Innexin

Overview
NameInnexin
Smed IDSMED30035928
Length (bp)1573
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Innexin (SMED30035928) t-SNE clustered cells

Violin plots show distribution of expression levels for Innexin (SMED30035928) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Innexin (SMED30035928) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Innexin (SMED30035928) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035928

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30035928SMESG000054964.1 SMESG000072377.1 SMESG000072363.1 dd_Smed_v4_8268_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035928SMESG000054964.1 SMESG000072377.1 SMESG000072363.1 dd_Smed_v4_8268_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Innexin vs. Ensembl Celegans
Match: inx-13 (Innexin [Source:UniProtKB/TrEMBL;Acc:O44887])

HSP 1 Score: 132.109 bits (331), Expect = 8.155e-34
Identity = 91/360 (25.28%), Postives = 175/360 (48.61%), Query Frame = 3
Query:  132 DYINYKLTSLXXXXXXXXXXXXXNKGTPIQCWMVDDLTKVDDETALKACFYNEYYFL---KVVNGNRIENKKIKNEINHYQYYPLMLICQSFLFCLPHLIWYYWLVDCQIDLRALIKGLRYS-----KNYHLSALAIRNYINDQRDCSCNFS--------GVFKLNFLYMLIKFSYLINVCFQLFFTKHFIGADSIIFGLKFILNIIFSLNWNIDTRFPPFFLSEAKSRK-GFKHMIDVECQLPVNDFLQEVFIFIDLWILVVGIITIFSNIKWICRVFNKRSSSKLIASFMKSNKTEISDSICK-----QRFFNY-LQNDGIFIISIISTNCGNVIATEIIIDLWE--MHQHDKITMKK 1136
            D +NY  T ++ +  A+ +      G PIQCW+    T   ++ +   CF    YF+   K +  + I+ +    EI +YQ+ P +L  Q+ LF LP L W     +  + L+ ++ G + +     K  + +A +   ++ +       F+        G   L +LY+ +KF YL+ + FQ     +F+G     +GL  + +I+    W     FP   + + + R  G KH   V+C L +N F ++V++F+  W+++VG+ T  + + W  ++  + +    I S+++  +   SD   +      +F +Y L++DG+FI  +I  N G+V + ++I+D+W+  +   D  + KK
Sbjct:   21 DRLNYYWTPMLLVIFALTLSAKQYVGQPIQCWIPAQFTGAWEQYSENYCFVQNTYFISPDKYIPDSEIDREGA--EIGYYQWVPFILGLQAILFYLPSLFWRLMNFNSGVALKKMLFGAKKADRVDEKARNEAAKSTGAHLYESLTLQSRFAKYTSAFTYGGSYLTYLYLFVKFLYLVQIVFQFIILNNFLGTSYTFWGLGILSDILNGREWEESGHFPRVTMCDFEVRVLGNKHRHTVQCVLMINMFNEKVYVFLWFWLVIVGVATFLNLVNWTRKLMFRSARKAHIKSYLQI-EDNFSDDNSRNGQILDKFVDYKLKSDGVFITHLIDNNGGSVFSHDVIVDMWDRFLQDEDNRSQKK 377          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 129.798 bits (325), Expect = 5.666e-33
Identity = 89/362 (24.59%), Postives = 165/362 (45.58%), Query Frame = 3
Query:  114 LEDLFSDYINYKLTSLXXXXXXXXXXXXXNKGTPIQCWMVDDLTKVDDETALKACFYNEYYFLKVVNGNRIE-NKKIKNEINHYQYYPLMLICQSFLFCLPHLIW---YYW--------LVDCQIDLRALIKGLRYS-----KNYHLSALAIRNYINDQRDCSCNFSGVFKLNFLYMLIKFSYLINVCFQLFFTKHFIGADSIIFGLKFILNIIFSLNWNIDTRFPPFFLSEAKSRK-GFKHMIDVECQLPVNDFLQEVFIFIDLWILVVGIITIFSNIKWICRVFNKRSSSKLIASFMKSNKTEISDSICKQRFFNYLQNDGIFIISIISTNCGNVIATEIIIDLWEMHQHDKITMKKLNS 1145
            ++D F D +NY  TS +    AI++      G PIQCW+    T   ++     C+    Y+L + +   +E   +   +I++YQ+ P +L  ++  F +P ++W    +W        L     D R +    R +       +   AL I+  + D             +  LY+ IK  YL NV  Q+F    F+G D++ +G   + +++    W +   FP   + + + R  G  H   V+C L +N F +++F+F+  W  +V  ++  S   WI   F      K I  ++++          K+    +L  DG+F + +IS + G+++ATE+I+ LW  + +D++   + NS
Sbjct:   17 VDDDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYYLPLTSAFPLEYGDRRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALEIQREVTDVSGMCVQKRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDLATDRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWH-NFNDRVRKIQFNS 377          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 129.798 bits (325), Expect = 5.666e-33
Identity = 89/362 (24.59%), Postives = 165/362 (45.58%), Query Frame = 3
Query:  114 LEDLFSDYINYKLTSLXXXXXXXXXXXXXNKGTPIQCWMVDDLTKVDDETALKACFYNEYYFLKVVNGNRIE-NKKIKNEINHYQYYPLMLICQSFLFCLPHLIW---YYW--------LVDCQIDLRALIKGLRYS-----KNYHLSALAIRNYINDQRDCSCNFSGVFKLNFLYMLIKFSYLINVCFQLFFTKHFIGADSIIFGLKFILNIIFSLNWNIDTRFPPFFLSEAKSRK-GFKHMIDVECQLPVNDFLQEVFIFIDLWILVVGIITIFSNIKWICRVFNKRSSSKLIASFMKSNKTEISDSICKQRFFNYLQNDGIFIISIISTNCGNVIATEIIIDLWEMHQHDKITMKKLNS 1145
            ++D F D +NY  TS +    AI++      G PIQCW+    T   ++     C+    Y+L + +   +E   +   +I++YQ+ P +L  ++  F +P ++W    +W        L     D R +    R +       +   AL I+  + D             +  LY+ IK  YL NV  Q+F    F+G D++ +G   + +++    W +   FP   + + + R  G  H   V+C L +N F +++F+F+  W  +V  ++  S   WI   F      K I  ++++          K+    +L  DG+F + +IS + G+++ATE+I+ LW  + +D++   + NS
Sbjct:   17 VDDDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYYLPLTSAFPLEYGDRRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALEIQREVTDVSGMCVQKRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDLATDRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWH-NFNDRVRKIQFNS 377          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 129.028 bits (323), Expect = 2.342e-32
Identity = 86/348 (24.71%), Postives = 157/348 (45.11%), Query Frame = 3
Query:  114 LEDLFSDYINYKLTSLXXXXXXXXXXXXXNKGTPIQCWMVDDLTKVDDETALKACFYNEYYFLKVVNGNRIE-NKKIKNEINHYQYYPLMLICQSFLFCLPHLIWY---YW--------LVDCQIDLRALIKGLRYS-----KNYHLSALAIRNYINDQRDCSCNFSGVFKLNFLYMLIKFSYLINVCFQLFFTKHFIGADSIIFGLKFILNIIFSLNWNIDTRFPPFFLSEAKSRK-GFKHMIDVECQLPVNDFLQEVFIFIDLWILVVGIITIFSNIKWICRVFNKRSSSKLIASFMKSNKTEISDSICKQRFFNYLQNDGIFIISIISTNCGNVIATEIIIDLWE 1103
            ++D F D +NY  TS +    AI++      G PIQCW+    T   ++     C+    Y+L + +   +E   +   +I++YQ+ P +L  ++  F +P ++W    +W        L     D R +    R +       +   AL I+  + D             +  LY+ IK  YL NV  Q+F    F+G D++ +G   + +++    W +   FP   + + + R  G  H   V+C L +N F +++F+F+  W  +V  ++  S   WI   F      K I  ++++          K+    +L  DG+F + +IS + G+++ATE+I+ LW 
Sbjct:   17 VDDDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYYLPLTSAFPLEYGDRRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALEIQREVTDVSGMCVQKRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDLATDRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWH 364          
BLAST of Innexin vs. Ensembl Celegans
Match: unc-7 (Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q03412])

