GENE-060503-273])

HSP 1 Score: 341.273 bits (874), Expect = 1.500e-100
Identity = 215/436 (49.31%), Postives = 267/436 (61.24%), Query Frame = 3
Query: 1197 GRNTPSRGASAAGNIDNRNNVLYDL-DEETQGSGXXXXXXXXXXXXXXXDESFHADMSVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDN-VNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLEE--VAG--KDPIDKA 2486
            G NTP +G + A   D  +  +  + DEE QG                      ++ S TEQ H IIIPSY++WFDYN IH IERRALPEFF GKNKSKS E+++AYRNF+IDTYRLNPQEYLT T+CRRNLTGDVC+++RVHAFLEQWGLINYQVD E +          T HF+VLTDS + L  L ++                      P  +S S + ++   KS +       PS + ++ L+TD Y   A         S G             +EW++QETLLLLE LEMYKDDWNKV+EHVGSRTQ+ECIL+FLRLPIEDPYLE   A +  L YQP+PFS+SGNP+MSTVAFLAS VDPR+AS AAKAAL EFSR++EE P  +      K      S   +DP  +GL+   V+G   DP++K+
Sbjct:  306 GENTPVKGGTMADLDDQEDEFMSGVRDEEDQGR--------------EFGRGLDSEESATEQTHHIIIPSYTSWFDYNCIHRIERRALPEFFNGKNKSKSPEIFLAYRNFIIDTYRLNPQEYLTSTSCRRNLTGDVCALIRVHAFLEQWGLINYQVDAESRPLPMGPP--PTPHFNVLTDSPSALVPLQHR----------------------PLQVSASQHMLHFPEKSREK------PSDLQNFGLRTDIY---ARKHPKTKGASAG-------------REWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLENSEASLGPLAYQPVPFSQSGNPVMSTVAFLASVVDPRVASAAAKAALEEFSRVREEAPPELF---NPKAPEPGRSLPRLDP-PFGLQSSNVSGPDSDPLEKS 677          

HSP 2 Score: 149.058 bits (375), Expect = 4.215e-36
Identity = 86/266 (32.33%), Postives = 138/266 (51.88%), Query Frame = 3
Query:   33 KKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLA---TLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNW--ISNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDF 815
            ++K G P+  F+E PE  A  + VR+W+ ++ KK       T  S+     +C   +     + G +   + ++ L   CFFD KPGG+L HI  +  K+K++QG RRFD Q+PSR +RNVEMF+ ++  L+ +    +P+V+LSP +  +   KL      I    V  +     L       V   ++  R VMR  + +M+HW   PDS+D    +S++ ++    P P  RP       W++  +W+L T   NEWM+EED+
Sbjct:   16 RRKSGGPSAPFWEGPETAAQLEAVRSWIGKHYKKVRSGGRATANSVCNSVCICVCFV-----SAGTVCVSVCVLYLQAKCFFDMKPGGALCHILGSVYKFKTEQGWRRFDLQNPSRVDRNVEMFVSVEKTLKQNNLLSRPVVYLSPDLDQKQASKLEDI---ITRHQVRRSQFVICLCL-----VCFAEEWFRPVMRVDQDVMVHWGMYPDSYDTLVPVSDVDAEVEEPPTPD-RP-------WKVHVKWVLDTDMFNEWMNEEDY 260          

HSP 3 Score: 60.077 bits (144), Expect = 1.561e-8
Identity = 45/73 (61.64%), Postives = 58/73 (79.45%), Query Frame = 3
Query: 2823 YLAQSEEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIXXXXXXXXXXXXXXXXXXXAFHMELLKTVESRAR 3041
            +LA  EE+KIK LVA LVE Q+KK+E+KL+ F+ELE I++RE E LEQQRQQLL +RQ FH+E +K  E +AR
Sbjct:  740 HLAAVEERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREKEALEQQRQQLLSERQNFHLEQVKYAEIKAR 812          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Cavefish
Match: mysm1 (Myb like, SWIRM and MPN domains 1 [Source:NCBI gene;Acc:103027263])

HSP 1 Score: 61.6178 bits (148), Expect = 5.636e-9
Identity = 32/77 (41.56%), Postives = 48/77 (62.34%), Query Frame = 3
Query: 1443 ERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNL--TGDVCSILRVHAFLEQWGLINYQVDQ 1667
            E++A+PEFF G+  SK+ E Y+  RN+++D +  +  +YL  T+ R  L   GDV  I R+H +LE  G IN+  DQ
Sbjct:  345 EKQAIPEFFEGR-PSKTPERYLKIRNYILDQWEKSKPKYLNKTSVRPGLKNCGDVNCIGRIHTYLELIGAINFNCDQ 420          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006171.1 (pep scaffold:Pmarinus_7.0:GL479547:361:13194:1 gene:ENSPMAG00000005491.1 transcript:ENSPMAT00000006171.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 375.555 bits (963), Expect = 2.289e-111
Identity = 211/381 (55.38%), Postives = 260/381 (68.24%), Query Frame = 3
Query: 1368 VTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDNVNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLE---GDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLEE--VAGKDPIDKAKEG 2495
            VT+Q H I++PSY+AWFDYNSIH IERRALPEFF GKNKSK+ EVY+AYRNFMIDTYRLNPQEYLT TACRRNL GDVC+I+R HAFLEQWGLINYQVD + +  A  +GPP TSHFHVL D+ +GL  L  + + V S         QPT        +NSD      K+ +   E      + ++ L++D Y       +      +G            +++W+DQETLLLLEGLEM+KDDWNKV+EHVGSRTQ+ECIL+FLRLPIEDPYLE   G  + +  L YQP+PFS+ GNP+MSTVAFLAS VDPR+A+ AAKAAL+EF ++KEEVP  +V+ H  KV  A +S    DP  +GLE   +AG  P  + K G
Sbjct:  415 VTDQMHHIVVPSYAAWFDYNSIHAIERRALPEFFNGKNKSKTPEVYLAYRNFMIDTYRLNPQEYLTSTACRRNLAGDVCAIMRAHAFLEQWGLINYQVDTDSRPAA--MGPPPTSHFHVLVDTPSGLVPLQPKTTPVASV--------QPTP-------NNSD------KAKEKTGE------LQNFGLRSDMYAKKDGTSAKSKIAGSG------------ARDWTDQETLLLLEGLEMFKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLEEGVGSLSSLGPLAYQPVPFSQVGNPVMSTVAFLASVVDPRVATAAAKAALDEFQKMKEEVPSALVETHVKKVEEAAKSSGKADPS-FGLESSGIAGTAPEQQEKIG 753          

HSP 2 Score: 224.172 bits (570), Expect = 5.120e-60
Identity = 110/261 (42.15%), Postives = 159/261 (60.92%), Query Frame = 3
Query:   33 KKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWISNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDF 815
            +KKDG PN +F E+ + +A FD VR WL ++ KKY Q +P TNKSLA L  QLLQ+QEE  GK  +   + ++P+ CF DFK GGSL  I +A  K+KSDQG RRFDFQ+PSR +RNVEMFM I+  L  + C  +P ++L P I  +   KL+   ++    + ++ + A+H++FP  +     D+  R VM++ R ++LHW   PDS+D W+     D  +   P        N  W++  +W+L T   NEWM+EED+
Sbjct:    4 RKKDGGPNVKFLESTDTVAQFDNVRQWLGKHYKKYIQAEPPTNKSLAGLVIQLLQFQEEVMGKHVSNPPLTRIPMKCFMDFKAGGSLCQILAAVYKFKSDQGWRRFDFQNPSRMDRNVEMFMTIEKLLVQNNCLSRPNIYLHPDIDHKLASKLKDIVKRHQGSLTDDKSNASHVVFPLPAN-HDEDEWVRPVMKKDRQMLLHWGFYPDSYDTWLMANEVDAEVEDMPP------RNGPWKVHVKWILDTDTFNEWMNEEDY 257          

HSP 3 Score: 67.3958 bits (163), Expect = 2.125e-11
Identity = 49/73 (67.12%), Postives = 59/73 (80.82%), Query Frame = 3
Query: 2823 YLAQSEEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIXXXXXXXXXXXXXXXXXXXAFHMELLKTVESRAR 3041
            +LA  EE+KIK LVA LVE Q+KK+E+KL+ F+ELE+I++RE E LE QRQQLL DRQAFHME LK  E RAR
Sbjct:  907 HLAAVEERKIKSLVALLVETQMKKLEIKLRHFEELESIMDREREALEYQRQQLLADRQAFHMEQLKYAEMRAR 979          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007866.1 (pep scaffold:Pmarinus_7.0:GL477456:337314:352717:-1 gene:ENSPMAG00000007110.1 transcript:ENSPMAT00000007866.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 143.28 bits (360), Expect = 6.375e-37
Identity = 70/97 (72.16%), Postives = 81/97 (83.51%), Query Frame = 3
Query: 2076 GLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVP 2366
             L++Y DDWNKV+EHVGSRTQ+ECIL+FLRLPIEDPYLE   A M  L YQP+PFS+SGNP+MSTVAFLAS VDPR+AS AAKAAL EFS  +  +P
Sbjct:   11 ALDLYTDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLEESEASMGPLAYQPVPFSRSGNPVMSTVAFLASVVDPRVASAAAKAALEEFSHRRVLLP 107          

