WD_REPEATS_REGION domain-containing protein

Overview
NameWD_REPEATS_REGION domain-containing protein
Smed IDSMED30035927
Length (bp)1575
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of WD_REPEATS_REGION domain-containing protein (SMED30035927) t-SNE clustered cells

Violin plots show distribution of expression levels for WD_REPEATS_REGION domain-containing protein (SMED30035927) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of WD_REPEATS_REGION domain-containing protein (SMED30035927) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for WD_REPEATS_REGION domain-containing protein (SMED30035927) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035927

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30035927SMESG000039027.1 SmedASXL_013717SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
zeta neoblastSMED30035927SMESG000039027.1 dd_Smed_v4_14734_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035927SMESG000039027.1 SMED_28067_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30035927SMESG000039027.1 SMED_28067_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Human
Match: NEDD1 (NEDD1 gamma-tubulin ring complex targeting factor [Source:HGNC Symbol;Acc:HGNC:7723])

HSP 1 Score: 58.9214 bits (141), Expect = 1.692e-8
Identity = 77/303 (25.41%), Postives = 134/303 (44.22%), Query Frame = 2
Query:   92 WNKNPQLSIFNFKQYSKPKIREINC---EDDILVASDYNGDNIAVLE-KLNNKMNIYTAEGTLKSSLNGNFNFNCMVLYGSDCLLTGENHGKIRVYDLKN-NLTRKLFDTNYPITVDLIDVSIDNKNIFVCY-ADGKLSKLEIKTARVDNLTWIS------EKIKCLKISPWVANNLLVGSV--NGSVSLYDANNHSRVFT-SNTHKGMVNCVSYSYFNDKIAISVGEDKQAILYGINESRPLKTYKTISPVTHCS-ISDGVLFSFGEANGDISIYDIRKLN---KFVYFHKLNDRISYLQFT 943
            W+ +    +  F  ++ P      C    ++ LV +  +GD I V   K      +  AEG  ++ +N     N   +Y    L++G  +  + ++DLK+  + R L D    +T           N   CY A G LS   I  +   NL+         + ++ LK S  +    L+GSV  NG V+L+D N+ S      + HK   + + +S  N+ + +++G DK+ ILY  +  + +KT    +P+T    + DG   + G + G I  YD+R L    K +  HK + +    Q++
Sbjct:   17 WDASSMTLVDKFNPHTSPHGISSICWSSNNNFLVTASSSGDKIVVSSCKCKPVPLLELAEGQKQTCVN----LNSTSMY----LVSGGLNNTVNIWDLKSKRVHRSLKDHKDQVTCVTY-------NWNDCYIASGSLSGEIILHSVTTNLSSTPFGHGSNQSVRHLKYS--LFKKSLLGSVSDNGIVTLWDVNSQSPYHNFDSVHKAPASGICFSPVNELLFVTIGLDKRIILYDTSSKKLVKTLVADTPLTAVDFMPDGATLAIGSSRGKIYQYDLRMLKSPVKTISAHKTSVQCIAFQYS 302          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Human
Match: NEDD1 (NEDD1 gamma-tubulin ring complex targeting factor [Source:HGNC Symbol;Acc:HGNC:7723])

HSP 1 Score: 58.9214 bits (141), Expect = 1.692e-8
Identity = 77/303 (25.41%), Postives = 134/303 (44.22%), Query Frame = 2
Query:   92 WNKNPQLSIFNFKQYSKPKIREINC---EDDILVASDYNGDNIAVLE-KLNNKMNIYTAEGTLKSSLNGNFNFNCMVLYGSDCLLTGENHGKIRVYDLKN-NLTRKLFDTNYPITVDLIDVSIDNKNIFVCY-ADGKLSKLEIKTARVDNLTWIS------EKIKCLKISPWVANNLLVGSV--NGSVSLYDANNHSRVFT-SNTHKGMVNCVSYSYFNDKIAISVGEDKQAILYGINESRPLKTYKTISPVTHCS-ISDGVLFSFGEANGDISIYDIRKLN---KFVYFHKLNDRISYLQFT 943
            W+ +    +  F  ++ P      C    ++ LV +  +GD I V   K      +  AEG  ++ +N     N   +Y    L++G  +  + ++DLK+  + R L D    +T           N   CY A G LS   I  +   NL+         + ++ LK S  +    L+GSV  NG V+L+D N+ S      + HK   + + +S  N+ + +++G DK+ ILY  +  + +KT    +P+T    + DG   + G + G I  YD+R L    K +  HK + +    Q++
Sbjct:   17 WDASSMTLVDKFNPHTSPHGISSICWSSNNNFLVTASSSGDKIVVSSCKCKPVPLLELAEGQKQTCVN----LNSTSMY----LVSGGLNNTVNIWDLKSKRVHRSLKDHKDQVTCVTY-------NWNDCYIASGSLSGEIILHSVTTNLSSTPFGHGSNQSVRHLKYS--LFKKSLLGSVSDNGIVTLWDVNSQSPYHNFDSVHKAPASGICFSPVNELLFVTIGLDKRIILYDTSSKKLVKTLVADTPLTAVDFMPDGATLAIGSSRGKIYQYDLRMLKSPVKTISAHKTSVQCIAFQYS 302          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Human
Match: NEDD1 (NEDD1 gamma-tubulin ring complex targeting factor [Source:HGNC Symbol;Acc:HGNC:7723])

HSP 1 Score: 58.9214 bits (141), Expect = 1.716e-8
Identity = 77/303 (25.41%), Postives = 134/303 (44.22%), Query Frame = 2
Query:   92 WNKNPQLSIFNFKQYSKPKIREINC---EDDILVASDYNGDNIAVLE-KLNNKMNIYTAEGTLKSSLNGNFNFNCMVLYGSDCLLTGENHGKIRVYDLKN-NLTRKLFDTNYPITVDLIDVSIDNKNIFVCY-ADGKLSKLEIKTARVDNLTWIS------EKIKCLKISPWVANNLLVGSV--NGSVSLYDANNHSRVFT-SNTHKGMVNCVSYSYFNDKIAISVGEDKQAILYGINESRPLKTYKTISPVTHCS-ISDGVLFSFGEANGDISIYDIRKLN---KFVYFHKLNDRISYLQFT 943
            W+ +    +  F  ++ P      C    ++ LV +  +GD I V   K      +  AEG  ++ +N     N   +Y    L++G  +  + ++DLK+  + R L D    +T           N   CY A G LS   I  +   NL+         + ++ LK S  +    L+GSV  NG V+L+D N+ S      + HK   + + +S  N+ + +++G DK+ ILY  +  + +KT    +P+T    + DG   + G + G I  YD+R L    K +  HK + +    Q++
Sbjct:   24 WDASSMTLVDKFNPHTSPHGISSICWSSNNNFLVTASSSGDKIVVSSCKCKPVPLLELAEGQKQTCVN----LNSTSMY----LVSGGLNNTVNIWDLKSKRVHRSLKDHKDQVTCVTY-------NWNDCYIASGSLSGEIILHSVTTNLSSTPFGHGSNQSVRHLKYS--LFKKSLLGSVSDNGIVTLWDVNSQSPYHNFDSVHKAPASGICFSPVNELLFVTIGLDKRIILYDTSSKKLVKTLVADTPLTAVDFMPDGATLAIGSSRGKIYQYDLRMLKSPVKTISAHKTSVQCIAFQYS 309          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Human
Match: NEDD1 (NEDD1 gamma-tubulin ring complex targeting factor [Source:HGNC Symbol;Acc:HGNC:7723])