HSP 1 Score: 127.487 bits (319), Expect = 5.433e-32
Identity = 89/363 (24.52%), Postives = 170/363 (46.83%), Query Frame = 3
Query:  114 LEDLFSDYINYKLTSLXXXXXXXXXXXXXNKGTPIQCWMVDDLTKVDDETALKACFYNEYYFLKVVNGNRIENKKIKN-EINHYQYYPLMLICQSFLFCLPHLIW---YYW-----------------LVDCQIDLRALIKGLRYSK------NYHLSALAIRNYINDQRDCSCNFSGVFKLNFLYMLIKFSYLINVCFQLFFTKHFIGADSIIFGLKFILNIIFSLNWNIDTRFPPFFLSEAKSRK-GFKHMIDVECQLPVNDFLQEVFIFIDLWILVVGIITIFSNIKWICRVFNKRSSSKLIASFMK----SNKTEISDSICKQRFF-NYLQNDGIFIISIISTNCGNVIATEIIIDLWE 1103
            L+D F D +NY  T+ +    A+++      G PIQCW+    T   ++     C+    Y++ +      E    +N +I +YQ+ P +L  ++ LF +P ++W    YW                 L+D +I  R +    R+ +      N      +   + N Q   +C       +  LY+ IK  Y  NV  Q F   H +G++ + +G   + +++ ++ W     FP   L + + R  G  H   V+C L +N F +++F+F+  W L  GI+T+ + + WI  +F        +  +++         I+D +  ++F  N+L+ DG+F++ +IST+ G ++++E+I+ LW+
Sbjct:   17 LDDDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDAMEQYTENYCWVQNTYWVPMQEDIPREIYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGHSRSCFSNLQLGANCGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSNDLAYGFSLLKDLMHAIEWEQTGMFPRVTLCDFEVRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQ 379          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q03412|UNC7_CAEEL (Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN=unc-7 PE=1 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 1.198e-29
Identity = 89/363 (24.52%), Postives = 170/363 (46.83%), Query Frame = 3
Query:  114 LEDLFSDYINYKLTSLXXXXXXXXXXXXXNKGTPIQCWMVDDLTKVDDETALKACFYNEYYFLKVVNGNRIENKKIKN-EINHYQYYPLMLICQSFLFCLPHLIWY---YW-----------------LVDCQIDLRALIKGLRYSK------NYHLSALAIRNYINDQRDCSCNFSGVFKLNFLYMLIKFSYLINVCFQLFFTKHFIGADSIIFGLKFILNIIFSLNWNIDTRFPPFFLSEAKSRK-GFKHMIDVECQLPVNDFLQEVFIFIDLWILVVGIITIFSNIKWICRVFNKRSSSKLIASFMK----SNKTEISDSICKQRFF-NYLQNDGIFIISIISTNCGNVIATEIIIDLWE 1103
            L+D F D +NY  T+ +    A+++      G PIQCW+    T   ++     C+    Y++ +      E    +N +I +YQ+ P +L  ++ LF +P ++W    YW                 L+D +I  R +    R+ +      N      +   + N Q   +C       +  LY+ IK  Y  NV  Q F   H +G++ + +G   + +++ ++ W     FP   L + + R  G  H   V+C L +N F +++F+F+  W L  GI+T+ + + WI  +F        +  +++         I+D +  ++F  N+L+ DG+F++ +IST+ G ++++E+I+ LW+
Sbjct:  137 LDDDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDAMEQYTENYCWVQNTYWVPMQEDIPREIYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGHSRSCFSNLQLGANCGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSNDLAYGFSLLKDLMHAIEWEQTGMFPRVTLCDFEVRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQ 499          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|O61787|INX16_CAEEL (Innexin-16 OS=Caenorhabditis elegans OX=6239 GN=inx-16 PE=3 SV=2)

HSP 1 Score: 101.293 bits (251), Expect = 4.994e-22
Identity = 72/332 (21.69%), Postives = 145/332 (43.67%), Query Frame = 3
Query:  117 EDLFSDYINYKLTSLXXXXXXXXXXXXXNKGTPIQCWMVDDLTKVDDETALKACFYNEYYFLKVVNGN-RIENKKIKNEINHYQYYPLMLICQSFLFCLPHLIWYYWLVDCQIDLRALIKGLRY------SKNYHLSALAIRNYINDQRDCSCNFSGVFKLNFLYMLIKFSYLINVCFQLFFTKHFIGADSIIFGLKFILNIIFSLNWNIDTRFPPFFLSEAKSRK-GFKHMIDVECQLPVNDFLQEVFIFIDLWILVVGIITIFSNIKWICRVFNKRSSSKLIASFMKSNKTEISDSICKQRFFNYLQNDGIFIISIISTNCGNVIATEII 1088
            +D   D +NY +T+ + I  ++++      G P+QCW  +      +  A   CF    YF+ + + N      +   E+ +YQ+ P +L+ Q+  FC+P   W  +     + +  +I   R         +  L  +A+ N+  +Q+      S +F     Y+++K   L+N+  Q F    F+      +G     +++   +W     FP     +   R+ G  H   ++C L VN F +++FIF+  W   + + T    + W+ R F+  S    I   +     + S     + + N L++DG+  + ++ +N G + + E++
Sbjct:   21 DDTSIDRLNYVVTTSILIAFSLLLFAKNYVGEPMQCWTPNQFAGGWESFAESYCFIENTYFVPMQDSNLPAAETREGREMIYYQWVPFLLVIQALFFCVPRAFWIIYPSYSGLTIADMITAARQNGKQLEGADEALEQVAMINWRTEQQKGHG--SRIFNC---YLVMKLLILLNIVLQFFLLNSFLNTAYTFWGWGIFWDMVNGRHWQESGHFPRVSFCDINVRELGNIHHWSLQCVLMVNMFNEKIFIFLWFWFAFLLVATAGDFVIWVWRRFDSNSKLGFILDLLNQEGIDHSPQKASELYKNVLRDDGVLFLRLLDSNSGRLNSEELM 347          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|O01393|UNC9_CAEEL (Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN=unc-9 PE=1 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 8.456e-22
Identity = 83/356 (23.31%), Postives = 161/356 (45.22%), Query Frame = 3
Query:  114 LEDLFSDYINYKLTSLXXXXXXXXXXXXXNKGTPIQCWMVDDLTKVDDETALKACFYNEYYFLKV---VNGNRIENKKIKNEINHYQYYPLMLICQSFLFCLPHLIWYYWLVDCQIDLRALIKGL-------RYSKNYHL--------SALAIRNYINDQRDCS------CNFSGVFKLNFLYMLIKFSYLINVCFQLFFTKHFIGADSIIFGLKFILNIIFSLNWNIDTRFPPFFLSEAKSRK-GFKHMIDVECQLPVNDFLQEVFIFIDLWILVVGIITIFSNIKWICRVFNKRSSSKLIASFMKS-NKTEISDSICKQRF-FNYLQNDGIFIISIISTNCGNVIATEIIIDLW 1100
            ++D   D +NY  T+ +    AI++      G PIQCW+    T+  ++     C+    YFL +   +  N  E +    +I +YQ+ P +L  ++ LF +P ++W        I +++L++           S+N  L         AL +++ +             C  S    + FLY+ +K  Y +N+  Q+F    F+G  S  +GL+ + +++    W     FP   L + + +  G  H   V+C L +N F +++F+F+  W  ++   T+ S   WI            +  ++      ++ DS   +RF F++L+ DG+F++ +++T+ G +   E+   LW
Sbjct:   19 VDDDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFTEPMEQYTENYCWVQNTYFLPLHDYIPHNYAEREN--RQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQSGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNRLKLLNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLGNRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDFEVKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLW 372          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q19746|INX3_CAEEL (Innexin-3 OS=Caenorhabditis elegans OX=6239 GN=inx-3 PE=1 SV=2)