HSP 2 Score: 59.6918 bits (143), Expect = 2.541e-9
Identity = 43/68 (63.24%), Postives = 53/68 (77.94%), Query Frame = 3
Query: 2838 EEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIXXXXXXXXXXXXXXXXXXXAFHMELLKTVESRAR 3041
            EE+KIK LVA LVE Q+KK+E+KL+ F+ELE I++RE E LE QRQQLL DR  FH+E +K  E RAR
Sbjct:  324 EERKIKSLVALLVETQMKKLEIKLRHFEELETIMDRERESLEYQRQQLLSDRSTFHLEQIKLAELRAR 391          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001387.1 (pep scaffold:Pmarinus_7.0:GL477098:21548:26970:1 gene:ENSPMAG00000001246.1 transcript:ENSPMAT00000001387.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.8398 bits (133), Expect = 2.841e-8
Identity = 34/74 (45.95%), Postives = 45/74 (60.81%), Query Frame = 3
Query: 1443 ERRALPEFFIGKNKSKSAEVYMAYRNFMIDTY-RLNPQEYLTFTACRRNLT--GDVCSILRVHAFLEQWGLINY 1655
            ERRA  EFF G+  SK+ E Y+  RN++++ + R+ P+ YL  TA R  L   GDV  I RVH  LE  G IN+
Sbjct:  246 ERRASEEFFQGR-PSKTPERYLKIRNYIVEEWERIRPR-YLNKTAVRSGLKNCGDVNCIGRVHTALELLGAINF 317          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001389.1 (pep scaffold:Pmarinus_7.0:GL477098:21548:25278:1 gene:ENSPMAG00000001246.1 transcript:ENSPMAT00000001389.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.4546 bits (132), Expect = 3.648e-8
Identity = 34/74 (45.95%), Postives = 45/74 (60.81%), Query Frame = 3
Query: 1443 ERRALPEFFIGKNKSKSAEVYMAYRNFMIDTY-RLNPQEYLTFTACRRNLT--GDVCSILRVHAFLEQWGLINY 1655
            ERRA  EFF G+  SK+ E Y+  RN++++ + R+ P+ YL  TA R  L   GDV  I RVH  LE  G IN+
Sbjct:  264 ERRASEEFFQGR-PSKTPERYLKIRNYIVEEWERIRPR-YLNKTAVRSGLKNCGDVNCIGRVHTALELLGAINF 335          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001385.1 (pep scaffold:Pmarinus_7.0:GL477098:15783:25278:1 gene:ENSPMAG00000001246.1 transcript:ENSPMAT00000001385.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.8398 bits (133), Expect = 4.220e-8
Identity = 34/74 (45.95%), Postives = 45/74 (60.81%), Query Frame = 3
Query: 1443 ERRALPEFFIGKNKSKSAEVYMAYRNFMIDTY-RLNPQEYLTFTACRRNLT--GDVCSILRVHAFLEQWGLINY 1655
            ERRA  EFF G+  SK+ E Y+  RN++++ + R+ P+ YL  TA R  L   GDV  I RVH  LE  G IN+
Sbjct:  333 ERRASEEFFQGR-PSKTPERYLKIRNYIVEEWERIRPR-YLNKTAVRSGLKNCGDVNCIGRVHTALELLGAINF 404          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Yeast
Match: SWI3 (Subunit of the SWI/SNF chromatin remodeling complex; SWI/SNF regulates transcription by remodeling chromosomes; contains SANT domain that is required for SWI/SNF assembly; is essential for displacement of histone H2A-H2B dimers during ATP-dependent remodeling; required for transcription of many genes, including ADH1, ADH2, GAL1, HO, INO1 and SUC2; relocates to the cytosol under hypoxic conditions [Source:SGD;Acc:S000003712])

HSP 1 Score: 222.246 bits (565), Expect = 1.622e-60
Identity = 131/370 (35.41%), Postives = 193/370 (52.16%), Query Frame = 3
Query: 1377 QAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVV--------KSQSNNSAIDKQPTV-------------TANPKDLSNSDNVNLQSKSADSNNETCMPSSIS-DYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDA-------ALMETLCYQP-IPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRL---KEEVPEYMVKEH 2387
            QAH I+IPSYS WF+   IH IE ++LPEFF  +  SK+ EVYM YRNFM+++YRLNP EY + T  RRN++GD  ++ R+H FL +WGLINYQVD   K+   ++ PP TS +    D+  GL    +    V        K   N S  D + T+               +P   ++ +N +        NNE    +S++ D +L              + E  T   +     L    + WS ++   LL+G++ +  DW KVA++VG+++ E+CIL FL+LPIED +L GD          +  L Y P +PFSKS NP++ST+AFL   V+P+      + A+     +   KEE+ +    EH
Sbjct:  301 QAHEIVIPSYSKWFNLEKIHSIEVQSLPEFFTNRIPSKTPEVYMRYRNFMVNSYRLNPNEYFSVTTARRNVSGDAAALFRLHKFLTKWGLINYQVD--SKLLPKNIEPPLTSQYSTRHDAPRGLFPFESYKPSVQLPDMAKLKKMMNTS--DSESTLYKYLKESKRKYDEITHPPSTTDDENGDKNDNGGKMNNEVSTSTSMTGDANL--------------LEEGETSRPLKKVKILEQIDENWSKEDLQKLLKGIQEFGADWYKVAKNVGNKSPEQCILRFLQLPIEDKFLYGDGNGKGDNDNGLGPLKYAPHLPFSKSENPVLSTIAFLVGLVNPKTVQSMTQRAIQSAESIKSQKEEISDQKPIEH 652          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Yeast
Match: RSC8 (Component of the RSC chromatin remodeling complex; essential for viability and mitotic growth; homolog of SWI/SNF subunit Swi3p, but unlike Swi3p, does not activate transcription of reporters [Source:SGD;Acc:S000001933])

HSP 1 Score: 195.282 bits (495), Expect = 2.100e-53
Identity = 118/314 (37.58%), Postives = 169/314 (53.82%), Query Frame = 3
Query: 1368 VTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTAN-PKDLSNSDNV--------NLQSKSADSNN-------ETCMPSSIS-----------------------DYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQ-EECILYFLRLPIEDPYL 2189
            + +Q H +IIPS+++WFD + IH IE+R+ P+FF   ++ K+ + Y   RNF+I+TYRL+P EYLT TA RRN+  DV SI+++HAFLE+WGLINYQ+D   K +   +GP  T HF V+ D+  GL+    + +V+K Q        +P V    P +L+   NV         LQ +S +S          TC   SI+                         + Q+  +I + +N + V +N                  WSDQE LLLLEG+EMY+D W K+A+HVG   + E+CI  FL LPIED Y+
Sbjct:   73 LAKQTHPVIIPSFASWFDISKIHEIEKRSNPDFFNDSSRFKTPKAYKDTRNFIINTYRLSPYEYLTITAVRRNVAMDVASIVKIHAFLEKWGLINYQIDPRTKPSL--IGPSFTGHFQVVLDTPQGLKPFLPE-NVIK-QEVEGGDGAEPQVKKEFPVNLTIKKNVYDSAQDFNALQDESRNSRQIHKVYICHTCGNESINVRYHNLRARDTNLCSRCFQEGHFGANFQSSDFIRLENNGNSVKKN------------------WSDQEMLLLLEGIEMYEDQWEKIADHVGGHKRVEDCIEKFLSLPIEDNYI 364          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Nematostella
Match: EDO49454 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGR1])

HSP 1 Score: 377.481 bits (968), Expect = 5.162e-113
Identity = 190/352 (53.98%), Postives = 241/352 (68.47%), Query Frame = 3
Query: 1359 DMSVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDNVNLQSKSADSNNET--CMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTA 2408
            D ++TEQ H I+IPSY++W+DYNSIH IERRALPEFF G+N+SK+ E+Y+A RNFMID YRLNP EYLT TACRRNL GDVC+I+R+HAFLEQWGLINYQVD + +     +GPP TSHFHV+ D+  GLQ L                         PK + +     +Q K      ET    PSS +++ L TDQY++  S ++                    +KEW+DQETLLLLEG+E++KDDWNKVAEHVG+RTQ+ECIL+FLRLPIEDP+LE     +  L +QP+PFS+ GNPIMSTVAFLAS VDPR+AS AAKAAL EFS++++E+PE ++  H    T+A
Sbjct:  423 DENLTEQTHHIVIPSYASWYDYNSIHAIERRALPEFFNGQNRSKTPEIYLAMRNFMIDAYRLNPTEYLTATACRRNLAGDVCAIVRIHAFLEQWGLINYQVDADSR--PAPMGPPATSHFHVMADTPAGLQPL-----------------------QLPKSMISPSQQMMQFKDEHGLRETPKSQPSS-TNFGLHTDQYLSKKSQKAATA-----------------TKEWTDQETLLLLEGMELFKDDWNKVAEHVGTRTQDECILHFLRLPIEDPFLED--MKLGPLTFQPVPFSQQGNPIMSTVAFLASVVDPRVASAAAKAALEEFSKMRDEIPEAIIDSHVKSATSA 729          