HSP 1 Score: 55.8398 bits (133), Expect = 1.233e-7
Identity = 38/126 (30.16%), Postives = 66/126 (52.38%), Query Frame = 2
Query:  587 LVGSV--NGSVSLYDANNHSRVFT-SNTHKGMVNCVSYSYFNDKIAISVGEDKQAILYGINESRPLKTYKTISPVTHCS-ISDGVLFSFGEANGDISIYDIRKLN---KFVYFHKLNDRISYLQFT 943
            L+GSV  NG V+L+D N+ S      + HK   + + +S  N+ + +++G DK+ ILY  +  + +KT    +P+T    + DG   + G + G I  YD+R L    K +  HK + +    Q++
Sbjct:   88 LLGSVSDNGIVTLWDVNSQSPYHNFDSVHKAPASGICFSPVNELLFVTIGLDKRIILYDTSSKKLVKTLVADTPLTAVDFMPDGATLAIGSSRGKIYQYDLRMLKSPVKTISAHKTSVQCIAFQYS 213          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Human
Match: NEDD1 (NEDD1 gamma-tubulin ring complex targeting factor [Source:HGNC Symbol;Acc:HGNC:7723])

HSP 1 Score: 55.8398 bits (133), Expect = 1.233e-7
Identity = 38/126 (30.16%), Postives = 66/126 (52.38%), Query Frame = 2
Query:  587 LVGSV--NGSVSLYDANNHSRVFT-SNTHKGMVNCVSYSYFNDKIAISVGEDKQAILYGINESRPLKTYKTISPVTHCS-ISDGVLFSFGEANGDISIYDIRKLN---KFVYFHKLNDRISYLQFT 943
            L+GSV  NG V+L+D N+ S      + HK   + + +S  N+ + +++G DK+ ILY  +  + +KT    +P+T    + DG   + G + G I  YD+R L    K +  HK + +    Q++
Sbjct:   88 LLGSVSDNGIVTLWDVNSQSPYHNFDSVHKAPASGICFSPVNELLFVTIGLDKRIILYDTSSKKLVKTLVADTPLTAVDFMPDGATLAIGSSRGKIYQYDLRMLKSPVKTISAHKTSVQCIAFQYS 213          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Zebrafish
Match: nedd1 (NEDD1 gamma-tubulin ring complex targeting factor [Source:ZFIN;Acc:ZDB-GENE-040426-2906])

HSP 1 Score: 51.2174 bits (121), Expect = 2.835e-6
Identity = 33/108 (30.56%), Postives = 56/108 (51.85%), Query Frame = 2
Query:  587 LVGSVN--GSVSLYDANNHSRV-FTSNTHKGMVNCVSYSYFNDKIAISVGEDKQAILYGINESRPLKTYKTISPVTHCSIS-DGVLFSFGEANGDISIYDIRKLNKFV 898
            L+G+V+  GSV+L+DAN    +      HK   + +++S  ND + ++VG DK+ + Y  +     +  +  SP+T    + DG     G   G I +YD+R L+  V
Sbjct:  177 LLGTVSDSGSVALWDANTQKELHLFEGAHKAPCSGLAFSPANDLLFVTVGLDKKIVCYDTSSKIVFRNKQVESPLTAIDFTPDGAGLVVGSTQGRIYLYDLRNLSAPV 284          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Zebrafish
Match: nedd1 (NEDD1 gamma-tubulin ring complex targeting factor [Source:ZFIN;Acc:ZDB-GENE-040426-2906])

HSP 1 Score: 51.2174 bits (121), Expect = 2.938e-6
Identity = 33/108 (30.56%), Postives = 56/108 (51.85%), Query Frame = 2
Query:  587 LVGSVN--GSVSLYDANNHSRV-FTSNTHKGMVNCVSYSYFNDKIAISVGEDKQAILYGINESRPLKTYKTISPVTHCSIS-DGVLFSFGEANGDISIYDIRKLNKFV 898
            L+G+V+  GSV+L+DAN    +      HK   + +++S  ND + ++VG DK+ + Y  +     +  +  SP+T    + DG     G   G I +YD+R L+  V
Sbjct:  177 LLGTVSDSGSVALWDANTQKELHLFEGAHKAPCSGLAFSPANDLLFVTVGLDKKIVCYDTSSKIVFRNKQVESPLTAIDFTPDGAGLVVGSTQGRIYLYDLRNLSAPV 284          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Xenopus
Match: nedd1 (NEDD1 gamma-tubulin ring complex targeting factor [Source:NCBI gene;Acc:779911])

HSP 1 Score: 67.3958 bits (163), Expect = 2.706e-11
Identity = 81/272 (29.78%), Postives = 132/272 (48.53%), Query Frame = 2
Query:  179 LVASDYNGDNIAVLEKLNNKMNIYT-AEGTLKSSLNGNFNFNCMVLYGSDCLLTGENHGKIRVYDLKN-NLTRKLFDTNYPITVDLIDVSIDNKNIFVCYADGKLSKLEIKTARVDNLTWI------SEKIKCLKISPWVANNLLVGSVN--GSVSLYDAN--NHSRVFTSNTHKGMVNCVSYSYFNDKIAISVGEDKQAILYGINESRPLKTYKTISPVTHCS-ISDGVLFSFGEANGDISIYDIRKLN---KFVYFHKLNDRISYLQFTY 946
            LV +  +GD I V    +  + +   AEG  ++ +N N +   +V  G D          + ++DLK+  L R L D    +T     V+ +  + +V  A G +S   I      NL+        S+ I+ LK S +V  +LL G+V+  GSV+L+DAN  N   VF S  HK   + + +S  ND + +++G DK+ I Y ++    L+T    SP+T    + DG   + G + G I +YD+R L+   K V  HK +  +  +QF +
Sbjct:   49 LVTASGSGDKIVVSSCKSKPVPLLELAEGKKQTCVNLNSSSQYVVSGGLD--------NTVNIWDLKSKRLHRSLKDHKDEVTC----VTFNANDCYV--ASGSMSGEIILHNVTTNLSSTPFGHGSSQPIRHLKYS-YVKKSLL-GTVSDSGSVTLWDANSQNPYHVFES-AHKAPASGICFSPVNDLLLVTIGLDKRIICYDVSSKILLQTVVAESPLTAVDFMPDGATLAVGSSRGKIYLYDLRMLSSPVKTVSAHKTS--VQCIQFQH 301          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Xenopus
Match: nedd1 (NEDD1 gamma-tubulin ring complex targeting factor [Source:NCBI gene;Acc:779911])

HSP 1 Score: 67.3958 bits (163), Expect = 3.510e-11
Identity = 81/272 (29.78%), Postives = 132/272 (48.53%), Query Frame = 2
Query:  179 LVASDYNGDNIAVLEKLNNKMNIYT-AEGTLKSSLNGNFNFNCMVLYGSDCLLTGENHGKIRVYDLKN-NLTRKLFDTNYPITVDLIDVSIDNKNIFVCYADGKLSKLEIKTARVDNLTWI------SEKIKCLKISPWVANNLLVGSVN--GSVSLYDAN--NHSRVFTSNTHKGMVNCVSYSYFNDKIAISVGEDKQAILYGINESRPLKTYKTISPVTHCS-ISDGVLFSFGEANGDISIYDIRKLN---KFVYFHKLNDRISYLQFTY 946
            LV +  +GD I V    +  + +   AEG  ++ +N N +   +V  G D          + ++DLK+  L R L D    +T     V+ +  + +V  A G +S   I      NL+        S+ I+ LK S +V  +LL G+V+  GSV+L+DAN  N   VF S  HK   + + +S  ND + +++G DK+ I Y ++    L+T    SP+T    + DG   + G + G I +YD+R L+   K V  HK +  +  +QF +
Sbjct:   49 LVTASGSGDKIVVSSCKSKPVPLLELAEGKKQTCVNLNSSSQYVVSGGLD--------NTVNIWDLKSKRLHRSLKDHKDEVTC----VTFNANDCYV--ASGSMSGEIILHNVTTNLSSTPFGHGSSQPIRHLKYS-YVKKSLL-GTVSDSGSVTLWDANSQNPYHVFES-AHKAPASGICFSPVNDLLLVTIGLDKRIICYDVSSKILLQTVVAESPLTAVDFMPDGATLAVGSSRGKIYLYDLRMLSSPVKTVSAHKTS--VQCIQFQH 301          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Xenopus
Match: nedd1 (NEDD1 gamma-tubulin ring complex targeting factor [Source:NCBI gene;Acc:779911])