HSP 1 Score: 99.7525 bits (247), Expect = 2.570e-21
Identity = 87/331 (26.28%), Postives = 146/331 (44.11%), Query Frame = 3
Query:  207 GTPIQCWMVDDLTKVDDETALKACFYNEYYFLKVVN--GNRIENKKIKNEINHYQYYPLMLICQSFLFCLPHLIWYYWLVDCQIDLRALI---KGLRY--SKNYHLSALAIRNYINDQRDC-SCNFSGVF-----------KLNFLYMLIKFSYLINVCFQLFFTKHFIGADSIIFGLKFILNIIFSLNWNIDTRFPPFFLSEAKSRK-GFKHMIDVECQLPVNDFLQEVFIFIDLWILVVGIITIFSNIKWICRVFNKRSSSKLIASFMKSNKTEISDSICKQRFF--NYLQNDGIFIISIISTNCGNVIATEIIIDLWEMH----QHDK 1121
            G+ IQCWM  +     ++ A   CF    +F+   +     +E+++ K EI +YQ+ P++L  Q+F+F LP  IW      C +D  ++I   + LR   S+        + ++I D  D  S N  G F             + LY+ IK  YL NV  Q      F+G ++ ++G     ++     W     FP   L +   RK    H   V+C L +N F +++++FI  W + V I T  + +  I R+    S    I S +        D       F  N L+ DG+ ++  I  + G ++  EI  +L++ H    QH++
Sbjct:   50 GSAIQCWMPMEFKGGWEQYAEDYCFIQNTFFIPERSEIPGDVEDRQ-KAEIGYYQWVPIVLAIQAFMFYLPSWIWSSLYKQCGLDFPSVISEAEALRSQDSETRTKGVNKLVDFIGDILDTRSKNEYGRFYCYRFGKGLGSMTSMLYICIKLMYLANVFVQFIILNKFLGNETFLWGFHTFADLYAGREWQDSGVFPRVTLCDFSVRKLANVHRYTVQCVLMINMFNEKIYLFIWFWFVFVLITTFINTLCTIYRLSFDSSRHNYIRSLLSGPVNNFKDEKAMIASFANNGLKQDGVLLMRFIDDHAGAMVTKEICEELFKKHGENLQHNR 379          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q23027|INX5_CAEEL (Innexin-5 OS=Caenorhabditis elegans OX=6239 GN=inx-5 PE=3 SV=2)