HSP 2 Score: 193.741 bits (491), Expect = 2.469e-50
Identity = 113/295 (38.31%), Postives = 166/295 (56.27%), Query Frame = 3
Query:   24 LFLKKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWISNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDFLLPGNQQEFAKQANRKPIISRKCYNGDDLNV 908
            + ++KKDG P+ ++YE  E  ALF+ V+ +L +N KKY Q +P TNK LATL  QLLQ+QE+ FG    +  + KLPI  F D+   G L  I +   K ++DQG RRFDFQSPSR +RNVEMF+ I+  ++  K    P V+++  +    V KLR   ++ +  IV++   ATH++       L  +D  R + +    +++HW   PDS+D W   +PS   L  EP   P       WE+  RWL    + NEWM+EED+ + G   E A +A RK    R   + D++N+
Sbjct:    1 MAVRKKDGGPDWKYYETSEAAALFEPVKQYLLKNHKKYVQVEPPTNKGLATLVAQLLQFQEDNFGHTVAKPPLTKLPIKLFQDYSANGGLCTILACVYKTRTDQGWRRFDFQSPSRIDRNVEMFLNIERAVKEAKLLMIPQVYIAQDVDQSQVAKLRDIVKRHNGNIVDDKTSATHIVH-ACPPPLPEEDWLRPLKKNEGQVLVHWWYYPDSYDTW---VPSTDVLD-EPQPEP--DHKGPWEVTGRWLTDLEKYNEWMNEEDYEI-GVDGE-ASRARRKSFRGRA--SSDEVNM 284          

HSP 3 Score: 63.5438 bits (153), Expect = 4.965e-10
Identity = 52/104 (50.00%), Postives = 66/104 (63.46%), Query Frame = 3
Query: 2832 QSEEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIXXXXXXXXXXXXXXXXXXXAFHMELLKTVESRARVVGHNQFHPINNINHQGSYHNASQ--AISQNPSV 3137
            Q EE+KIK LVA LVE Q+KK+E+KL+ F+ELE I++RE E LE QRQQLL +RQ FH E L+  E RAR    +   P + +      HNA Q  A+ Q P  
Sbjct:  857 QVEERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREREALEYQRQQLLAERQQFHQEQLRAAELRARASHMSPSTPTSTV------HNAPQAHAVPQQPGT 954          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Medaka
Match: ENSORLT00000019896.2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily c member 1 [Source:NCBI gene;Acc:101157086])

HSP 1 Score: 365.54 bits (937), Expect = 9.645e-107
Identity = 209/368 (56.79%), Postives = 246/368 (66.85%), Query Frame = 3
Query: 1368 VTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDNVNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLEE--VAG 2465
            VTEQ H IIIPSY AWFDYNSIH IERRALPEFF GKNKSK+ E+Y+AYRNFMIDTYRLNPQEYLT T+CRRNLTGDVC+I+RVHAFLEQWGL+NYQVD E +          T HF VL D+ +GL  L ++   +  Q        QP               N   KS D       P  + ++ L+ D Y       S  N  S  G+          +++W++QETLLLLE LEM+KDDWNKV+EHVGSRTQ+ECIL+FLRLPIEDPYLE   A +  L YQPIPFS+SGNP+MSTVAFLAS VDPR+AS AAKAAL EFSR++EEVP  +V+ H  KV  A  S   VDP  +GLE   +AG
Sbjct:  450 VTEQTHHIIIPSYGAWFDYNSIHEIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTSCRRNLTGDVCAIMRVHAFLEQWGLVNYQVDSESRPLPMGPP--PTPHFTVLADTPSGLMPLNHRPPTIPPQ--------QPMP-------------NFADKSKDK------PIDLQNFGLRADLY-------SKKNTKSKAGIA---------TRDWTEQETLLLLEALEMFKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLENTEASLGPLAYQPIPFSQSGNPVMSTVAFLASVVDPRVASAAAKAALEEFSRVREEVPAELVEAHVKKVQEAARSTGKVDP-TFGLESSGIAG 771          

HSP 2 Score: 224.557 bits (571), Expect = 2.206e-59
Identity = 108/283 (38.16%), Postives = 173/283 (61.13%), Query Frame = 3
Query:   33 KKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWISNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDFLLPGNQQEFAKQANRKPIISRK 881
            +KKDG P+ +F+E+ E ++  ++VR W+ ++ KKY QND  ++KSLA L  QLLQ+QE+ FG+  N  ++ KLP  CF DFK GG+L HI  +  K+KS+QG RRFD Q+PSR +RNVEMF+ ++  L  + C  +PIV+LSP +  +   KL+   ++    I E+ ++ATH ++P   +    ++  R V+R+ + +++HW   PDS+D W+S    D  +   P        ++ W++  +W+L T   NEWM+EED+ +           N+KP+ SR+
Sbjct:   59 RKKDGGPSTKFWESSETVSQLESVRLWIGKHYKKYVQNDSPSSKSLAGLVVQLLQFQEDAFGRRVNNPALTKLPAKCFMDFKAGGALCHILGSVYKFKSEQGWRRFDLQNPSRMDRNVEMFLNVEKNLVQNNCLTRPIVFLSPDVEPKQASKLKDIIKRHQGSITEDKSKATHHIYPSPGQ-QEEEEWLRPVIRKDKQVLVHWGLYPDSYDTWVSAGEVDADVEDPP------NGDKPWKVHAKWVLDTDAFNEWMNEEDYEV---------DENKKPVNSRQ 325          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Medaka
Match: smarcc1b (SWI/SNF complex subunit SMARCC1 [Source:NCBI gene;Acc:101164905])

HSP 1 Score: 313.153 bits (801), Expect = 9.089e-90
Identity = 179/331 (54.08%), Postives = 222/331 (67.07%), Query Frame = 3
Query: 1368 VTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDNVNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEE 2360
            + EQ H IIIPSY++WF+ NSIH IE+RALPEFF GKNKSK+ E+Y+AYRNFMIDTYRLNPQEYL+ T CRRNLTGDVCS++RVHAFLEQWGLINYQVD E +          T HF+VL D+ +GL  L ++                      P  +S S ++    +     +  C      ++ L+TD Y          N           AG     +EW++QETLLLLE LE+Y+DDWNKV+EHVGSRTQ+ECIL+FLRLPIEDPYLE  ++ +  L YQP+PFS+S NP+MSTVAFLAS VDPR+AS AAKAAL EFS+++EE
Sbjct:  409 IVEQTHHIIIPSYTSWFNNNSIHSIEKRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLSSTTCRRNLTGDVCSLIRVHAFLEQWGLINYQVDAESRPLPMGPP--PTPHFNVLADTPSGLAPLQHK----------------------PLQVSASQHMLYFPERGREKSTDC-----QNFGLRTDVYARKHPKAKGAN-----------AG-----REWTEQETLLLLEALEVYRDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLEDSSSSLGPLAYQPVPFSQSENPVMSTVAFLASVVDPRVASAAAKAALEEFSKVQEE 694          

HSP 2 Score: 191.045 bits (484), Expect = 4.527e-49
Identity = 99/263 (37.64%), Postives = 150/263 (57.03%), Query Frame = 3
Query:   33 KKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWISNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDFLL 821
            +KK+  P+  F+++P+ ++  + VR W+ R+ KKY   D  + +SLA L  QLLQ+QE+ FG+  +  ++ KLP HCF D +PGG LSHI     K+K +QG RRFD Q+PSRTERN+EMF  I+  L  + C   P+V L  ++  +   +L     +    I E+   A+H +   ++  +  D+  R VMR    I +HW   PDS+D W+S+  SD     E  +  ++   + W +   WLL T   NEWM+EED+ L
Sbjct:   23 RKKECSPSAWFWDSPDTLSQLELVRQWIGRHYKKYVVVDAPSCQSLAALTMQLLQFQEDAFGRHASNPALTKLPAHCFVDLRPGGGLSHILGTAYKFKVEQGWRRFDLQNPSRTERNIEMFAVIEKTLLQNNCISLPVVCLDSSLDPDLTSRLSAIILRHQGSITEDRAMASHHVC-ASAAPIDEDEWMRPVMRRDNHIQVHWGMHPDSYDRWLSS--SDV----EGDVEELLHIQRPWRVHAGWLLDTDVFNEWMNEEDYCL 278          