HSP 1 Score: 67.0106 bits (162), Expect = 4.066e-11
Identity = 81/272 (29.78%), Postives = 132/272 (48.53%), Query Frame = 2
Query:  179 LVASDYNGDNIAVLEKLNNKMNIYT-AEGTLKSSLNGNFNFNCMVLYGSDCLLTGENHGKIRVYDLKN-NLTRKLFDTNYPITVDLIDVSIDNKNIFVCYADGKLSKLEIKTARVDNLTWI------SEKIKCLKISPWVANNLLVGSVN--GSVSLYDAN--NHSRVFTSNTHKGMVNCVSYSYFNDKIAISVGEDKQAILYGINESRPLKTYKTISPVTHCS-ISDGVLFSFGEANGDISIYDIRKLN---KFVYFHKLNDRISYLQFTY 946
            LV +  +GD I V    +  + +   AEG  ++ +N N +   +V  G D          + ++DLK+  L R L D    +T     V+ +  + +V  A G +S   I      NL+        S+ I+ LK S +V  +LL G+V+  GSV+L+DAN  N   VF S  HK   + + +S  ND + +++G DK+ I Y ++    L+T    SP+T    + DG   + G + G I +YD+R L+   K V  HK +  +  +QF +
Sbjct:   65 LVTASGSGDKIVVSSCKSKPVPLLELAEGKKQTCVNLNSSSQYVVSGGLD--------NTVNIWDLKSKRLHRSLKDHKDEVTC----VTFNANDCYV--ASGSMSGEIILHNVTTNLSSTPFGHGSSQPIRHLKYS-YVKKSLL-GTVSDSGSVTLWDANSQNPYHVFES-AHKAPASGICFSPVNDLLLVTIGLDKRIICYDVSSKILLQTVVAESPLTAVDFMPDGATLAVGSSRGKIYLYDLRMLSSPVKTVSAHKTS--VQCIQFQH 317          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Xenopus
Match: nedd1 (NEDD1 gamma-tubulin ring complex targeting factor [Source:NCBI gene;Acc:779911])

HSP 1 Score: 67.0106 bits (162), Expect = 4.642e-11
Identity = 81/272 (29.78%), Postives = 132/272 (48.53%), Query Frame = 2
Query:  179 LVASDYNGDNIAVLEKLNNKMNIYT-AEGTLKSSLNGNFNFNCMVLYGSDCLLTGENHGKIRVYDLKN-NLTRKLFDTNYPITVDLIDVSIDNKNIFVCYADGKLSKLEIKTARVDNLTWI------SEKIKCLKISPWVANNLLVGSVN--GSVSLYDAN--NHSRVFTSNTHKGMVNCVSYSYFNDKIAISVGEDKQAILYGINESRPLKTYKTISPVTHCS-ISDGVLFSFGEANGDISIYDIRKLN---KFVYFHKLNDRISYLQFTY 946
            LV +  +GD I V    +  + +   AEG  ++ +N N +   +V  G D          + ++DLK+  L R L D    +T     V+ +  + +V  A G +S   I      NL+        S+ I+ LK S +V  +LL G+V+  GSV+L+DAN  N   VF S  HK   + + +S  ND + +++G DK+ I Y ++    L+T    SP+T    + DG   + G + G I +YD+R L+   K V  HK +  +  +QF +
Sbjct:   67 LVTASGSGDKIVVSSCKSKPVPLLELAEGKKQTCVNLNSSSQYVVSGGLD--------NTVNIWDLKSKRLHRSLKDHKDEVTC----VTFNANDCYV--ASGSMSGEIILHNVTTNLSSTPFGHGSSQPIRHLKYS-YVKKSLL-GTVSDSGSVTLWDANSQNPYHVFES-AHKAPASGICFSPVNDLLLVTIGLDKRIICYDVSSKILLQTVVAESPLTAVDFMPDGATLAVGSSRGKIYLYDLRMLSSPVKTVSAHKTS--VQCIQFQH 319          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Xenopus
Match: nedd1 (NEDD1 gamma-tubulin ring complex targeting factor [Source:NCBI gene;Acc:779911])

HSP 1 Score: 66.6254 bits (161), Expect = 4.957e-11
Identity = 81/272 (29.78%), Postives = 132/272 (48.53%), Query Frame = 2
Query:  179 LVASDYNGDNIAVLEKLNNKMNIYT-AEGTLKSSLNGNFNFNCMVLYGSDCLLTGENHGKIRVYDLKN-NLTRKLFDTNYPITVDLIDVSIDNKNIFVCYADGKLSKLEIKTARVDNLTWI------SEKIKCLKISPWVANNLLVGSVN--GSVSLYDAN--NHSRVFTSNTHKGMVNCVSYSYFNDKIAISVGEDKQAILYGINESRPLKTYKTISPVTHCS-ISDGVLFSFGEANGDISIYDIRKLN---KFVYFHKLNDRISYLQFTY 946
            LV +  +GD I V    +  + +   AEG  ++ +N N +   +V  G D          + ++DLK+  L R L D    +T     V+ +  + +V  A G +S   I      NL+        S+ I+ LK S +V  +LL G+V+  GSV+L+DAN  N   VF S  HK   + + +S  ND + +++G DK+ I Y ++    L+T    SP+T    + DG   + G + G I +YD+R L+   K V  HK +  +  +QF +
Sbjct:   49 LVTASGSGDKIVVSSCKSKPVPLLELAEGKKQTCVNLNSSSQYVVSGGLD--------NTVNIWDLKSKRLHRSLKDHKDEVTC----VTFNANDCYV--ASGSMSGEIILHNVTTNLSSTPFGHGSSQPIRHLKYS-YVKKSLL-GTVSDSGSVTLWDANSQNPYHVFES-AHKAPASGICFSPVNDLLLVTIGLDKRIICYDVSSKILLQTVVAESPLTAVDFMPDGATLAVGSSRGKIYLYDLRMLSSPVKTVSAHKTS--VQCIQFQH 301          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Mouse
Match: Nedd1 (neural precursor cell expressed, developmentally down-regulated gene 1 [Source:MGI Symbol;Acc:MGI:97293])

HSP 1 Score: 60.8474 bits (146), Expect = 2.801e-9
Identity = 40/126 (31.75%), Postives = 68/126 (53.97%), Query Frame = 2
Query:  587 LVGSV--NGSVSLYDANNHSRVFT-SNTHKGMVNCVSYSYFNDKIAISVGEDKQAILYGINESRPLKTYKTISPVTHCS-ISDGVLFSFGEANGDISIYDIRKLN---KFVYFHKLNDRISYLQFT 943
            L+GSV  NG V+L+D N+ S   T  +THK   + + +S  N+ + +++G DK+ ILY  +  + +KT    +P+T    + DG   + G + G I  YD+R L    K +  HK + +    Q++
Sbjct:  177 LLGSVSDNGVVTLWDVNSQSSYHTFDSTHKAPASGICFSPVNELLFVTIGLDKRIILYDTSSKKLVKTLVADTPLTAVDFMPDGATLAIGSSRGKIYQYDLRMLKSPVKTISAHKTSVQCIAFQYS 302          
BLAST of WD_REPEATS_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|P33215|NEDD1_MOUSE (Protein NEDD1 OS=Mus musculus OX=10090 GN=Nedd1 PE=1 SV=2)