HSP 1 Score: 98.2117 bits (243), Expect = 1.324e-20
Identity = 85/370 (22.97%), Postives = 163/370 (44.05%), Query Frame = 3
Query:  129 SDYINYKLTSLXXXXXXXXXXXXXNKGTPIQCWMVDDLTKVDDETALKACFYNEYYFLKVVNGNRIENK--------KIKNEINHYQYYPLMLICQSFLFCLPHLIWYYWLVDCQIDLRALIKGLRYSKNYHLSALAIRNYINDQRDCSCNFSGVF--KLNF----------------------LYMLIKFSYLINVCFQLFFTKHFIGADSIIFGLKFILNIIFSLNWNIDTRFP-----PFFLSEAKSRKGFKHMIDVECQLPVNDFLQEVFIFIDLWILVVGIITIFSNIKWICRVFNKRSSSKLIASFMKSN---KTEIS-DSICKQRFFNY-LQNDGIFIISIISTNCGNVIATEIIIDLWEMHQ 1112
            +D  +Y+ TS +  F AI++      G PIQCW+    T+  ++ A   CF    YFL     +  E              ++ +YQ+ P++L+ Q+FLF LP +IW  +   C++ ++ L      S+        I++ ++D +  +  F   F  KLNF                      LY+L+K  YL N+  Q +   +F+   S ++G +   +++    W     FP      F + +  S     H   ++C + +N   ++V++F   W+L VG++T+ S   W      +      I S+++     +TE    S     F +  L  DG+FI  ++  N G++  + ++ +++ +++
Sbjct:   22 ADRFSYQYTSTLLGFSAIMMAASQYVGRPIQCWVPAQFTRTWEKYAETYCFIKGTYFLPGAFASEGEMSVTSPDDAVTATPQVGYYQWIPIVLVLQAFLFYLPSIIWRTFNESCELKIKELAAVSEASRK-------IKSNMSDDQVKATKFGRYFFKKLNFRNESPVFKETGSVVASGKFLPALYLLVKILYLANIVLQFWILTYFLETKSWMWGWQTFQDLMAGREWETTGIFPRVTMCDFSIMDLTS----VHDHSIQCVIVINMLAEKVYVFFWFWLLFVGLLTVCSLAYWAVIYMLQSVGRNFIYSYLQQTPEFQTEQERGSFVPANFVDKCLTPDGVFISRLVQQNSGDLFTSIMLGEMFSLYR 380          
BLAST of Innexin vs. TrEMBL
Match: A0A1I8GJJ5 (Innexin OS=Macrostomum lignano OX=282301 GN=inx PE=3 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 3.738e-42
Identity = 102/376 (27.13%), Postives = 194/376 (51.60%), Query Frame = 3
Query:   90 KLIKNRIILEDLFSDYINYKLTSLXXXXXXXXXXXXXNKGTPIQCWMVDDLTKVDDETALKACFY-NEYYFLKVVNGNRIENKKIKNEINHYQYYPLMLICQSFLFCLPHLIWYYWLVDCQIDLRALIKGLR---------YSKNYHLSALAIRNYINDQRD---------------CSCNFSGVFKLNFL---YMLIKFSYLINVCFQLFFTKHFIGADSIIFGLKFILNIIFSLNWNIDTRFPPFFLSEAKSRK-GFKHMIDVECQLPVNDFLQEVFIFIDLWILVVGIITIFSNIKWICRVFNKRSSSKLIASFMK-SNKTEISDSICKQRFF-NYLQNDGIFIISIISTNCGNVIATEIIIDLWEMHQHDKI 1124
            ++  +R  ++D F+D +NY+ + ++      +I I    G PIQCW+  + T+  +E A   C+  N YY     +    E  + +  I +YQ+ P++L  Q+ +F +P LIW  ++     ++R L++             +KN    A  +   I  QR+               CSC   G    NFL   Y  +K  YL+N   QL+  + F+G     FG + +L+I+  ++W   + FP     + ++RK G  +   ++C LP+N FL+++++F+  W+ +V +IT+ S + W CR+   R  +  +  ++K  N  + +D +  ++F  NYL+ DG+FI+ ++S NCG+++A ++  +LW +++H ++
Sbjct:  104 RIGSSRQRVDDDFADRLNYQFSGVILFLFIGLIGIRQYVGKPIQCWIPQEFTRGWEEYAENYCWVANTYYASLEADHLPEEQSRSRLTITYYQWAPIVLAVQALMFYIPCLIWRLFMNYSGFNVRRLLQMAADANVVIPEALNKNVRFMARYMEGCIYRQREYKRGLGVRVRRCLSACSCICCGKRHGNFLVVLYFFVKLLYLLNAFGQLYLMEKFVGTTHTFFGFRVLLDILQGVHWYRSSNFPRVTFCDLQARKIGVNYRYTLQCVLPLNMFLEKIYVFLWFWVALVSVITMSSFVSWFCRMAFARRRTGFVRKYLKIMNALKDTDRLTSRKFVENYLRVDGVFILRLVSANCGDIVAGDLACELWSIYRHKRL 479          
BLAST of Innexin vs. TrEMBL
Match: A0A267EEW5 (Innexin OS=Macrostomum lignano OX=282301 GN=inx PE=3 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 6.253e-39
Identity = 102/377 (27.06%), Postives = 189/377 (50.13%), Query Frame = 3
Query:   90 KLIKNRIILEDLFSDYINYKLTSLXXXXXXXXXXXXXNKGTPIQCWMVDDLTKVDDETALKACFYNEYYFLKVVNGNRIENKKIKNE--INHYQYYPLMLICQSFLFCLPHLIWYYWLVDCQIDLRALIKGL---------RYSKNYHLSALAIRNYINDQRDCSCNFSGVFK------------------LNFLYMLIKFSYLINVCFQLFFTKHFIGADSIIFGLKFILNIIFSLNWNIDTRFPPFFLSEAKSRK-GFKHMIDVECQLPVNDFLQEVFIFIDLWILVVGIITIFSNIKWICRVFNKRSSSKLIASFMK-SNKTEISDSICKQRFF-NYLQNDGIFIISIISTNCGNVIATEIIIDLWEMHQHDKI 1124
            ++  +++  +D F+D +NY+ T ++      +I I    G PIQCW+  + T+  +E A   C+    Y+  V   + +  + I+NE  I +YQ+ P++L  Q+ +F LP LIW  ++     +LR +++             +KN    A  +   I  QR+         K                  L  LY  IK  YL+NV  QL+  + FIG     FG + +L+I+  + W   + FP     + +++K G  +   ++C LP+N FL+++++F+  W ++V I+T+ S + W  R+   R     I  ++K  N  + +D    ++F  NYL+ DG+FI  +I+ NCG+++A ++  +LW +++H ++
Sbjct:   14 RIGSSKLRFDDDFADRLNYQFTGVILFLFIGLIGIRQYVGKPIQCWIPQEFTRGWEEYAENYCWVANTYYASV-QADHLPPQHIRNELMITYYQWAPIVLAVQALMFYLPCLIWRLFMNYSGFNLRKILQMATDANVVIPEALNKNVRFMARYMEGCIYRQREYRRGVGVRLKHCLSKCSCLCCGKRYGNFLVVLYFFIKVLYLLNVFGQLYIMEKFIGTTYTFFGFRVLLDIVHGIKWYQSSNFPRVTFCDLQAKKEGQNYHYTLQCVLPLNMFLEKIYVFLWFWHVLVSIVTLTSFVNWFFRMAFARRRLNFIRKYLKIMNVLKDTDKTTSRKFVENYLRVDGVFIFRLIAMNCGDIVAGDLACELWSIYRHKRL 389          
BLAST of Innexin vs. TrEMBL
Match: Q2L6N1 (Innexin OS=Dugesia japonica OX=6161 GN=inx3 PE=2 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 2.034e-38
Identity = 113/403 (28.04%), Postives = 205/403 (50.87%), Query Frame = 3
Query:   90 KLIKNRIILEDLFSDYINYKLTSLXXXXXXXXXXXXXNKGTPIQCWMVDDLTKVDDETALKACFYNEYYFLKVVNGNRIENKKIKNE--INHYQYYPLMLICQSFLFCLPHLIWYYWLVDCQIDLRALIK------------GLRYSKNY---HLSALAIRNYI----------NDQRD-------------CSCNFSGVFKLNFLYMLIKFSYLINVCFQLFFTKHFIGADSIIFGLKFILNIIFSLNWNIDTRFPPFFLSEAKSRK-GFKHMIDVECQLPVNDFLQEVFIFIDLWILVVGIITIFSNIKWICRVFNKRSSSKLIASFMK-SNKTEISDSICKQRFF-NYLQNDGIFIISIISTNCGNVIATEIIIDLWEMHQHDKI---TMKKLNSLNYEE 1160
            ++  N++  +D F D +NY+ T L+      +I I    G PIQCW+  + T+  +E     C+ +  YF  + N  R+ +K  +NE  I +YQ+ P++L  QS LF +P LIW         ++R +++             L+ S ++   H+     R+ I          N +R              C     G F L  LY+ IKF YLIN+  QL+  + FIG     +G++ + +++    W+    FP     + +++K G  H+  ++C LP+N FL++++IF+  W ++VGI T+ S   WI R+ +  +  K+I ++++  N    +D    ++F  +YL++DG F+I +I+ N G+++A ++I ++W++++H +I      K  SLN E 
Sbjct:   52 RIGSNKLRFDDDFVDRLNYQFTGLLLFMFIGLIGIRQYVGKPIQCWIPQEFTRGWEEYTENYCWVSNTYFASIQN--RMPSKDTRNEQMIGYYQWAPILLGLQSLLFYIPCLIWRNVSPQSGFNVRRILQVASDANCSLIPEQLQKSISFIARHMDTCLYRHRICYEHKHFMRSNGKRSKFSRCLAKLRCICCLGKLQGNF-LTVLYISIKFLYLINIIGQLYLMEKFIGTKYTFYGIRVLWDLMRGHEWHHSGNFPRVTFCDLEAKKLGKNHLYSLQCVLPMNMFLEKIYIFLWFWHVIVGIATLCSLFSWIRRIGSPVNRIKMIRNYLRLMNILHDTDKGPSRKFAESYLRSDGCFLIQLIAINIGDLVAGDLICEMWQIYRHKRIQEFEELKFTSLNVES 451          
BLAST of Innexin vs. TrEMBL
Match: A0A1I8GCN3 (Innexin OS=Macrostomum lignano OX=282301 GN=inx PE=3 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 1.359e-37
Identity = 100/376 (26.60%), Postives = 189/376 (50.27%), Query Frame = 3
Query:   90 KLIKNRIILEDLFSDYINYKLTSLXXXXXXXXXXXXXNKGTPIQCWMVDDLTKVDDETALKACFYNEYYFLKVVNGN-RIENKKIKNEINHYQYYPLMLICQSFLFCLPHLIWYYWLVDCQIDLRALIKGL---------RYSKNYHLSALAIRNYINDQRD---------------CSCNFSGVFKLNFL---YMLIKFSYLINVCFQLFFTKHFIGADSIIFGLKFILNIIFSLNWNIDTRFPPFFLSEAKSRK-GFKHMIDVECQLPVNDFLQEVFIFIDLWILVVGIITIFSNIKWICRVFNKRSSSKLIASFMK-SNKTEISDSICKQRFF-NYLQNDGIFIISIISTNCGNVIATEIIIDLWEMHQHDKI 1124
            ++  +++  +D F+D +NY+ T ++      +I I    G PIQCW+  + T+  +E A   C+    Y+  V   +   E+ + K  I +YQ+ P++L  Q+ +F LP LIW  ++     ++R +++             +KN    A  +   I  QR+               CSC   G    NFL   Y  IK  YL+NV  QL+  + F+G     FG + + ++   + W   + FP     + +++K G  +   ++C LP+N FL+++++F+  W ++V I+T+ S + W  R+   R     +  ++K  N  + +D    ++F  NYL+ DG+FI  +I+ NCG+++A ++  +LW +++H ++
Sbjct:   14 RIGSSKLRFDDDFADRLNYQFTGVILFLFIGLIGIRQYVGKPIQCWIPQEFTRGWEEYAENYCWVANTYYASVPEEHLPAEHLRRKRMITYYQWAPIVLAVQALMFYLPCLIWRLFMNYSGFNVRKILQMATDANVVIPEALNKNIRFMARYMEGCIYRQREYRRGVGVRVKHCLAKCSCLCCGKRYGNFLVVLYFFIKVLYLLNVFGQLYIMEKFVGTTYTFFGFQVLRDLFNGIQWYQSSNFPRVTFCDLQAKKLGVNYHYTLQCVLPLNMFLEKIYVFLWFWHVLVSIVTLGSFVNWFFRMAFARRRLIFVRKYLKIMNVLKDTDKTTSRKFVENYLRIDGVFIFRLIAMNCGDIVAGDLACELWSIYRHKRL 389          
BLAST of Innexin vs. TrEMBL
Match: A0A1I8GHL0 (Innexin OS=Macrostomum lignano OX=282301 GN=inx PE=3 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 1.165e-36
Identity = 102/377 (27.06%), Postives = 189/377 (50.13%), Query Frame = 3
Query:   90 KLIKNRIILEDLFSDYINYKLTSLXXXXXXXXXXXXXNKGTPIQCWMVDDLTKVDDETALKACFYNEYYFLKVVNGNRIENKKIKNE--INHYQYYPLMLICQSFLFCLPHLIWYYWLVDCQIDLRALIK---------GLRYSKNYHLSALAIRNYINDQRDCSCNFSGVFK------------------LNFLYMLIKFSYLINVCFQLFFTKHFIGADSIIFGLKFILNIIFSLNWNIDTRFPPFFLSEAKSRK-GFKHMIDVECQLPVNDFLQEVFIFIDLWILVVGIITIFSNIKWICRVFNKRSSSKLIASFMK-SNKTEISDSICKQRFF-NYLQNDGIFIISIISTNCGNVIATEIIIDLWEMHQHDKI 1124
            ++  +++  +D F+D +NY+ T ++      +I I    G PIQCW+  + T+  +E A   C+    Y+  V   + +  + I+NE  I +YQ+ P++L  Q+ +F LP LIW  ++     +LR +++             +KN    A  +   I  QR+         K                  L  LY  IK  YL+NV  QL+  + FIG     FG + +L+I+  + W   + FP     + +++K G  +   ++C LP+N FL+++++F+  W ++V I+T+ S + W  R+   R     I  ++K  N  + +D    ++F  NYL+ DG+FI  +I+ NCG+++A ++  +LW +++H ++
Sbjct:  580 RIGSSKLRFDDDFADRLNYQFTGVILFLFIGLIGIRQYVGKPIQCWIPQEFTRGWEEYAENYCWVANTYYASV-QADHLPPQHIRNELMITYYQWAPIVLAVQALMFYLPCLIWRLFMNYSGFNLRKILQMATDANVVIPEALNKNVRFMARYMEGCIYRQREYRRGVGVRLKHCLSKCSCLCCGKRYGNFLVVLYFFIKVLYLLNVFGQLYIMEKFIGTTYTFFGFRVLLDIVHGIKWYQSSNFPRVTFCDLQAKKEGQNYHYTLQCVLPLNMFLEKIYVFLWFWHVLVSIVTLTSFVNWFFRMAFARRRLNFIRKYLKIMNVLKDTDKTTSRKFVENYLRVDGVFIFRLIAMNCGDIVAGDLACELWSIYRHKRL 955          