HSP 3 Score: 60.077 bits (144), Expect = 1.743e-8
Identity = 45/73 (61.64%), Postives = 56/73 (76.71%), Query Frame = 3
Query: 2823 YLAQSEEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIXXXXXXXXXXXXXXXXXXXAFHMELLKTVESRAR 3041
            +LA  EE+KIK LVA LVE Q+KK+E+KL+ F+ELE I++RE E LEQQRQQLL +RQ FH E LK  E + R
Sbjct:  809 HLAAVEERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREKEALEQQRQQLLTERQTFHTEQLKQAELKVR 881          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Medaka
Match: smarcc1b (SWI/SNF complex subunit SMARCC1 [Source:NCBI gene;Acc:101164905])

HSP 1 Score: 300.442 bits (768), Expect = 5.375e-86
Identity = 174/323 (53.87%), Postives = 214/323 (66.25%), Query Frame = 3
Query: 1368 VTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDNVNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALN 2336
            + EQ H IIIPSY++WF+ NSIH IE+RALPEFF GKNKSK+ E+Y+AYRNFMIDTYRLNPQEYL+ T CRRNLTGDVCS++RVHAFLEQWGLINYQVD E +          T HF+VL D+ +GL  L ++                      P  +S S ++    +     +  C      ++ L+TD Y          N           AG     +EW++QETLLLLE LE+Y+DDWNKV+EHVGSRTQ+ECIL+FLRLPIEDPYLE  ++ +  L YQP+PFS+S NP+MSTVAFLAS VDPR+AS AAKAAL 
Sbjct:  413 IVEQTHHIIIPSYTSWFNNNSIHSIEKRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLSSTTCRRNLTGDVCSLIRVHAFLEQWGLINYQVDAESRPLPMGPP--PTPHFNVLADTPSGLAPLQHK----------------------PLQVSASQHMLYFPERGREKSTDC-----QNFGLRTDVYARKHPKAKGAN-----------AG-----REWTEQETLLLLEALEVYRDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLEDSSSSLGPLAYQPVPFSQSENPVMSTVAFLASVVDPRVASAAAKAALG 690          

HSP 2 Score: 188.734 bits (478), Expect = 1.298e-48
Identity = 99/263 (37.64%), Postives = 149/263 (56.65%), Query Frame = 3
Query:   33 KKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWISNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDFLL 821
            +KK+  P+  F+++P+ ++  + VR W+ R+ KKY   D  + +SLA L  QLLQ+QE+ FG+  +  ++ KLP HCF D +PGG LSHI     K+K +QG RRFD Q+PSRTERN+EMF  I+  L  + C   P+V L  ++  +   +L     +    I E+   A+H +    + +   D+  R VMR    I +HW   PDS+D W+S+  SD     E  +  ++   + W +   WLL T   NEWM+EED+ L
Sbjct:   27 RKKECSPSAWFWDSPDTLSQLELVRQWIGRHYKKYVVVDAPSCQSLAALTMQLLQFQEDAFGRHASNPALTKLPAHCFVDLRPGGGLSHILGTAYKFKVEQGWRRFDLQNPSRTERNIEMFAVIEKTLLQNNCISLPVVCLDSSLDPDLTSRLSAIILRHQGSITEDRAMASHHVCASAAPI-DEDEWMRPVMRRDNHIQVHWGMHPDSYDRWLSS--SDV----EGDVEELLHIQRPWRVHAGWLLDTDVFNEWMNEEDYCL 282          

HSP 3 Score: 59.3066 bits (142), Expect = 2.548e-8
Identity = 45/73 (61.64%), Postives = 56/73 (76.71%), Query Frame = 3
Query: 2823 YLAQSEEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIXXXXXXXXXXXXXXXXXXXAFHMELLKTVESRAR 3041
            +LA  EE+KIK LVA LVE Q+KK+E+KL+ F+ELE I++RE E LEQQRQQLL +RQ FH E LK  E + R
Sbjct:  736 HLAAVEERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREKEALEQQRQQLLTERQTFHTEQLKQAELKVR 808          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Medaka
Match: smarcc2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 [Source:ZFIN;Acc:ZDB-GENE-100728-1])

HSP 1 Score: 223.016 bits (567), Expect = 6.512e-63
Identity = 108/269 (40.15%), Postives = 168/269 (62.45%), Query Frame = 3
Query:   15 VTMLFLKKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWI--SNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDF 815
            + ++ ++KKDG PN +++E  + ++ FD VR WL +N KKY Q +P TNKSL++L  QLLQ+QEE FG+  +   + KLP+ CF DFK GG+L HI +A  K+KSDQG RRFDFQ+PSR +RNVEMFM I+  L  + C  +P+++LS  I  + + KL+   ++    + E+ + ++H++ P  +  L  ++  R VM+  + ++LHW   PDS+D WI  S I +     P P         +  ++  +W+L   + NEWM+EED+
Sbjct:    4 LGLMAVRKKDGGPNVKYFEASDTVSQFDNVRVWLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQEEVFGRHVSNPPLTKLPMKCFLDFKSGGALCHILAAAYKFKSDQGWRRFDFQNPSRMDRNVEMFMTIEKSLVQNHCLSRPVIYLSSDIDPKLLGKLKDIIKRHQGSVAEDKSNSSHIVVPIPAS-LEEEEWVRPVMKRDKQVLLHWGYFPDSYDTWIPASEIEAAVEDPPTP--------EKPRKVHAKWILDLDQYNEWMNEEDY 263          

HSP 2 Score: 82.8037 bits (203), Expect = 6.228e-16
Identity = 38/51 (74.51%), Postives = 43/51 (84.31%), Query Frame = 3
Query: 1350 FHADMSVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEV 1502
             H D +VTEQ H IIIPSY+AWFDYNS+H IERRALPEFF GKNKSK+ E+
Sbjct:  404 LHED-NVTEQTHHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEM 453          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Planmine SMEST
Match: SMESG000031576.1 (SMESG000031576.1)

HSP 1 Score: 2024.98 bits (5245), Expect = 0.000e+0
Identity = 1219/1258 (96.90%), Postives = 1224/1258 (97.30%), Query Frame = 3
Query:   21 MLFLKKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWISNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDFLLPGNQQEFAKQANRKPIISRKCYNGDDLNVMLNVSSQPSSVGXXXXXXXXXXXXXXXXXXXXXXXXNKEDNSGKRRKQNVVRAASLANLRKSKVKEXXXXXXXXXXXXXXXPECPNRVEEVPSNSLGRNTPSRGASAAGNIDNRNNVLYDLDEETQGSGXXXXXXXXXXXXXXXDESFHADMSVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDNVNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLEEVAGKDPIDKAKEGDXXXXXXXXXXXXXXXXXDSSTSVKSETDNKVXXXXXXXXXXXXRMDSSENQPAVVEENEIKVESKDEEMQEKPISNEEEIKIFDKDSNXXXXXXXXXXXXXXXXXXXXYLAQSEEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIXXXXXXXXXXXXXXXXXXXAFHMELLKTVESRARVVGHNQFHPINNINHQGSYHNASQAISQNPSVQHQQAGTLPTQQFPQNQVIQQHXXXXXXXXXXXXXXXQHNTSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNMQTPQHQSNMAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITQQYSXXXXXXXXXXXXAAYQNVGMS-AAAAAARKPTDINFSEQQIPHQQVSNQSLQNTQQMNPIHHLSSQPDPDGNNTNVNIN 3791
            MLFLKKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAET+EKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWISNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDFLLPGNQQEFAKQANRKPIISRKCYNGDDLNVMLNVSSQPSSVGDQQQSSAQSLKKDKKKRKLSPSPSNKEDNSGKRRKQNVVRAASLANLRKSKVKEDDDYEDDDVTKDLDDPECPNRVEEVPSNSLGRNTPSRGASAAGNIDNRNNVLYDLDEETQGSGINNNSAAANPNSNIADESFHADMSVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDNVNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLEEVAGKDPIDKAKEGDN E AKEEIKV VKENIDSSTSVKSETDNKVETESHTESEGTERMDSSENQPAVVEENEIKVESKDEEMQEKPISNEEEIKIFDKDSNSRRLAEAASVALAASATKARYLAQSEEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIEREYEVLEQQRQQLLLDRQAFHMELLKTVESRARVVGHNQFHPINNINHQGSYHNASQAISQNPSVQHQQAGTLPTQQFPQNQVIQQHNPNPVPLQYPPNPMPQHNTSMQSNQIPQHNQSIQQQYPQNLPPPPPQHQSNMQTPQHQSNMA    Q+ Q     + P +   Q         Q   + SSSQHQQNMH QNITQQYSQGPLPPQTQQQQAAYQNVGMS  AAAAARKPTDINFSEQQIPHQQVSNQSLQNTQQMNPIHHLSSQPDPDGNNTNVNIN
Sbjct:    1 MLFLKKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETIEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWISNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDFLLPGNQQEFAKQANRKPIISRKCYNGDDLNVMLNVSSQPSSVGDQQQSSAQSLKKDKKKRKLSPSPSNKEDNSGKRRKQNVVRAASLANLRKSKVKEDDDYEDDDVTKDLDDPECPNRVEEVPSNSLGRNTPSRGASAAGNIDNRNNVLYDLDEETQGSGINNNSAAANPNSNIADESFHADMSVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDNVNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLEEVAGKDPIDKAKEGDNEEGAKEEIKVGVKENIDSSTSVKSETDNKVETESHTESEGTERMDSSENQPAVVEENEIKVESKDEEMQEKPISNEEEIKIFDKDSNSRRLAEAASVALAASATKARYLAQSEEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIEREYEVLEQQRQQLLLDRQAFHMELLKTVESRARVVGHNQFHPINNINHQGSYHNASQAISQNPSVQHQQAGTLPTQQFPQNQVIQQHNPNPVPLQYPPNPMPQHNTSMQSNQIPQHNQSIQQQYPQNLPPPPPQHQSNMQTPQHQSNMA---PQHQQNLQPQHQPNMPPIQHQQQLPIPTQTPQNMSSSQHQQNMHPQNITQQYSQGPLPPQTQQQQAAYQNVGMSAVAAAAARKPTDINFSEQQIPHQQVSNQSLQNTQQMNPIHHLSSQPDPDGNNTNVNIN 1255          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Planmine SMEST
Match: SMESG000013315.1 (SMESG000013315.1)