HSP 1 Score: 60.8474 bits (146), Expect = 1.959e-8
Identity = 40/126 (31.75%), Postives = 68/126 (53.97%), Query Frame = 2
Query:  587 LVGSV--NGSVSLYDANNHSRVFT-SNTHKGMVNCVSYSYFNDKIAISVGEDKQAILYGINESRPLKTYKTISPVTHCS-ISDGVLFSFGEANGDISIYDIRKLN---KFVYFHKLNDRISYLQFT 943
            L+GSV  NG V+L+D N+ S   T  +THK   + + +S  N+ + +++G DK+ ILY  +  + +KT    +P+T    + DG   + G + G I  YD+R L    K +  HK + +    Q++
Sbjct:  177 LLGSVSDNGVVTLWDVNSQSSYHTFDSTHKAPASGICFSPVNELLFVTIGLDKRIILYDTSSKKLVKTLVADTPLTAVDFMPDGATLAIGSSRGKIYQYDLRMLKSPVKTISAHKTSVQCIAFQYS 302          
BLAST of WD_REPEATS_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q3B7M6|NEDD1_BOVIN (Protein NEDD1 OS=Bos taurus OX=9913 GN=NEDD1 PE=2 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 3.073e-8
Identity = 78/303 (25.74%), Postives = 135/303 (44.55%), Query Frame = 2
Query:   92 WNKNPQLSIFNFKQYSKPKIREINC---EDDILVASDYNGDNIAVLE-KLNNKMNIYTAEGTLKSSLNGNFNFNCMVLYGSDCLLTGENHGKIRVYDLKN-NLTRKLFDTNYPITVDLIDVSIDNKNIFVCY-ADGKLSKLEIKTARVDNLTWIS------EKIKCLKISPWVANNLLVGSV--NGSVSLYDANNHSRVFT-SNTHKGMVNCVSYSYFNDKIAISVGEDKQAILYGINESRPLKTYKTISPVTHCS-ISDGVLFSFGEANGDISIYDIRKLN---KFVYFHKLNDRISYLQFT 943
            W+ +    +  F  ++ P      C    ++ LV +  +GD I V   K      +   EG  ++ ++     N   +Y    L++G  +  + ++DLK+  + R L D          +V+    N   CY A G LS   I  +   NL+         + I+ LK S  +    L+GSV  NG V+L+D N+ S      +THK   + + +S  N+ + ++VG DK+ ILY  +  + +KT    +P+T    + DG   + G + G I  YD+R L    K +  HK + +    Q++
Sbjct:   17 WDASSMTLVDKFNPHTAPHAISSVCWSSNNNFLVTASSSGDKIVVSSCKCKPVPLLELGEGQKQTCVS----LNSTSMY----LVSGGLNNTVNIWDLKSKRVHRSLKDHKD-------EVTCVTYNWNDCYIASGSLSGEIILHSVTTNLSSTPFGHGSNQSIRHLKYS--LFKKSLLGSVSDNGIVTLWDVNSQSPYHNFDSTHKAPASGICFSPVNELLFVTVGLDKRIILYDTSSKKLVKTLVADAPLTAVDFMPDGATLAIGSSRGKIYQYDLRMLKSPIKTISAHKTSVQCIAFQYS 302          
BLAST of WD_REPEATS_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8NHV4|NEDD1_HUMAN (Protein NEDD1 OS=Homo sapiens OX=9606 GN=NEDD1 PE=1 SV=1)