HSP 2 Score: 69.3218 bits (168), Expect = 1.690e-8
Identity = 53/224 (23.66%), Postives = 98/224 (43.75%), Query Frame = 3
Query:  213 PIQCWMVDDLTKVDDETALKACFYNEYYFLKVVNGNRIENKKIKNE--INHYQYYPLMLICQSFLFCLPHLIWYYWLVDCQIDLRALIKGLRYS--KNYHLSALAIR---NYINDQRDCS--------------CNFSGVFKLNFLYMLIKFSYLINVCFQLFFTKHFIGADSIIFGLKFILNIIFSLNWNIDTRFPPFFLSEAKSRK-GFKHMIDVECQLPVN 818
            PIQCW+  + +K  ++ A   C+ +  YFL       ++ +++K    I +YQ+  ++L  Q+ +  +PHL+W    V  +  L  LIK  R +   +  L   A++     + +Q + S              C  S   +L  L+++++  ++ N   Q++  + F+G +   FG + + ++     W     FP         RK G K   DV  Q PV 
Sbjct:    2 PIQCWVPQEFSKAWEDFAENYCWVSNTYFLMPEQDIPVKTEQLKQMTFITYYQWVAIVLAGQAIITWIPHLLWR---VGAR-RLPVLIKNARGASIPDTDLRRKAVQCLVAALEEQAEASRRYSRMKNVVEKFLCCLSPSMRLTMLFLIVRILFIGNSIGQIYLMRQFLGTNDTFFGYEVLKSLTLGREWRETGHFPRVTYCHLVVRKVGVKSQSDVTPQQPVR 221          