HSP 1 Score: 2024.98 bits (5245), Expect = 0.000e+0
Identity = 1224/1258 (97.30%), Postives = 1226/1258 (97.46%), Query Frame = 3
Query:   21 MLFLKKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWISNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDFLLPGNQQEFAKQANRKPIISRKCYNGDDLNVMLNVSSQPSSVGXXXXXXXXXXXXXXXXXXXXXXXXNKEDNSGKRRKQNVVRAASLANLRKSKVKEXXXXXXXXXXXXXXXPECPNRVEEVPSNSLGRNTPSRGASAAGNIDNRNNVLYDLDEETQGSGXXXXXXXXXXXXXXXDESFHADMSVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDNVNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLEEVAGKDPIDKAKEGDXXXXXXXXXXXXXXXXXDSSTSVKSETDNKVXXXXXXXXXXXXRMDSSENQPAVVEENEIKVESKDEEMQEKPISNEEEIKIFDKDSNXXXXXXXXXXXXXXXXXXXXYLAQSEEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIXXXXXXXXXXXXXXXXXXXAFHMELLKTVESRARVVGHNQFHPINNINHQGSYHNASQAISQNPSVQHQQAGTLPTQQFPQNQVIQQHXXXXXXXXXXXXXXXQHNTSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNMQTPQHQSNMAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITQQYSXXXXXXXXXXXXAAYQNVGMS-AAAAAARKPTDINFSEQQIPHQQVSNQSLQNTQQMNPIHHLSSQPDPDGNNTNVNIN 3791
            MLFLKKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLF KNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWISNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDFLLPGNQQEFAKQANRKPIISRKCYNGDDLNVMLNVSSQPSSVGDQQQSSAQSLKKDKKKRKLSPSPSNKEDNSGKRRKQNVVRAASLANLRKSKVKEDDDYEDDDVTKDLDDPECPNRVEEVPSNSLGRNTPSRGASAAGNIDNRNNVLYDLDEETQGSGINNNSAAANPNSNIADESFHADMSVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDNVNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLEEVAGKDPIDKAKEGDN E AKEEIKVAVKENIDSSTSVKSETDNKVETESHTESEGTERMDSSENQPAVVEENEIKVESKDEEMQEKPISNEEEIKIFDKDSNSRRLAEAASVALAASATKARYLAQSEEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIEREYEVLEQQRQQLLLDRQAFHMELLKTVESRARVVGHNQFHPINNINHQGSYHNASQAISQNPSVQHQQAGTLPTQQFPQNQVIQQHNPNPVPLQYPPNPMPQHNTSMQSNQIPQHNQSIQQQYPQNLPPPPPQHQSNMQTPQHQSNMA   Q     Q Q        Q Q  +P  T    + SSSSQHQQNMHTQNITQQYSQGPLPPQTQQQQAAYQNVGMS  AAAAARKPTDINFSEQQIPHQQVSNQSLQNTQQMNPIHHLSSQPDPDGNNTNVNIN
Sbjct:    1 MLFLKKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLFSKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWISNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDFLLPGNQQEFAKQANRKPIISRKCYNGDDLNVMLNVSSQPSSVGDQQQSSAQSLKKDKKKRKLSPSPSNKEDNSGKRRKQNVVRAASLANLRKSKVKEDDDYEDDDVTKDLDDPECPNRVEEVPSNSLGRNTPSRGASAAGNIDNRNNVLYDLDEETQGSGINNNSAAANPNSNIADESFHADMSVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDNVNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLEEVAGKDPIDKAKEGDNEEGAKEEIKVAVKENIDSSTSVKSETDNKVETESHTESEGTERMDSSENQPAVVEENEIKVESKDEEMQEKPISNEEEIKIFDKDSNSRRLAEAASVALAASATKARYLAQSEEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIEREYEVLEQQRQQLLLDRQAFHMELLKTVESRARVVGHNQFHPINNINHQGSYHNASQAISQNPSVQHQQAGTLPTQQFPQNQVIQQHNPNPVPLQYPPNPMPQHNTSMQSNQIPQHNQSIQQQYPQNLPPPPPQHQSNMQTPQHQSNMA--PQHQQNLQPQHQPNMPPIQHQQQLPIPTQTPQNMSSSSQHQQNMHTQNITQQYSQGPLPPQTQQQQAAYQNVGMSAVAAAAARKPTDINFSEQQIPHQQVSNQSLQNTQQMNPIHHLSSQPDPDGNNTNVNIN 1256          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Planmine SMEST
Match: SMESG000031576.1 (SMESG000031576.1)

HSP 1 Score: 2016.12 bits (5222), Expect = 0.000e+0
Identity = 1212/1258 (96.34%), Postives = 1217/1258 (96.74%), Query Frame = 3
Query:   21 MLFLKKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWISNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDFLLPGNQQEFAKQANRKPIISRKCYNGDDLNVMLNVSSQPSSVGXXXXXXXXXXXXXXXXXXXXXXXXNKEDNSGKRRKQNVVRAASLANLRKSKVKEXXXXXXXXXXXXXXXPECPNRVEEVPSNSLGRNTPSRGASAAGNIDNRNNVLYDLDEETQGSGXXXXXXXXXXXXXXXDESFHADMSVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDNVNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLEEVAGKDPIDKAKEGDXXXXXXXXXXXXXXXXXDSSTSVKSETDNKVXXXXXXXXXXXXRMDSSENQPAVVEENEIKVESKDEEMQEKPISNEEEIKIFDKDSNXXXXXXXXXXXXXXXXXXXXYLAQSEEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIXXXXXXXXXXXXXXXXXXXAFHMELLKTVESRARVVGHNQFHPINNINHQGSYHNASQAISQNPSVQHQQAGTLPTQQFPQNQVIQQHXXXXXXXXXXXXXXXQHNTSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNMQTPQHQSNMAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITQQYSXXXXXXXXXXXXAAYQNVGMS-AAAAAARKPTDINFSEQQIPHQQVSNQSLQNTQQMNPIHHLSSQPDPDGNNTNVNIN 3791
            MLFLKKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAET+EKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWISNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDFLLPGNQQEFAKQANRKPIISRKCYNGDDLNVMLNVSSQPSSVGDQQQSSAQSLKKDKKKRKLSPSPSNKEDNSGKRRKQNVVRAASLANLRKSKVKEDDDYEDDDVTKDLDDPECPNRVEEVPSNSLGRNTPSRGASAAGNIDNRNNVLYDLDEETQGSGINNNSAAANPNSNIADESFHADMSVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDNVNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLEEVAGKDPIDKAKEGDN E AKEEIKV VKENIDSSTSVKSETDNK       ESEGTERMDSSENQPAVVEENEIKVESKDEEMQEKPISNEEEIKIFDKDSNSRRLAEAASVALAASATKARYLAQSEEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIEREYEVLEQQRQQLLLDRQAFHMELLKTVESRARVVGHNQFHPINNINHQGSYHNASQAISQNPSVQHQQAGTLPTQQFPQNQVIQQHNPNPVPLQYPPNPMPQHNTSMQSNQIPQHNQSIQQQYPQNLPPPPPQHQSNMQTPQHQSNMA    Q+ Q     + P +   Q         Q   + SSSQHQQNMH QNITQQYSQGPLPPQTQQQQAAYQNVGMS  AAAAARKPTDINFSEQQIPHQQVSNQSLQNTQQMNPIHHLSSQPDPDGNNTNVNIN
Sbjct:    1 MLFLKKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETIEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWISNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDFLLPGNQQEFAKQANRKPIISRKCYNGDDLNVMLNVSSQPSSVGDQQQSSAQSLKKDKKKRKLSPSPSNKEDNSGKRRKQNVVRAASLANLRKSKVKEDDDYEDDDVTKDLDDPECPNRVEEVPSNSLGRNTPSRGASAAGNIDNRNNVLYDLDEETQGSGINNNSAAANPNSNIADESFHADMSVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDNVNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLEEVAGKDPIDKAKEGDNEEGAKEEIKVGVKENIDSSTSVKSETDNK-------ESEGTERMDSSENQPAVVEENEIKVESKDEEMQEKPISNEEEIKIFDKDSNSRRLAEAASVALAASATKARYLAQSEEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIEREYEVLEQQRQQLLLDRQAFHMELLKTVESRARVVGHNQFHPINNINHQGSYHNASQAISQNPSVQHQQAGTLPTQQFPQNQVIQQHNPNPVPLQYPPNPMPQHNTSMQSNQIPQHNQSIQQQYPQNLPPPPPQHQSNMQTPQHQSNMA---PQHQQNLQPQHQPNMPPIQHQQQLPIPTQTPQNMSSSQHQQNMHPQNITQQYSQGPLPPQTQQQQAAYQNVGMSAVAAAAARKPTDINFSEQQIPHQQVSNQSLQNTQQMNPIHHLSSQPDPDGNNTNVNIN 1248          
BLAST of SWI/SNF complex subunit SMARCC2 vs. Planmine SMEST
Match: SMESG000013315.1 (SMESG000013315.1)