HSP 1 Score: 58.9214 bits (141), Expect = 8.124e-8
Identity = 77/303 (25.41%), Postives = 134/303 (44.22%), Query Frame = 2
Query:   92 WNKNPQLSIFNFKQYSKPKIREINC---EDDILVASDYNGDNIAVLE-KLNNKMNIYTAEGTLKSSLNGNFNFNCMVLYGSDCLLTGENHGKIRVYDLKN-NLTRKLFDTNYPITVDLIDVSIDNKNIFVCY-ADGKLSKLEIKTARVDNLTWIS------EKIKCLKISPWVANNLLVGSV--NGSVSLYDANNHSRVFT-SNTHKGMVNCVSYSYFNDKIAISVGEDKQAILYGINESRPLKTYKTISPVTHCS-ISDGVLFSFGEANGDISIYDIRKLN---KFVYFHKLNDRISYLQFT 943
            W+ +    +  F  ++ P      C    ++ LV +  +GD I V   K      +  AEG  ++ +N     N   +Y    L++G  +  + ++DLK+  + R L D    +T           N   CY A G LS   I  +   NL+         + ++ LK S  +    L+GSV  NG V+L+D N+ S      + HK   + + +S  N+ + +++G DK+ ILY  +  + +KT    +P+T    + DG   + G + G I  YD+R L    K +  HK + +    Q++
Sbjct:   17 WDASSMTLVDKFNPHTSPHGISSICWSSNNNFLVTASSSGDKIVVSSCKCKPVPLLELAEGQKQTCVN----LNSTSMY----LVSGGLNNTVNIWDLKSKRVHRSLKDHKDQVTCVTY-------NWNDCYIASGSLSGEIILHSVTTNLSSTPFGHGSNQSVRHLKYS--LFKKSLLGSVSDNGIVTLWDVNSQSPYHNFDSVHKAPASGICFSPVNELLFVTIGLDKRIILYDTSSKKLVKTLVADTPLTAVDFMPDGATLAIGSSRGKIYQYDLRMLKSPVKTISAHKTSVQCIAFQYS 302          
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: T2M8K8 (Protein NEDD1 OS=Hydra vulgaris OX=6087 GN=NEDD1 PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.076e-11
Identity = 81/300 (27.00%), Postives = 140/300 (46.67%), Query Frame = 2
Query:  104 PQLSIFNFKQYSKPKIREINCE-DDILVASDYNGD--NIAVL-EKLNNKMNIYTAEGTLKSSLNGNFNFNCMVLYGSDCLLTGENHGKIRVYDLKNNLTRKLF-DTNYPITVDL-------IDVSIDNKNIFVCYADGKLSKLEIKTARVDNLTWISEKIKCLKISPWVANNLLVGSVN--GSVSLYDANNHSRVFTSNTHKGMVNCVSYSYFNDKIAISVGEDKQAILYGINESRPLKTYKTISPVTHCS-ISDGVLFSFGEANGDISIYDIRKLN---KFVYFHKLNDRISYLQFTYK 949
            P L++ + K  +   +   +C  +  LVA  + G+  N+A L E   + +NI T+      S NGN  +  +V  G D ++         ++D+K+   ++++ D  +P+T  +       I  S ++ NI +      +S   + T         ++ I+ L  S +V +  L+ S+N  G+VSL+D      + T   HKG    VS+S  ND +  S G DK+ I Y +   + +KT  T  PVT C  + DG   + G A+G + ++D+R+ +   K V  HK + R    Q   K
Sbjct:   19 PTLNLHSVKNGTNANLTSCSCSPNGQLVAYAHEGEGLNVASLQEDDQDVINIPTSCEQSSVSFNGNSRY--LVSSGVDHVVC--------IWDIKSKTAKRIYKDHTHPVTCSIFNYNDNTIASSSNHGNILLTNVQSGVSSEPLSTGE-------NQAIRSLNYSHFVRS--LLASINDSGAVSLWDTKEKKLIKTFTEHKGPGTKVSFSPLNDMLLCSCGLDKRIIFYDVTGKKMVKTINTEGPVTCCEFMHDGCTVAAGTASGRLYLFDLRQGSTPVKVVTAHKTSVRSVSFQMIPK 299          
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: V8NU28 (Protein NEDD1 (Fragment) OS=Ophiophagus hannah OX=8665 GN=NEDD1 PE=4 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 2.443e-10
Identity = 83/288 (28.82%), Postives = 133/288 (46.18%), Query Frame = 2
Query:  164 CEDDILVASDYNGDNIAVLEKLNNKMNIYT-AEGTLKSSLNGNFNFNCMVLYGSDCLLTGENHGKIRVYDLK-NNLTRKLFDTNYPITVDLIDVSIDNKNIFVCYADGKLSKLEIKTARVDNLT------WISEKIKCLKISPWVANNLLVGSVN--GSVSLYDANNHSRVFT-SNTHKGMVNCVSYSYFNDKIAISVGEDKQAILYGINESRPLKTYKTISPVTHCS-ISDGVLFSFGEANGDISIYDIRKLN---KFVYFHKLNDRISYLQ----FTYKSHQNGDS 970
            C D+ LV +   GD I V       + ++  AEGT ++ ++ + N   +   G D          + ++DLK   L R L D    IT     VS +  + +V  A G +S   I  +   NL+        ++ I+ LK SP+     L+GSV+  G+V+L+D N+        N HK     + +S  ++ + ++VG DK+ ILY     R L+T    +P+T    + +G   + G + G I  YD+RKL    K V  HK + +   LQ    F+  SH+ G S
Sbjct:   68 CWDNFLVTTSAVGDKIVVSNCKGKPVPLFELAEGTKQTCISLSSNSMYIASGGID--------STVNIWDLKYRKLHRSLKDHREEITC----VSFNWNDCYV--ASGSMSGEIILHSIATNLSSTPFGHGTTQPIRHLKYSPF--KKALLGSVSDSGTVTLWDVNSQIPYHNFENAHKAPAYEICFSPISELLLVTVGLDKRIILYDTASKRQLRTLVAETPLTAVEFMPEGTSLTIGSSRGKIYHYDLRKLTAPVKSVTAHKTSVKCITLQNYNSFSKSSHKTGSS 339          
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: I7M3Y6 (Cytochrome d1 heme domain protein OS=Tetrahymena thermophila (strain SB210) OX=312017 GN=TTHERM_00237640 PE=4 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.996e-9
Identity = 57/213 (26.76%), Postives = 102/213 (47.89%), Query Frame = 2
Query:  317 GSDCLLTGENHGKIRVYDLKNNLTRKLFDTNYPITVDLIDVSIDNKNIFVCYADGKLSKLEIKTARVDN-LTWISE--KIKCLKISPWVANNLLVGSVNGSVSLYDANNHSRVFTSNTHKGMVNCVSYSYFNDKIAISVGEDKQAILYGINESRPLKTYKTISPVTHCSI-SDGVLFSFGEANGDISIYDIRKLNK---FVYFHKLNDRISYL 934
             S  L +G ++G++++YDLKN    K + +N+   V  +D    ++N ++  +  ++  + +     D  +   SE   ++ +K SP   N L     +G VS +D N   ++     H+  VN V++S  N  +A S   D    LY INE + +K     SP+T  +  SDG     G   G++ +YD++ L K    +  H  N  ++Y+
Sbjct:   90 ASTKLASGGSNGRVKIYDLKNQCIAKTY-SNHFGGVTCVDW---HQNDYILASSSQVGDIFLYNTENDQQVATFSENNSVQQIKFSPQRNNYLASCCGDGRVSFWDVNTKQQIAVFQNHQSKVNSVTFSPHNRVLATSASLDATINLYDINEKKVVKKLSCDSPITSLAFHSDGYTLIAGTLYGELMVYDLKNLPKPKLLLEGHTKNQAVNYI 298          
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: A0A2D4H148 (WD_REPEATS_REGION domain-containing protein (Fragment) OS=Micrurus corallinus OX=54390 PE=4 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 2.198e-9
Identity = 81/286 (28.32%), Postives = 134/286 (46.85%), Query Frame = 2
Query:  170 DDILVASDYNGDNIAVLEKLNNKMNIYT-AEGTLKSSLNGNFNFNCMVLYGSDCLLTGENHGKIRVYDLK-NNLTRKLFDTNYPITVDLIDVSIDNKNIFVCYADGKLSKLEIKTARVDNLT------WISEKIKCLKISPWVANNLLVGSVN--GSVSLYDANNHSRVFT-SNTHKGMVNCVSYSYFNDKIAISVGEDKQAILYGINESRPLKTYKTISPVTHCS-ISDGVLFSFGEANGDISIYDIRKLN---KFVYFHKLNDRISYLQ----FTYKSHQNGDS 970
            ++ LV +   GD I V       + ++  AEGT ++ ++   + N M +       +G     + ++DLK   L R L D    IT     VS +  + +V  A G +S   I  +   NL+        ++ I+ LK SP+     L+GSV+  G+V+L+D N+ +      N HK     + +S  ++ + ++VG DK+ ILY     R L+T    +P+T    + +G   + G + G I  YD+RKL    K V  HK + +   LQ    F+  SH+ G S
Sbjct:   47 NNFLVTTSAVGDKIVVSNCKGKPVPLFELAEGTKQTCIS--LSSNSMYI------ASGGIDSTVNIWDLKYRKLHRSLKDHKEEITC----VSFNWNDCYV--ASGSMSGEIILHSIATNLSSTPFGHGTTQPIRHLKYSPF--KKALLGSVSDSGTVTLWDVNSQTPFHNFENAHKAPAYEICFSPISELLLVTVGLDKRIILYDTASKRQLRTLAAETPLTAVEFMPEGTSLTIGSSRGKIYHYDLRKLTAPVKSVSAHKTSVKCITLQNYNSFSKSSHKTGSS 316          
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: G1KNP6 (WD_REPEATS_REGION domain-containing protein OS=Anolis carolinensis OX=28377 GN=nedd1 PE=4 SV=2)

HSP 1 Score: 70.4774 bits (171), Expect = 5.832e-9
Identity = 75/273 (27.47%), Postives = 128/273 (46.89%), Query Frame = 2
Query:  164 CEDDILVASDYNGDNIAVLEKLNNKMNIYT-AEGTLKSSLNGNFNFNCMVLYGSDCLLTGENHGKIRVYDLK-NNLTRKLFDTNYPITVDLIDVSIDNKNIFVCYADGKLSKLEIKTARVDNLT------WISEKIKCLKISPWVANNLLVGSVN--GSVSLYDANNHSRVFT-SNTHKGMVNCVSYSYFNDKIAISVGEDKQAILYGINESRPLKTYKTISPVTHCS-ISDGVLFSFGEANGDISIYDIRKLN---KFVYFHKLNDRISYLQ 937
            C ++ LV +   GD I +       + ++  AEG  ++ ++ + N   +   G+D          + ++DLK   L R L D    +T     VS +  + +V  A G LS   I  +   NL+        ++ ++ LK SP+     L+GSV+  G+V+L+D N+ +      NTHK     + +S  ++ + ++VG DK+  LY  +  R LKT    +P+T    + +G   + G + G I  YD+RKL    K V  HK + +   LQ
Sbjct:   45 CNNNFLVTASGTGDKIVISNYKGKPIPLFELAEGAKQTCISLSSNSMYIASGGTD--------STVNIWDLKCRKLHRSLKDHKDEVTC----VSFNWNDCYV--ASGSLSGEIILHSLATNLSSTPFGHGTTQPVRHLKYSPF--KKALLGSVSDSGNVTLWDVNSQTPYHNFENTHKAPAQEICFSPISELLLVTVGLDKRINLYDTSSKRQLKTLVAEAPLTAVEFMPEGTSLAIGSSRGKIYHYDLRKLTAPVKSVSAHKTSVKCIALQ 301          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Cavefish
Match: nedd1 (NEDD1 gamma-tubulin ring complex targeting factor [Source:ZFIN;Acc:ZDB-GENE-040426-2906])