HSP 3 Score: 66.2402 bits (160), Expect = 1.260e-7
Identity = 32/115 (27.83%), Postives = 66/115 (57.39%), Query Frame = 3
Query:  792 DVECQLPVNDFLQEVFIFIDLWILVVGIITIFSNIKWICRVFNKRSSSKLIASFMKSNK--TEISDSICKQRFFNY-LQNDGIFIISIISTNCGNVIATEIIIDLWEMHQHDKIT 1127
            D++C LP+N F+++V++F+  W +++G++T  S + W+ +          I  ++K+ +  +   +  C  RF N  L  DG+FI+ ++S    ++IA ++   LW+ ++  KIT
Sbjct:  391 DLQCVLPINHFVEKVYVFLWFWFIILGVLTFASTLLWVFKTLIPYRRVAFIKQYLKAMRILSNTEERDCN-RFVNINLGADGVFILQVVSNLASDLIALDVASTLWKNYRQAKIT 504          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000054964.1 (SMESG000054964.1)

HSP 1 Score: 691.804 bits (1784), Expect = 0.000e+0
Identity = 356/360 (98.89%), Postives = 357/360 (99.17%), Query Frame = 3
Query:   87 MKLIKNRIILEDLFSDYINYKLTSLXXXXXXXXXXXXXNKGTPIQCWMVDDLTKVDDETALKACFYNEYYFLKVVNGNRIENKKIKNEINHYQYYPLMLICQSFLFCLPHLIWYYWLVDCQIDLRALIKGLRYSKNYHLSALAIRNYINDQRDCSCNFSGVFKLNFLYMLIKFSYLINVCFQLFFTKHFIGADSIIFGLKFILNIIFSLNWNIDTRFPPFFLSEAKSRKGFKHMIDVECQLPVNDFLQEVFIFIDLWILVVGIITIFSNIKWICRVFNKRSSSKLIASFMKSNKTEISDSICKQRFFNYLQNDGIFIISIISTNCGNVIATEIIIDLWEMHQHDKITMKKLNSLNYEEIV 1166
            MKLIKNRIILEDLFSDYINYKLTSLVFIFIAIVIEIVINKGTPIQCWMVDDLTKVDDETALKACFYNEYYFLKVVNGNRIENKKIKNEINHYQYYPLMLICQSFLFCLPHLIWYYWLVDCQIDLRALIKGLRYSKNYHLSALAIRNYINDQRDCSCNFSGVFKLNFLYMLIKFSYLINVCFQLFFTKHFIGADSIIFGLKFILNIIFSLNWNIDTRFPPF LSEAKSRKGFKHM DVECQLPVNDFLQEVFIFIDLWILVVGIITIFSNIKWICRVFNKRSSSKLIASFMKSNK EISDSICKQRFFNYLQNDGIFIISIISTNCG+VIATEIIIDLWEMHQHDKITMKKLNSLNYEEIV
Sbjct:    1 MKLIKNRIILEDLFSDYINYKLTSLVFIFIAIVIEIVINKGTPIQCWMVDDLTKVDDETALKACFYNEYYFLKVVNGNRIENKKIKNEINHYQYYPLMLICQSFLFCLPHLIWYYWLVDCQIDLRALIKGLRYSKNYHLSALAIRNYINDQRDCSCNFSGVFKLNFLYMLIKFSYLINVCFQLFFTKHFIGADSIIFGLKFILNIIFSLNWNIDTRFPPFILSEAKSRKGFKHMTDVECQLPVNDFLQEVFIFIDLWILVVGIITIFSNIKWICRVFNKRSSSKLIASFMKSNKIEISDSICKQRFFNYLQNDGIFIISIISTNCGSVIATEIIIDLWEMHQHDKITMKKLNSLNYEEIV 360          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000060499.1 (SMESG000060499.1)

HSP 1 Score: 156.762 bits (395), Expect = 7.561e-42
Identity = 109/401 (27.18%), Postives = 202/401 (50.37%), Query Frame = 3
Query:   90 KLIKNRIILEDLFSDYINYKLTSLXXXXXXXXXXXXXNKGTPIQCWMVDDLTKVDDETALKACFYNEYYFLKVVNGNRIENKKIKNEINHYQYYPLMLICQSFLFCLPHLIWYYWLVDCQIDLRALIK------------GLRYSKNY---HLSALAIRNYI----------NDQRD-------------CSCNFSGVFKLNFLYMLIKFSYLINVCFQLFFTKHFIGADSIIFGLKFILNIIFSLNWNIDTRFPPFFLSEAKSRK-GFKHMIDVECQLPVNDFLQEVFIFIDLWILVVGIITIFSNIKWICRVFNKRSSSKLIASFMK-SNKTEISDSICKQRFF-NYLQNDGIFIISIISTNCGNVIATEIIIDLWEMHQHDKIT---MKKLNSLNYEE 1160
            ++  N++  +D F D +NY+ T L+      +I I    G PIQCW+  + T+  +E     C+ +  YF  + N    ++ + +  I +YQ+ P++L  QS LF +P LIW         ++R +++             L+ S ++   H+     R+ I          N +R              C     G F L  LY+ IK  YLIN+  QL+  + FIG     +G++ + +++    W+    FP     + +++K G  H+  ++C LP+N FL++++IF+  W ++VGI T+FS   WI R+ +  +  K+I ++++  N    +D    ++F  +YL++DG F+I +I+ N G+++A ++I ++W++++H +I      K  SLN E 
Sbjct:   52 RIGSNKLRFDDDFVDRLNYQFTGLLLFMFIGLIGIRQYVGKPIQCWIPQEFTRGWEEYTENYCWVSNTYFASIQNRMPSKDARKEQMIGYYQWAPILLGLQSLLFYIPCLIWRNVSPQSGFNVRRILQVASDANCSLIPEQLQKSISFIARHMDTCLYRHRICYEHKHFMRTNGKRSTISRCLAKLRCICCLGKLQGNF-LTVLYISIKILYLINIIGQLYLMEKFIGTKYAFYGIRVLWDLMRGHEWHYSGNFPRVTFCDLEAKKLGKNHLYSLQCVLPMNMFLEKIYIFLWFWHVIVGIATLFSLFSWIKRIGSPVNRIKMIRNYLRLMNILHDTDKGPSRKFAESYLRSDGCFLIQLIAINIGDLVAGDLICEMWQIYRHKRIQEFEELKFTSLNVES 451          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000048374.1 (SMESG000048374.1)