HSP 1 Score: 2015.35 bits (5220), Expect = 0.000e+0
Identity = 1217/1258 (96.74%), Postives = 1219/1258 (96.90%), Query Frame = 3
Query:   21 MLFLKKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWISNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDFLLPGNQQEFAKQANRKPIISRKCYNGDDLNVMLNVSSQPSSVGXXXXXXXXXXXXXXXXXXXXXXXXNKEDNSGKRRKQNVVRAASLANLRKSKVKEXXXXXXXXXXXXXXXPECPNRVEEVPSNSLGRNTPSRGASAAGNIDNRNNVLYDLDEETQGSGXXXXXXXXXXXXXXXDESFHADMSVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDNVNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLEEVAGKDPIDKAKEGDXXXXXXXXXXXXXXXXXDSSTSVKSETDNKVXXXXXXXXXXXXRMDSSENQPAVVEENEIKVESKDEEMQEKPISNEEEIKIFDKDSNXXXXXXXXXXXXXXXXXXXXYLAQSEEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIXXXXXXXXXXXXXXXXXXXAFHMELLKTVESRARVVGHNQFHPINNINHQGSYHNASQAISQNPSVQHQQAGTLPTQQFPQNQVIQQHXXXXXXXXXXXXXXXQHNTSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNMQTPQHQSNMAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITQQYSXXXXXXXXXXXXAAYQNVGMS-AAAAAARKPTDINFSEQQIPHQQVSNQSLQNTQQMNPIHHLSSQPDPDGNNTNVNIN 3791
            MLFLKKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLF KNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWISNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDFLLPGNQQEFAKQANRKPIISRKCYNGDDLNVMLNVSSQPSSVGDQQQSSAQSLKKDKKKRKLSPSPSNKEDNSGKRRKQNVVRAASLANLRKSKVKEDDDYEDDDVTKDLDDPECPNRVEEVPSNSLGRNTPSRGASAAGNIDNRNNVLYDLDEETQGSGINNNSAAANPNSNIADESFHADMSVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDNVNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLEEVAGKDPIDKAKEGDN E AKEEIKVAVKENIDSSTSVKSETDNK       ESEGTERMDSSENQPAVVEENEIKVESKDEEMQEKPISNEEEIKIFDKDSNSRRLAEAASVALAASATKARYLAQSEEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIEREYEVLEQQRQQLLLDRQAFHMELLKTVESRARVVGHNQFHPINNINHQGSYHNASQAISQNPSVQHQQAGTLPTQQFPQNQVIQQHNPNPVPLQYPPNPMPQHNTSMQSNQIPQHNQSIQQQYPQNLPPPPPQHQSNMQTPQHQSNMA   Q     Q Q        Q Q  +P  T    + SSSSQHQQNMHTQNITQQYSQGPLPPQTQQQQAAYQNVGMS  AAAAARKPTDINFSEQQIPHQQVSNQSLQNTQQMNPIHHLSSQPDPDGNNTNVNIN
Sbjct:    1 MLFLKKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSLATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLKYKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTISAETVEKLRTASRKIHLQIVENANEATHLLFSKNSKVLLNDDMARIVMREGRGIMLHWIGTPDSHDNWISNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWLLSTVENNEWMSEEDFLLPGNQQEFAKQANRKPIISRKCYNGDDLNVMLNVSSQPSSVGDQQQSSAQSLKKDKKKRKLSPSPSNKEDNSGKRRKQNVVRAASLANLRKSKVKEDDDYEDDDVTKDLDDPECPNRVEEVPSNSLGRNTPSRGASAAGNIDNRNNVLYDLDEETQGSGINNNSAAANPNSNIADESFHADMSVTEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRNFMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQEGKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPTVTANPKDLSNSDNVNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNRSDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEHVGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMSTVAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESGKNVDPDKYGLEEVAGKDPIDKAKEGDNEEGAKEEIKVAVKENIDSSTSVKSETDNK-------ESEGTERMDSSENQPAVVEENEIKVESKDEEMQEKPISNEEEIKIFDKDSNSRRLAEAASVALAASATKARYLAQSEEKKIKGLVAQLVEAQLKKMEVKLKQFQELEAIIEREYEVLEQQRQQLLLDRQAFHMELLKTVESRARVVGHNQFHPINNINHQGSYHNASQAISQNPSVQHQQAGTLPTQQFPQNQVIQQHNPNPVPLQYPPNPMPQHNTSMQSNQIPQHNQSIQQQYPQNLPPPPPQHQSNMQTPQHQSNMA--PQHQQNLQPQHQPNMPPIQHQQQLPIPTQTPQNMSSSSQHQQNMHTQNITQQYSQGPLPPQTQQQQAAYQNVGMSAVAAAAARKPTDINFSEQQIPHQQVSNQSLQNTQQMNPIHHLSSQPDPDGNNTNVNIN 1249          
The following BLAST results are available for this feature:
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SMARCC20.000e+042.44SWI/SNF related, matrix associated, actin dependen... [more]
SMARCC20.000e+042.54SWI/SNF related, matrix associated, actin dependen... [more]
SMARCC20.000e+042.82SWI/SNF related, matrix associated, actin dependen... [more]
SMARCC11.563e-18043.49SWI/SNF related, matrix associated, actin dependen... [more]
SMARCC23.730e-13150.68SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
swsn-12.820e-9946.80SWI/SNF nucleosome remodeling complex component; S... [more]
swsn-15.118e-9946.80SWI/SNF nucleosome remodeling complex component; S... [more]
swsn-11.082e-8245.53SWI/SNF nucleosome remodeling complex component; S... [more]
swsn-11.082e-8245.53SWI/SNF nucleosome remodeling complex component; S... [more]
swsn-11.775e-8245.53SWI/SNF nucleosome remodeling complex component; S... [more]
back to top
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mor4.358e-16840.48gene:FBgn0002783 transcript:FBtr0302550[more]
mor1.181e-16740.48gene:FBgn0002783 transcript:FBtr0083238[more]
back to top
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smarcc1a7.390e-17940.70SWI/SNF related, matrix associated, actin dependen... [more]
smarcc28.379e-13350.96SWI/SNF related, matrix associated, actin dependen... [more]
BX548005.14.534e-13150.87SWI/SNF related, matrix associated, actin dependen... [more]
smarcc1b5.646e-9450.13SWI/SNF related, matrix associated, actin dependen... [more]
mysm15.954e-1039.13Myb-like, SWIRM and MPN domains 1 [Source:NCBI gen... [more]
back to top
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SMARCC21.128e-843.58SWI/SNF related, matrix associated, actin dependen... [more]
SMARCC21.056e-843.58SWI/SNF related, matrix associated, actin dependen... [more]
SMARCC21.168e-843.13SWI/SNF related, matrix associated, actin dependen... [more]
SMARCC21.300e-843.39SWI/SNF related, matrix associated, actin dependen... [more]
SMARCC21.191e-843.46SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Smarcc21.707e-943.24SWI/SNF related, matrix associated, actin dependen... [more]
Smarcc21.596e-943.33SWI/SNF related, matrix associated, actin dependen... [more]
Smarcc13.355e-17842.39SWI/SNF related, matrix associated, actin dependen... [more]
Smarcc13.724e-17843.24SWI/SNF related, matrix associated, actin dependen... [more]
Smarcc16.921e-17843.00SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of SWI/SNF complex subunit SMARCC2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8TAQ2|SMRC2_HUMAN0.000e+042.82SWI/SNF complex subunit SMARCC2 OS=Homo sapiens OX... [more]
sp|Q92922|SMRC1_HUMAN7.505e-18043.49SWI/SNF complex subunit SMARCC1 OS=Homo sapiens OX... [more]
sp|P97496|SMRC1_MOUSE4.841e-17743.00SWI/SNF complex subunit SMARCC1 OS=Mus musculus OX... [more]
sp|Q6PDG5|SMRC2_MOUSE2.926e-11556.68SWI/SNF complex subunit SMARCC2 OS=Mus musculus OX... [more]
sp|O14470|SSR2_SCHPO7.288e-6838.22SWI/SNF and RSC complexes subunit ssr2 OS=Schizosa... [more]
back to top
BLAST of SWI/SNF complex subunit SMARCC2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZI881.205e-2694.37SWI/SNF complex subunit SMARCC-1 OS=Schmidtea medi... [more]