HSP 1 Score: 55.8398 bits (133), Expect = 8.194e-8
Identity = 37/105 (35.24%), Postives = 55/105 (52.38%), Query Frame = 2
Query:  587 LVGSVN--GSVSLYDANNHSRVFT-SNTHKGMVNCVSYSYFNDKIAISVGEDKQAILYGINESRPLKTYKTISPVTHCSIS-DGVLFSFGEANGDISIYDIRKLN 889
            L+GSV+  GSV L+DAN    V T    HK   + +S+S  ND + I+VG DK+ + Y        ++ +  SP+T    + DG     G   G I +YD+R L+
Sbjct:  162 LLGSVSDSGSVVLWDANTQKEVHTFEGAHKAPASGLSFSPANDLLFITVGLDKKIVCYDTASKIIFRSKQVESPLTAVDFTPDGAGLVVGSTQGRIYMYDLRNLS 266          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Cavefish
Match: wdr91 (WD repeat domain 91 [Source:NCBI gene;Acc:103023610])

HSP 1 Score: 51.2174 bits (121), Expect = 2.406e-6
Identity = 47/171 (27.49%), Postives = 72/171 (42.11%), Query Frame = 2
Query:  329 LLTGENHGKIRVYD--LKNNLTRKLFDTNYPITVDLIDVSIDNKNIFVCYADGKLSKLEIKTARVDN---------LTWISEKIK-----CLKISPWVAN--------NLLV-GSVNGSVSLYDANNHSRVFTSNTHKGMVNCVSYSYFNDKIAISVGEDKQAILYGINES 766
            LL G   G +R+YD   K NL     D  +P  + L      +   FVC A   +S+    T  +           L W ++ +K      L+  P   N        NLLV G+ +G + L+D   +  V +   H G V  V +SY ++    S+GED + I + I+ S
Sbjct:  450 LLLGSGVGTVRLYDTEAKKNLYEMTIDDAHPRILSL--AYSPSGTSFVCSAAANVSRPGSVTEMMPRASLPVSGQLLLWDTKTVKQQLQFALEPGPVAVNCTAFNHNGNLLVTGAADGWIRLFDMQRYESVMSWKAHDGEVYSVEFSY-DENTVFSIGEDGKFIQWNIHRS 617          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Cavefish
Match: wdr91 (WD repeat domain 91 [Source:NCBI gene;Acc:103023610])

HSP 1 Score: 51.2174 bits (121), Expect = 2.406e-6
Identity = 47/171 (27.49%), Postives = 72/171 (42.11%), Query Frame = 2
Query:  329 LLTGENHGKIRVYD--LKNNLTRKLFDTNYPITVDLIDVSIDNKNIFVCYADGKLSKLEIKTARVDN---------LTWISEKIK-----CLKISPWVAN--------NLLV-GSVNGSVSLYDANNHSRVFTSNTHKGMVNCVSYSYFNDKIAISVGEDKQAILYGINES 766
            LL G   G +R+YD   K NL     D  +P  + L      +   FVC A   +S+    T  +           L W ++ +K      L+  P   N        NLLV G+ +G + L+D   +  V +   H G V  V +SY ++    S+GED + I + I+ S
Sbjct:  450 LLLGSGVGTVRLYDTEAKKNLYEMTIDDAHPRILSL--AYSPSGTSFVCSAAANVSRPGSVTEMMPRASLPVSGQLLLWDTKTVKQQLQFALEPGPVAVNCTAFNHNGNLLVTGAADGWIRLFDMQRYESVMSWKAHDGEVYSVEFSY-DENTVFSIGEDGKFIQWNIHRS 617          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Cavefish
Match: wdr91 (WD repeat domain 91 [Source:NCBI gene;Acc:103023610])

HSP 1 Score: 50.8322 bits (120), Expect = 2.898e-6
Identity = 47/171 (27.49%), Postives = 72/171 (42.11%), Query Frame = 2
Query:  329 LLTGENHGKIRVYD--LKNNLTRKLFDTNYPITVDLIDVSIDNKNIFVCYADGKLSKLEIKTARVDN---------LTWISEKIK-----CLKISPWVAN--------NLLV-GSVNGSVSLYDANNHSRVFTSNTHKGMVNCVSYSYFNDKIAISVGEDKQAILYGINES 766
            LL G   G +R+YD   K NL     D  +P  + L      +   FVC A   +S+    T  +           L W ++ +K      L+  P   N        NLLV G+ +G + L+D   +  V +   H G V  V +SY ++    S+GED + I + I+ S
Sbjct:  408 LLLGSGVGTVRLYDTEAKKNLYEMTIDDAHPRILSL--AYSPSGTSFVCSAAANVSRPGSVTEMMPRASLPVSGQLLLWDTKTVKQQLQFALEPGPVAVNCTAFNHNGNLLVTGAADGWIRLFDMQRYESVMSWKAHDGEVYSVEFSY-DENTVFSIGEDGKFIQWNIHRS 575          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Cavefish
Match: wdr91 (WD repeat domain 91 [Source:NCBI gene;Acc:103023610])

HSP 1 Score: 50.8322 bits (120), Expect = 3.119e-6
Identity = 47/171 (27.49%), Postives = 72/171 (42.11%), Query Frame = 2
Query:  329 LLTGENHGKIRVYD--LKNNLTRKLFDTNYPITVDLIDVSIDNKNIFVCYADGKLSKLEIKTARVDN---------LTWISEKIK-----CLKISPWVAN--------NLLV-GSVNGSVSLYDANNHSRVFTSNTHKGMVNCVSYSYFNDKIAISVGEDKQAILYGINES 766
            LL G   G +R+YD   K NL     D  +P  + L      +   FVC A   +S+    T  +           L W ++ +K      L+  P   N        NLLV G+ +G + L+D   +  V +   H G V  V +SY ++    S+GED + I + I+ S
Sbjct:  450 LLLGSGVGTVRLYDTEAKKNLYEMTIDDAHPRILSL--AYSPSGTSFVCSAAANVSRPGSVTEMMPRASLPVSGQLLLWDTKTVKQQLQFALEPGPVAVNCTAFNHNGNLLVTGAADGWIRLFDMQRYESVMSWKAHDGEVYSVEFSY-DENTVFSIGEDGKFIQWNIHRS 617          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006164.1 (pep scaffold:Pmarinus_7.0:GL480460:21134:25454:1 gene:ENSPMAG00000005568.1 transcript:ENSPMAT00000006164.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 2.612e-9
Identity = 41/129 (31.78%), Postives = 69/129 (53.49%), Query Frame = 2
Query:  587 LVGSV--NGSVSLYDANNHS--RVFTSNTHKGMVNCVSYSYFNDKIAISVGEDKQAILYGINESRPLKTYKTISPVTHCS-ISDGVLFSFGEANGDISIYDIRKLN---KFVYFHKLNDRISYLQFTYK 949
            L GSV  +GSV L+DAN       FT+  H+   + +++S  ND + ++ G DK+ ILY +     L++    SP+T    + DG   + G + G + +YD+R ++   + V  HK + R   L+F +K
Sbjct:  179 LFGSVSDDGSVVLWDANARRPHHAFTA-AHRAPASALAFSPVNDLLFVTAGLDKRIILYDMVSKSILRSVTAESPLTAVEFMPDGSTLALGTSRGKLILYDLRMMSAPLRSVSAHKTSVRC--LRFHHK 304          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO45998 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRE1])