HSP 1 Score: 150.214 bits (378), Expect = 8.674e-40
Identity = 105/372 (28.23%), Postives = 191/372 (51.34%), Query Frame = 3
Query:  117 EDLFSDYINYKLTSLXXXXXXXXXXXXXNKGTPIQCWMVDDLTKVDDETALKACFYNEYYFLKVVNGNRIENKKIKNEINHYQYYPLMLICQSFLFCLPHLIWYYWLVDCQIDLRALIKGLR---------YSKNYHLSALAI-----RNY--------------INDQRDCSCNFS--------GVFKLNFLYMLIKFSYLINVCFQLFFTKHFIGADSIIFGLKFILNIIFSLNWNIDTRFPPFFLSEAKSRK-GFKHMIDVECQLPVNDFLQEVFIFIDLWILVVGIITIFSNIKWICRVFNKRSSSKLIASFMK-SNKTEISDSICKQRFF-NYLQNDGIFIISIISTNCGNVIATEIIIDLWEMHQH 1115
            +D + D +NY++T  +      V+ +    G PIQCW   +  K  ++ +   C+ +  ++  + N   +   K    I +YQ+ P++L  Q+ +F +P LIW   +     ++R +I+             SKN    A  I     RNY              +N ++ C+C FS        G F L FLY ++K  Y+INV  Q++  K F+G DS  FG+K ++++I    WN    FP     E +++K G  ++ +++C LP+N FL++++IF+  + +++GIIT  S   W+ R+   +S  K I  ++K  N    +D+    +F  N L+ DG+FII +++ N G+++A ++ ++LW +++H
Sbjct:   23 DDDWVDRLNYQITCFLHFLFIGVLGLRSYIGKPIQCWAPQEFNKAWEDYSENFCWVSNTFYAPINNNLPLRMDKTSKLIGYYQWTPIVLAVQALMFYIPCLIWRLLMNYSGFNVRRIIQMAGDTNSLVPDINSKNIKFIARYIDTCIDRNYRDCKRNQISVDGKQLNYRKKCNC-FSRHCCHTNHGRF-LFFLYGIVKVLYVINVLLQMYLMKRFLGTDSNFFGVKVLVDLINGFEWNHSGNFPRVTFCEVQTKKLGENNIYNLQCVLPLNMFLEKIYIFLWFYYVILGIITTASFCSWLLRMGYVKSRWKFIRKYLKILNAMRETDNTATLKFTENNLRPDGVFIIYLVTINVGHIVAGDLTVELWNIYRH 392          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000024134.1 (SMESG000024134.1)

HSP 1 Score: 146.747 bits (369), Expect = 7.715e-39
Identity = 94/362 (25.97%), Postives = 189/362 (52.21%), Query Frame = 3
Query:   90 KLIKNRIILEDLFSDYINYKLTSLXXXXXXXXXXXXXNKGTPIQCWMVDDLTKVDDETALKACFYNEYYFLKVVNGNRIE-NKKIKNEINHYQYYPLMLICQSFLFCLPHLIWYYWLVDCQIDLRALIKGL---------RYSKNYHLSALAIRNYINDQRDCSCNFSGVFK-----LNFLYMLIKFSYLINVCFQLFFTKHFIGADSIIFGLKFILNIIFSLNWNIDTRFPPFFLSEAKSRK-GFKHMIDVECQLPVNDFLQEVFIFIDLWILVVGIITIFSNIKWICRVFNKRSSSKLIASFMK-SNKTEISDSICKQRF-FNYLQNDGIFIISIISTNCGNVIATEIIIDLWEMHQHDK 1121
            ++  NRI L D FSD INY+ +S++ I +  +  +    G PIQCW+  + +   +E +   C+ +  Y    VN    E   K   +I++YQ+  ++L  Q+ LF +P ++W   ++    +L+ +++              K+    A+ +   +  ++     +   FK     L F+Y++IK  YL+N+  QL+  + FIG     +G++ + +++  + W     FP     +  ++K G  H+  ++C LP N FL+++FIF+  W +++G IT  S   W+ ++  ++   + I  ++K     + S+   K+ F F+YL+ DG+FI+ +IS N G+++A +++ +LW +++  +
Sbjct:    6 RIGSNRIRLVDDFSDRINYQFSSILIIVLISLTGVWQYFGKPIQCWIPQEFSTGWEEYSESYCWISGTY---PVNRRLPELTDKQDVQISYYQWTSIVLAVQALLFFIPCMMWRLLILQSGFNLQRIMQVAVDANVIIPDHLQKSIKFIAIHMDKCLKSKKIYGTGYKAKFKRLFCNLLFVYIIIKVLYLLNIIGQLYLMQRFIGTSYSFYGIQVLYDLMTGIGWPQSGNFPRVTFCDFTAKKLGKNHIYTIQCVLPFNMFLEKIFIFLWFWNVIIGCITAVSLFCWLNKLMTRKLKFRFIGDYLKLMGLAKNSEESWKENFIFDYLRTDGLFIMHLISINVGDIVAADVVCELWNLYRSQR 364          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000055266.1 (SMESG000055266.1)