A0A5K3FU960.000e+042.33Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5E4ASX40.000e+042.37Uncharacterized protein OS=Marmota monax OX=9995 G... [more]
A0A5E4AUD50.000e+042.59Uncharacterized protein OS=Marmota monax OX=9995 G... [more]
A0A5E4AVC80.000e+042.88Uncharacterized protein OS=Marmota monax OX=9995 G... [more]
back to top
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smarcc21.116e-11857.61SWI/SNF related, matrix associated, actin dependen... [more]
smarcc1a2.120e-10751.05SWI/SNF complex subunit SMARCC1 [Source:NCBI gene;... [more]
smarcc1a3.145e-10751.05SWI/SNF complex subunit SMARCC1 [Source:NCBI gene;... [more]
smarcc1b1.500e-10049.31SWI/SNF related, matrix associated, actin dependen... [more]
mysm15.636e-941.56Myb like, SWIRM and MPN domains 1 [Source:NCBI gen... [more]
back to top
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006171.12.289e-11155.38pep scaffold:Pmarinus_7.0:GL479547:361:13194:1 gen... [more]
ENSPMAT00000007866.16.375e-3772.16pep scaffold:Pmarinus_7.0:GL477456:337314:352717:-... [more]
ENSPMAT00000001387.12.841e-845.95pep scaffold:Pmarinus_7.0:GL477098:21548:26970:1 g... [more]
ENSPMAT00000001389.13.648e-845.95pep scaffold:Pmarinus_7.0:GL477098:21548:25278:1 g... [more]
ENSPMAT00000001385.14.220e-845.95pep scaffold:Pmarinus_7.0:GL477098:15783:25278:1 g... [more]
back to top
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
SWI31.622e-6035.41Subunit of the SWI/SNF chromatin remodeling comple... [more]
RSC82.100e-5337.58Component of the RSC chromatin remodeling complex;... [more]
back to top
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO494545.162e-11353.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SWI/SNF complex subunit SMARCC2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSORLT00000019896.29.645e-10756.79SWI/SNF related, matrix associated, actin dependen... [more]
smarcc1b9.089e-9054.08SWI/SNF complex subunit SMARCC1 [Source:NCBI gene;... [more]
smarcc1b5.375e-8653.87SWI/SNF complex subunit SMARCC1 [Source:NCBI gene;... [more]
smarcc26.512e-6340.15SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of SWI/SNF complex subunit SMARCC2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000031576.10.000e+096.90SMESG000031576.1[more]
SMESG000013315.10.000e+097.30SMESG000013315.1[more]
SMESG000031576.10.000e+096.34SMESG000031576.1[more]
SMESG000013315.10.000e+096.74SMESG000013315.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035929 ID=SMED30035929|Name=SWI/SNF complex subunit SMARCC2|organism=Schmidtea mediterranea sexual|type=transcript|length=3897bp
TATAAATCTTATATGTAACAATGCTATTTCTTAAAAAGAAAGACGGTTTA
CCGAATCAGAGATTTTATGAAAATCCTGAAATTATTGCTCTTTTTGATAC
CGTAAGGACTTGGCTAACACGAAATTGCAAAAAATATTGGCAAAATGATC
CCATGACGAACAAGAGTCTTGCAACTTTATGCTACCAATTACTTCAGTAT
CAAGAGGAAACTTTTGGAAAGATGAATAATGAAATATCAATGGTTAAATT
ACCAATTCATTGCTTTTTTGATTTTAAGCCAGGTGGAAGCCTAAGCCATA
TATTTTCTGCATGTCTTAAATACAAATCTGATCAAGGTATTAGGCGATTT
GATTTTCAGTCTCCATCTAGAACTGAACGAAATGTTGAAATGTTTATGCA
AATTAAACATGAATTACAAACCCATAAATGCTGGGAACAACCGATTGTAT
GGCTGTCACCAACTATTTCAGCTGAAACTGTTGAAAAATTACGCACTGCA
AGTAGAAAAATTCATTTGCAAATTGTTGAAAATGCCAATGAAGCTACCCA
TTTGTTATTTCCAAAAAACTCAAAAGTATTACTTAACGATGATATGGCAA
GAATTGTGATGCGAGAAGGTAGAGGTATTATGCTACACTGGATTGGTACA
CCGGATTCTCATGATAATTGGATTTCGAATATTCCAAGTGATTGCACTCT
ATCGCCTGAACCAGCAATTAGACCTATTATTGGTTCTAACCAATTATGGG
AAATAGATTGCAGATGGTTGTTATCAACTGTTGAAAATAACGAGTGGATG
TCCGAAGAAGATTTTTTATTGCCTGGAAATCAGCAAGAGTTTGCTAAGCA
GGCCAATAGGAAACCAATAATTTCTAGAAAATGCTATAATGGTGATGATT
TGAATGTTATGCTTAATGTCAGTTCTCAGCCATCGAGTGTTGGGGATCAA
CAACAATCAAGTGCACAGTCGTTGAAAAAAGATAAAAAGAAACGAAAACT
ATCACCATCCCCGTCAAATAAAGAAGATAATTCAGGCAAAAGACGAAAAC
AGAATGTAGTAAGAGCTGCTAGCTTAGCAAATTTAAGAAAATCTAAAGTT
AAAGAAGATGATGATTATGAAGATGATGATGTTACAAAGGATCTAGATGA
TCCTGAATGTCCAAATCGTGTTGAAGAGGTTCCAAGTAACAGCTTGGGCA
GAAATACTCCATCTCGAGGAGCATCAGCCGCTGGAAATATCGATAATCGA
AATAATGTATTATATGATCTGGATGAAGAAACACAAGGATCAGGAATCAA
TAATAATTCTGCTGCGGCCAATCCCAATAGTAACATTGCCGATGAATCTT
TCCATGCCGATATGAGTGTCACTGAACAGGCTCATTGTATTATTATTCCT
AGCTATTCGGCTTGGTTTGATTACAATTCCATCCATGTCATTGAAAGGCG
AGCACTGCCGGAATTTTTCATTGGGAAAAATAAAAGCAAATCTGCGGAAG
TCTACATGGCTTACAGAAATTTCATGATTGATACTTACCGATTGAATCCT
CAAGAATATCTGACATTTACCGCTTGTAGACGCAATTTAACCGGCGATGT
TTGTTCGATTTTACGTGTCCACGCATTTCTCGAACAATGGGGATTGATTA
ATTATCAAGTTGACCAAGAAGGCAAGATTACCGCCGGTAGCTTGGGGCCT
CCAAACACGTCTCATTTCCATGTGCTAACTGACTCAGCCACCGGCCTCCA
ATCTCTAGGTAACCAGGCATCTGTTGTGAAATCCCAATCGAATAATTCTG
CTATCGATAAGCAGCCGACTGTGACAGCTAATCCAAAAGATCTATCAAAT
TCAGATAACGTCAATTTACAATCTAAAAGTGCAGATTCTAATAATGAGAC
TTGCATGCCGAGTTCGATATCGGATTACTCATTACAAACTGACCAATATA
TAAATATAGCATCTAATCGATCAGATGTCAATGAAAACAGTACAGGAGGA
GTCATTGATCCTCCTGCCGGTTTACCAGCTAGATCAAAAGAATGGTCAGA
TCAAGAAACATTACTTTTGCTCGAAGGCTTAGAAATGTACAAAGATGATT
GGAATAAGGTCGCGGAACATGTCGGATCACGCACTCAAGAGGAGTGCATT
TTGTATTTTCTTCGACTGCCTATCGAAGATCCCTATCTGGAAGGCGATGC
AGCACTCATGGAAACTTTATGTTACCAACCGATTCCATTTTCAAAATCAG
GAAATCCAATTATGTCGACTGTCGCGTTTTTGGCATCATGTGTTGATCCA
AGGATTGCCAGTGAAGCTGCGAAAGCCGCGCTTAACGAATTCAGCCGATT
GAAAGAAGAGGTACCGGAATATATGGTGAAGGAACACAAAGCCAAGGTGA
CGACAGCAGTGGAATCTGGTAAAAATGTAGACCCAGATAAATATGGATTA
GAAGAAGTTGCTGGGAAAGATCCAATCGATAAAGCGAAAGAAGGAGACAA
CGTAGAAGAAGCGAAAGAGGAAATCAAAGTGGCTGTTAAAGAAAATATCG
ATTCATCCACATCGGTGAAATCGGAAACTGACAATAAAGTTGAAACTGAA
TCTCATACAGAATCCGAAGGCACAGAAAGAATGGACTCCAGTGAGAACCA
ACCGGCAGTTGTCGAGGAAAATGAAATCAAAGTCGAATCGAAAGACGAAG
AAATGCAAGAAAAGCCAATTTCTAATGAAGAGGAGATTAAAATCTTCGAC
AAAGATTCGAATTCCCGGCGTTTAGCGGAGGCCGCTAGTGTAGCACTGGC
AGCTTCGGCCACTAAGGCCCGTTATTTGGCGCAATCCGAGGAAAAGAAAA
TCAAAGGACTTGTTGCTCAGCTCGTTGAAGCCCAATTGAAGAAAATGGAA
GTCAAACTAAAACAATTTCAAGAATTAGAAGCGATTATTGAGAGGGAATA
TGAGGTTCTTGAACAACAAAGGCAGCAGTTGCTTCTCGATAGACAGGCTT
TCCACATGGAACTATTGAAAACGGTGGAGTCACGAGCACGAGTTGTCGGC
CATAATCAATTCCATCCAATAAACAATATAAACCACCAGGGCTCATATCA
TAATGCATCTCAAGCGATTTCACAAAATCCATCTGTCCAACACCAGCAGG
CCGGCACACTGCCAACACAGCAATTCCCTCAAAACCAAGTAATACAACAA
CACAACCCGAATCCGGTTCCATTGCAATACCCCCCGAATCCAATGCCACA
GCACAACACCTCTATGCAATCGAATCAAATTCCTCAGCACAATCAATCTA
TCCAACAGCAGTATCCTCAGAATTTGCCGCCGCCACCCCCGCAACATCAA
TCCAACATGCAAACCCCCCAGCACCAATCAAATATGGCGCCACAACACCA
GCAAAATTTGCAGCCACAACATCAACCGAATATGCCACCAATCCAGCACC
AGCAACAACTGCCGATACCAACTCAAACCCCTCAAAATATGTCATCATCA
TCATCGTCTCAACATCAACAGAATATGCACACTCAGAATATTACTCAACA
GTATTCCCAAGGCCCATTGCCGCCTCAAACTCAGCAACAACAAGCTGCCT
ATCAAAATGTTGGCATGTCAGCAGCGGCTGCTGCTGCTAGGAAACCAACA
GATATAAATTTCTCTGAGCAACAAATTCCCCATCAACAAGTTTCAAACCA
ATCTCTTCAGAATACCCAGCAAATGAACCCGATCCACCATCTTTCGTCTC
AACCTGATCCGGATGGCAATAATACCAATGTGAACATCAATTAATTTCTA
TTGAAATTTAGCATATTTAATGTTTTTTAATAATAATAGTAATTCAATTA
AAACTGTACATTTTTTAATGTCATGAATAAATTTATTTGGAATTCCC
back to top