HSP 1 Score: 51.2174 bits (121), Expect = 9.627e-7
Identity = 44/200 (22.00%), Postives = 93/200 (46.50%), Query Frame = 2
Query:  170 DDILVASDYNGDNIAVLEKLNNKMNIYTAEGTLKSSLNGNFNFNCMVLYGSDCLL-TGENHGKIRVYDLKNNLTRKLFDTNYPI---TVDLIDVSIDNKNIFVCYADGKLSKLEIKTARVDNLTWISEKIKCLKISPWVANNLLVGSVNGSVSLYDANNHSRVFTSNTHKGMVNCVSYSYFNDKIAISVGEDKQAILYGI 757
            D ILV + ++   + V + +        A  ++ + L+ +   N + L  ++ L+ TG   G + ++    N+ ++   +N+ +   TV  +  S D + IF C AD  +  +++ T        + E+I+C   + W    +L G  +G + ++D  +  ++     H+G + C+  S  +    ++ GED Q IL+ I
Sbjct:  680 DGILVTASWDS-TVKVWKFMPAPEGRKPAPPSILAELDHDTEVNSVDLDPTNTLVVTGTMDGNVLLW----NIDQQAIISNHSVHRETVHCVLFSPDGQRIFSCGADHFMRVIDVHTGTEVFCKDVGEEIRC---AVWDGQMVLAGGESGDLQVWDLFHVQQITKIKAHQGAIRCIDVSG-DGCTVVTGGEDGQVILWKI 870          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Medaka
Match: nedd1 (NEDD1 gamma-tubulin ring complex targeting factor [Source:NCBI gene;Acc:101172408])

HSP 1 Score: 51.9878 bits (123), Expect = 1.333e-6
Identity = 64/247 (25.91%), Postives = 108/247 (43.72%), Query Frame = 2
Query:  179 LVASDYNGDNIAVLE-KLNNKMNIYTAEGTLKSSLNGNFNFNCMVLYGSD-CLLTGENHGKIRVYDLKNN-LTRKLFDTNYPITVDLIDVSIDNKNIFVCYADGKLSKLEIKTARVDNLTWIS------EKIKCLKISPWVANNLLVGSVN--GSVSLYDANNHSRVFT-SNTHKGMVNCVSYSYFNDKIAISVGEDKQAILYGINESRPLKTYKTISPVTHCSIS-DGVLFSFGEANGDISIYDIR 880
            LV++  +GD + V   KL     +  AEG  ++ +  + +F  +V  G D C         + ++DLK + L R L D    +T   +  +  +  I      G L    + T    NL+  +        I  L++S       L+G+V+  GSV L+D+N    +      HK   + V++S  +D + +SVG DK+ + Y       L++ +  SP+T    + DG     G   G I  YD+R
Sbjct:   49 LVSASSSGDKLVVSSLKLAPVPVVELAEGKKQTRVCLSSSFQFLVSGGLDHC---------VHIWDLKTSRLHRSLKDHKEEVTC--VSFNASDSRIISGSTSGDLVLHSLTT----NLSSQAFGHGSDHPIHDLRLS--TVKRSLLGTVSDSGSVVLWDSNTQKELHVFEGAHKAPASGVAFSPTSDLLVVSVGLDKKIVCYDTASRIVLRSIRVESPLTSVEFTPDGTGLVVGSTQGKIYQYDLR 278          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000022611.2 (protein NEDD1 [Source:NCBI gene;Acc:101174063])

HSP 1 Score: 51.6026 bits (122), Expect = 1.846e-6
Identity = 63/247 (25.51%), Postives = 108/247 (43.72%), Query Frame = 2
Query:  179 LVASDYNGDNIAVLEKLNNKMNIYT-AEGTLKSSLNGNFNFNCMVLYGSD-CLLTGENHGKIRVYDLKNN-LTRKLFDTNYPITVDLIDVSIDNKNIFVCYADGKLSKLEIKTARVDNLTWIS------EKIKCLKISPWVANNLLVGSVN--GSVSLYDANNHSRVFT-SNTHKGMVNCVSYSYFNDKIAISVGEDKQAILYGINESRPLKTYKTISPVTHCSIS-DGVLFSFGEANGDISIYDIR 880
            LV++  +GD + V       + +   AEG  ++ +  + +F  +V  G D C         + ++DLK + L R L D    +T    + S  +  I      G+L    + T    NL+  +        I  L++S       L+G+V+  G+V L+D+N    +      HK   + V++S  ND + +SVG DK+ + Y       L++ +  SP+T    + DG     G   G I  YD+R
Sbjct:  123 LVSASSSGDKLVVSSLKQAPVPVVELAEGKKQTRVALSSSFQFLVSGGLDHC---------VHIWDLKTSRLHRSLKDHKEEVTCVTFNAS--DSRIISGSTSGELVIHSLTT----NLSSQAFGHGSEHPIHDLRLS--TVKRSLLGTVSDSGAVVLWDSNTQKELHAFYGAHKAPASGVAFSPTNDLLVVSVGLDKKIVCYDTASRIVLRSIRVESPLTSVEFTPDGTGLVVGSTQGKIYQYDLR 352          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000025739.2 (autophagy related 16 like 2 [Source:NCBI gene;Acc:101163065])

HSP 1 Score: 50.8322 bits (120), Expect = 2.617e-6
Identity = 39/151 (25.83%), Postives = 77/151 (50.99%), Query Frame = 2
Query:  326 CLLTGENHGKIRVYDLKNNLTRKLFDTNYPITVDLIDVSIDNKNIFVCYADGKLSKLEIKTARVDNLTWISEKIKC------LKISPWVANNLLVGSVNGSVSLY---DANNHSRVFTSNTHKGMVNCVSYSYFNDKIAISVGEDKQAILY 751
            C+++G    KIRV+D +     +   +   +T   +D+S D++ +  C  D  L  ++++    D + + +E  KC        ISP  ++ +  GS +GSV ++    AN  +R+     H+  VN VS+S   + + +SV + ++A+L+
Sbjct:  469 CIISGHFDSKIRVWDGRLGGCVQELPSQGRVTS--LDLSYDHRQVLSCCRDDSLQLVDLRRWSRDRVVFRAEGFKCGSDSTKAVISP-DSSYVAAGSADGSVYVWRVSTANLETRLL--EEHRSPVNAVSWSLSGEYV-VSVDKSRRAVLW 613          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000039027.1 (SMESG000039027.1)