HSP 1 Score: 146.747 bits (369), Expect = 1.152e-38
Identity = 88/342 (25.73%), Postives = 174/342 (50.88%), Query Frame = 3
Query:  201 NKGTPIQCWMVDDLTKVDDETALKACFYNEYYFLKVVNGNRIENKKIKNEINHYQYYPLMLICQSFLFCLPHLIWYYWLVDCQIDLRALIKGLR------------------------------YSKNYHLSALAIRNYINDQRDCSCNFSGVFKLNFLYMLIKFSYLINVCFQLFFTKHFIGADSIIFGLKFILNIIFSLNWNIDTRFPPFFLSEAKSRK-GFKHMIDVECQLPVNDFLQEVFIFIDLWILVVGIITIFSNIKWICRVFNKRSSSKLIASFMK----SNKTEISDSICKQRFFNYLQNDGIFIISIISTNCGNVIATEIIIDLWEMHQHDK 1121
            + G PIQCW+  + T+  +E A   C+ ++ YF  V         +   +I++YQ+  ++L  Q+ LF +P +IW   ++    +L+ +++  +                              Y   Y      + +Y+N    C    SG + L+F+Y++IK  YL+NV  QL+  + FIG     +G++ + +++  + W     FP     + K++K G  H+  ++C LP+N FL+++FI +  W +++G IT  S + W+ ++ N++   + I  ++K      K+E  +S  K   F+YL+ DG+FI+ +IS N G+++A +++ +LW +++  +
Sbjct:   41 DDGKPIQCWIPQEFTRGWEEYAESYCWISDTYFNPVDRRLPKLTDRQDVKISYYQWASIVLAVQALLFFIPCMIWRLLILQSGFNLQRIMQVAKDANAIIPDHLQKSIKFIAIHMDKCLKRKKIYGTGYKAKFKRLLSYVNG--GCCARNSGNY-LSFVYIIIKVLYLLNVVGQLYLMQRFIGTSYSFYGIQVLYDLVTGIEWRKSGHFPRITFCDFKTKKLGKNHIYTLQCVLPLNMFLEKIFILLWFWNVIIGCITAVSLLSWLNKLMNRKHKFRFIRDYLKLMELVKKSE--ESWRKNFIFDYLRTDGLFIMHLISINVGDIVAADVVCELWNLYRSQR 377          
The following BLAST results are available for this feature:
BLAST of Innexin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
inx-138.155e-3425.28Innexin [Source:UniProtKB/TrEMBL;Acc:O44887][more]
inx-15.666e-3324.59Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-15.666e-3324.59Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-12.342e-3224.71Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
unc-75.433e-3224.52Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q0... [more]
back to top
BLAST of Innexin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q03412|UNC7_CAEEL1.198e-2924.52Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|O61787|INX16_CAEEL4.994e-2221.69Innexin-16 OS=Caenorhabditis elegans OX=6239 GN=in... [more]
sp|O01393|UNC9_CAEEL8.456e-2223.31Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q19746|INX3_CAEEL2.570e-2126.28Innexin-3 OS=Caenorhabditis elegans OX=6239 GN=inx... [more]
sp|Q23027|INX5_CAEEL1.324e-2022.97Innexin-5 OS=Caenorhabditis elegans OX=6239 GN=inx... [more]
back to top
BLAST of Innexin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8GJJ53.738e-4227.13Innexin OS=Macrostomum lignano OX=282301 GN=inx PE... [more]
A0A267EEW56.253e-3927.06Innexin OS=Macrostomum lignano OX=282301 GN=inx PE... [more]
Q2L6N12.034e-3828.04Innexin OS=Dugesia japonica OX=6161 GN=inx3 PE=2 S... [more]
A0A1I8GCN31.359e-3726.60Innexin OS=Macrostomum lignano OX=282301 GN=inx PE... [more]
A0A1I8GHL01.165e-3627.06Innexin OS=Macrostomum lignano OX=282301 GN=inx PE... [more]
back to top
BLAST of Innexin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000054964.10.000e+098.89SMESG000054964.1[more]
SMESG000060499.17.561e-4227.18SMESG000060499.1[more]
SMESG000048374.18.674e-4028.23SMESG000048374.1[more]
SMESG000024134.17.715e-3925.97SMESG000024134.1[more]
SMESG000055266.11.152e-3825.73SMESG000055266.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035928 ID=SMED30035928|Name=Innexin|organism=Schmidtea mediterranea sexual|type=transcript|length=1573bp
ATCAATTTAGCGTTGCACTTGAACAATTAATATTGTTATTAGGATTGCAA
ATTATGCAATTTTTAGATTGAAATTAATCAAGCAGAATGAAACTCATTAA
AAATCGAATTATTCTGGAAGATTTGTTTTCGGATTATATTAATTACAAAT
TGACAAGTTTAGTATTCATATTTATCGCCATTGTCATTGAAATAGTAATA
AATAAAGGAACCCCAATTCAGTGTTGGATGGTGGACGATTTAACAAAGGT
AGATGATGAAACGGCCTTGAAAGCTTGTTTTTATAATGAATATTATTTTT
TAAAAGTTGTCAATGGAAATCGAATTGAAAATAAGAAAATAAAAAATGAA
ATAAACCATTATCAATATTATCCTCTTATGTTAATTTGCCAGAGTTTTTT
GTTTTGTCTTCCTCATCTGATTTGGTATTATTGGTTAGTCGATTGTCAAA
TAGATCTCAGGGCTCTTATCAAGGGATTGCGCTACTCAAAGAATTATCAT
TTATCAGCACTGGCAATACGAAATTATATCAACGATCAAAGAGATTGCAG
TTGTAATTTCAGTGGAGTTTTCAAATTGAATTTCTTATACATGCTCATCA
AATTTTCTTACCTAATTAATGTTTGTTTCCAATTATTTTTCACTAAACAT
TTTATTGGAGCAGATTCAATAATTTTCGGATTGAAATTTATTTTAAACAT
TATTTTTTCACTCAATTGGAACATAGACACTCGGTTTCCGCCTTTCTTTC
TTAGCGAAGCAAAATCTAGAAAGGGATTTAAACATATGATAGACGTCGAA
TGTCAGCTTCCTGTTAATGATTTCCTCCAAGAAGTTTTCATTTTCATCGA
TTTGTGGATCCTTGTTGTTGGAATTATCACGATTTTCAGCAACATAAAGT
GGATATGTCGAGTATTTAATAAAAGATCCAGTTCAAAATTGATAGCAAGT
TTTATGAAATCCAATAAAACAGAAATCTCTGATTCAATATGCAAACAGAG
ATTCTTTAATTATCTTCAAAATGACGGAATATTCATTATTAGCATCATTT
CCACTAATTGTGGCAATGTCATAGCAACAGAAATAATCATAGACCTATGG
GAAATGCATCAGCATGATAAAATCACGATGAAAAAATTAAATTCATTAAA
TTACGAAGAAATTGTGTAAATCAAGAAATTAATTTTTCGCCATTGCTCAT
TATATTGAATGTAATATTTGTATTTGGTTTTTAATTGTAAAATATGCGAT
TGAATTTCTTTGAGGCTAAATGGCATTTTTATTAATATTCCGATTCAGAC
AATATTTCTATTTCCAGGGATTTAACATAAATCAGGCGTTTCAAACACGT
GGTCCGAAACGAATCACATAGACTTTGTAATTTAACCAAACTTATATGAT
CAACATCTGCAAGCATCACTGAGACTGGTTTCATTGCAGGATATTAAACG
TAACATCAATACTTTGGTTGATGCAAAGCGATGCCAGTTAAGTAGCCAGA
AAAGGAATTGATTTCATAATAACATTAATTTAGAATTTTAATGTAAGGCG
GCAGCATAATGATTACGAGAAAG
back to top

protein sequence of SMED30035928-orf-1

>SMED30035928-orf-1 ID=SMED30035928-orf-1|Name=SMED30035928-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=361bp
MKLIKNRIILEDLFSDYINYKLTSLVFIFIAIVIEIVINKGTPIQCWMVD
DLTKVDDETALKACFYNEYYFLKVVNGNRIENKKIKNEINHYQYYPLMLI
CQSFLFCLPHLIWYYWLVDCQIDLRALIKGLRYSKNYHLSALAIRNYIND
QRDCSCNFSGVFKLNFLYMLIKFSYLINVCFQLFFTKHFIGADSIIFGLK
FILNIIFSLNWNIDTRFPPFFLSEAKSRKGFKHMIDVECQLPVNDFLQEV
FIFIDLWILVVGIITIFSNIKWICRVFNKRSSSKLIASFMKSNKTEISDS
ICKQRFFNYLQNDGIFIISIISTNCGNVIATEIIIDLWEMHQHDKITMKK
LNSLNYEEIV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0005921gap junction
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030054cell junction
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000990Innexin
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000990InnexinPRINTSPR01262INNEXINcoord: 91..113
score: 36.87
coord: 168..182
score: 41.87
coord: 239..255
score: 33.88
coord: 35..46
score: 34.0
IPR000990InnexinPFAMPF00876Innexincoord: 14..339
e-value: 6.5E-52
score: 177.0
IPR000990InnexinPANTHERPTHR11893INNEXINcoord: 12..350
IPR000990InnexinPROSITEPS51013PANNEXINcoord: 7..347
score: 21.866
NoneNo IPR availableTMHMMTMhelixcoord: 17..39
NoneNo IPR availableTMHMMTMhelixcoord: 164..186
NoneNo IPR availableTMHMMTMhelixcoord: 313..335
NoneNo IPR availableTMHMMTMhelixcoord: 251..273
NoneNo IPR availableTMHMMTMhelixcoord: 95..117