protein sequence of SMED30035929-orf-1

>SMED30035929-orf-1 ID=SMED30035929-orf-1|Name=SMED30035929-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1258bp
MLFLKKKDGLPNQRFYENPEIIALFDTVRTWLTRNCKKYWQNDPMTNKSL
ATLCYQLLQYQEETFGKMNNEISMVKLPIHCFFDFKPGGSLSHIFSACLK
YKSDQGIRRFDFQSPSRTERNVEMFMQIKHELQTHKCWEQPIVWLSPTIS
AETVEKLRTASRKIHLQIVENANEATHLLFPKNSKVLLNDDMARIVMREG
RGIMLHWIGTPDSHDNWISNIPSDCTLSPEPAIRPIIGSNQLWEIDCRWL
LSTVENNEWMSEEDFLLPGNQQEFAKQANRKPIISRKCYNGDDLNVMLNV
SSQPSSVGDQQQSSAQSLKKDKKKRKLSPSPSNKEDNSGKRRKQNVVRAA
SLANLRKSKVKEDDDYEDDDVTKDLDDPECPNRVEEVPSNSLGRNTPSRG
ASAAGNIDNRNNVLYDLDEETQGSGINNNSAAANPNSNIADESFHADMSV
TEQAHCIIIPSYSAWFDYNSIHVIERRALPEFFIGKNKSKSAEVYMAYRN
FMIDTYRLNPQEYLTFTACRRNLTGDVCSILRVHAFLEQWGLINYQVDQE
GKITAGSLGPPNTSHFHVLTDSATGLQSLGNQASVVKSQSNNSAIDKQPT
VTANPKDLSNSDNVNLQSKSADSNNETCMPSSISDYSLQTDQYINIASNR
SDVNENSTGGVIDPPAGLPARSKEWSDQETLLLLEGLEMYKDDWNKVAEH
VGSRTQEECILYFLRLPIEDPYLEGDAALMETLCYQPIPFSKSGNPIMST
VAFLASCVDPRIASEAAKAALNEFSRLKEEVPEYMVKEHKAKVTTAVESG
KNVDPDKYGLEEVAGKDPIDKAKEGDNVEEAKEEIKVAVKENIDSSTSVK
SETDNKVETESHTESEGTERMDSSENQPAVVEENEIKVESKDEEMQEKPI
SNEEEIKIFDKDSNSRRLAEAASVALAASATKARYLAQSEEKKIKGLVAQ
LVEAQLKKMEVKLKQFQELEAIIEREYEVLEQQRQQLLLDRQAFHMELLK
TVESRARVVGHNQFHPINNINHQGSYHNASQAISQNPSVQHQQAGTLPTQ
QFPQNQVIQQHNPNPVPLQYPPNPMPQHNTSMQSNQIPQHNQSIQQQYPQ
NLPPPPPQHQSNMQTPQHQSNMAPQHQQNLQPQHQPNMPPIQHQQQLPIP
TQTPQNMSSSSSSQHQQNMHTQNITQQYSQGPLPPQTQQQQAAYQNVGMS
AAAAAARKPTDINFSEQQIPHQQVSNQSLQNTQQMNPIHHLSSQPDPDGN
NTNVNIN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016514SWI/SNF complex
GO:0005634nucleus
GO:0090544BAF-type complex
Vocabulary: biological process
TermDefinition
GO:0043044ATP-dependent chromatin remodeling
GO:0006338chromatin remodeling
GO:0006357regulation of transcription from RNA polymerase II promoter
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000044cephalic ganglia
PLANA:0000099neuron
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036388WH-like_DNA-bd_sf
IPR030087BAF155
IPR001005SANT/Myb
IPR032450SMARCC_N
IPR011991WHTH_DNA-bd_dom
IPR032448SWIRM-assoc
IPR032451SMARCC_C
IPR009057Homeobox-like_sf
IPR007526SWIRM
IPR017884SANT_dom
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 939..992
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 672..723
e-value: 7.8E-26
score: 91.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 305..409
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 390..409
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 806..842
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1114..1172
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 805..884
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1106..1172
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 853..873
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 589..614
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 330..345
NoneNo IPR availablePANTHERPTHR12802SWI/SNF COMPLEX-RELATEDcoord: 219..586
NoneNo IPR availablePANTHERPTHR12802SWI/SNF COMPLEX-RELATEDcoord: 673..1153
IPR001005SANT/Myb domainSMARTSM00717santcoord: 673..721
e-value: 4.7E-12
score: 56.0
IPR001005SANT/Myb domainPFAMPF00249Myb_DNA-bindingcoord: 675..718
e-value: 3.4E-11
score: 43.2
IPR001005SANT/Myb domainCDDcd00167SANTcoord: 693..718
e-value: 6.19395E-4
score: 36.7846
IPR032448SMARCC, SWIRM-associated domainPFAMPF16498SWIRM-assoc_3coord: 760..818
e-value: 1.2E-17
score: 63.9
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 465..552
e-value: 8.9E-43
score: 146.2
IPR032450SMARCC, N-terminalPFAMPF16496SWIRM-assoc_2coord: 7..455
e-value: 1.1E-106
score: 357.2
IPR032451SMARCC, C-terminalPFAMPF16495SWIRM-assoc_1coord: 925..1007
e-value: 1.7E-26
score: 92.0
IPR007526SWIRM domainPFAMPF04433SWIRMcoord: 462..547
e-value: 4.0E-30
score: 104.0
IPR007526SWIRM domainPROSITEPS50934SWIRMcoord: 459..556
score: 28.538
IPR030087SWI/SNF complex subunit SMARCC1PANTHERPTHR12802:SF9SWI/SNF COMPLEX SUBUNIT SMARCC1coord: 219..586
IPR030087SWI/SNF complex subunit SMARCC1PANTHERPTHR12802:SF9SWI/SNF COMPLEX SUBUNIT SMARCC1coord: 673..1153
IPR017884SANT domainPROSITEPS51293SANTcoord: 672..723
score: 24.524
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 672..724
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 455..552