HSP 1 Score: 855.899 bits (2210), Expect = 0.000e+0
Identity = 424/431 (98.38%), Postives = 426/431 (98.84%), Query Frame = 2
Query:  239 MNIYTAEGTLKSSLNGNFNFNCMVLYGSDCLLTGENHGKIRVYDLKNNLTRKLFDTNYPITVDLIDVSIDNKNIFVCYADGKLSKLEIKTARVDNLTWISEKIKCLKISPWVANNLLVGSVNGSVSLYDANNHSRVFTSNTHKGMVNCVSYSYFNDKIAISVGEDKQAILYGINESRPLKTYKTISPVTHCSISDGVLFSFGEANGDISIYDIRKLNKFVYFHKLNDRISYLQFTYKSHQNGDSIEYLSTIEQSGGYANKLSYDCSLESCFSEGEYSVHYNNNHQISCDGFNISHMNQRKSSLSPVSNEFKLSNENKLRKQVQFETPVXXXXXPSVPIDSVAKPESIIESNIQSGGFDKEFLRQTIHEELNKQLMALEDRLSSDILMKTIDQLFITENNIIQSILPVVTETRELLKENKSLCEKLNRHNFF 1531
            MNIYTAEGTLKSSLNGNFNFNCMVLYGSDCLLTGENHGKIRVYDLKNNLTRKLFDTNYPITVDLIDVSIDNKNIFVCYADGK+SKLEIKTARVDNLTWISEKIKCLKISPWVANNLLVGSVNGSVSLYDANNHSRVFTSNTHKGMVNCVSYSYFNDKIAIS GEDKQAILYGINESRPLKTYKTISPVTHCSISDGVLFSFGEANGDISIYDIRKLNKFVYFHKLNDRISYLQFTYKSHQNGDSIEYLSTIEQSGGYANKLSYDCSLESCFSEGEYSVHYNNNHQISCDGFNISH+NQRKSSLSPVSNEFKLSNENKLRKQVQFETPV  NNNPSVPID VAKPESIIESNIQSGGFDKEFLRQTIHEELNKQLM LEDRLSSDILMKTIDQLFITENNIIQSILPVVTETRELLKENKSLCEKLNRHNFF
Sbjct:    1 MNIYTAEGTLKSSLNGNFNFNCMVLYGSDCLLTGENHGKIRVYDLKNNLTRKLFDTNYPITVDLIDVSIDNKNIFVCYADGKVSKLEIKTARVDNLTWISEKIKCLKISPWVANNLLVGSVNGSVSLYDANNHSRVFTSNTHKGMVNCVSYSYFNDKIAISGGEDKQAILYGINESRPLKTYKTISPVTHCSISDGVLFSFGEANGDISIYDIRKLNKFVYFHKLNDRISYLQFTYKSHQNGDSIEYLSTIEQSGGYANKLSYDCSLESCFSEGEYSVHYNNNHQISCDGFNISHINQRKSSLSPVSNEFKLSNENKLRKQVQFETPV--NNNPSVPIDPVAKPESIIESNIQSGGFDKEFLRQTIHEELNKQLMELEDRLSSDILMKTIDQLFITENNIIQSILPVVTETRELLKENKSLCEKLNRHNFF 429          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000038919.1 (SMESG000038919.1)

HSP 1 Score: 359.762 bits (922), Expect = 2.518e-117
Identity = 208/498 (41.77%), Postives = 298/498 (59.84%), Query Frame = 2
Query:   71 GVLLCASWNKNPQLSIFNFKQYSKPKIREINCEDDILVASDYNGDNIAVLEKLNNKMNIYTAEGTLKSSLNGNFNFNCMVLYGSDCLLTGENHGKIRVYDLKNNLTRKLFDTNYPITVDLIDVSIDNKNIFVCYADGKLSKLEIKTARVDNLTWISEKIKCLKISPWVANNLLVGSVNGSVSLYDANNHSRVFTSNTHKGMVNCVSYSYFNDKIAISVGEDKQAILYGINESRPLKTYKTISPVTHCSISDGVLFSFGEANGDISIYDIRKLNKFVYFHKLNDRISYLQFTY----KSHQNGDSIEYLST--IEQSGGYANKLSYDCSLESCFSEGEYSVHYNNNHQISCDGFNI-SHMNQRKSSLSPVSNEFKLSNENKLRKQVQFE----TPVXXXXXPSVPIDSVAKPESIIESNIQSGGFDKEFLRQTIHEELNKQLMALEDRLSSDILMKTIDQLFITENNIIQSILPVVTETRELLKENKSLCEKLNRHNFF 1531
            GVL+ AS N   +L +F FK+  +PK+R +  ++DILV+SDY G NI V E+    +  Y  E TLKSS+ G  + NC+ LY    +  G N G I V+DL+     K F+TN   ++  I+++IDN+NIF  Y+DG +SKLEIK   V++LTWIS ++ C+K  PW  N LL+G ++GSV+LYD N+  ++F S  H   VNCVSYSY N+ +A+S G DKQ +LY INE  P+KT KT SPVT CS+S+GV FSFGE NG I++YDIR L K ++ HK + +I+YLQF++    K+ ++ DS +  ST     S     K +Y+CS+ SCFSE E    Y      S +  +I S+ N  K    P+S +    NEN + + VQ +      VN+  N SV           +ES+ Q    D E++     E L+++L+   DRL + I+M  ID+L I E NI  ++ P++ E REL++EN++L  KL     F
Sbjct:  136 GVLISASSNIKSELDVFFFKESGRPKLRTVYFQNDILVSSDYLGQNIGVFERSGRTIKTYNRETTLKSSVLGKLDMNCLALYKDVHIFAGGNKGNIHVFDLRKEKYLKSFNTNSEKSIVNIELTIDNRNIFSVYSDGTVSKLEIKNKNVNHLTWISGQVSCIKSCPWAVNKLLLGFLDGSVNLYDVNSERKLFASVAHTNKVNCVSYSYHNELLAMSGGNDKQIVLYNINEKTPMKTLKTSSPVTSCSMSEGVFFSFGEENGTITVYDIRNLKKAIFSHKSDSKINYLQFSFDSFLKNTKDTDSFQAFSTSSCSVSKALVRKSNYNCSVASCFSEYEGCSVYGKFDNTSNESLDISSYGNHGK----PISEQSNSRNENSILEGVQLKFQDLASVNSQRNSSVV---------TVESDNQQSELDMEYISHIYKEVLDEELLKASDRLENKIIMDFIDRLGIMEQNIDTTMQPILAEYRELMQENQTLINKLKNSGRF 620          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000059975.1 (SMESG000059975.1)

HSP 1 Score: 253.447 bits (646), Expect = 2.207e-78
Identity = 163/465 (35.05%), Postives = 257/465 (55.27%), Query Frame = 2
Query:  140 KPKIREINCEDDILVASDYNGDNIAVLEKLNNKMNIYTAEGTLKSSLNGNFNFNCMVLYGSDCLLTGENHGKIRVYDLKNNLTRKLFDTNYPITVDLIDVSIDNKNIFVCYADGKLSKLEIKTARVDNLTWISEKIKCLKISPWVANNLLVGSVNGSVSLYDANNHSRVFTSNTHKGMVNCVSYSYFNDKIAISVGEDKQAILYGINESRPLKTYKTISPVTHCSISDGVLFSFGEANGDISIYDIRKLNKFVYFHKLNDRISYLQFTYKSHQNGDSIEYLSTIEQSGGYANKLSYDCSLESCFSEGEYSVHYNNNHQISCDGFNISHMNQRKSSLSPVSNEFKLSNENKLRKQVQFETPVXXXXX----PSVPIDSVAKPESIIE-SNIQSGGFDKEFLRQTIHEELNKQLMALEDRLSSDILMKTIDQLFITENNIIQSILPVVTETRELLKENKSLCEKLNR 1519
            KPK+  I+ + +I+ A DY GD IA+ E  N +  +YT + T KSS +G F+ NC+ LY    +  G++ GK+ ++D+  N   K F T    ++  I +S D  +IF CY +G++S + +K  +    +WI E I C  I+PW   +LL+GSV+G + LYD      +  S+ H   VN VSYSY+N+ + +S  ++ Q +L+  NE + ++ +KT SP+T CS+SDGVL+ FGEANG++SI+DIR   + VY  K  + I Y+QF +KS QN  + ++   +  S    NK + D SL SCFS G +S   +    +S D F++S  N          N+F  S ++   K   F TP+ +        +    S  KP+  I+ SN+         LR  I  ++   L ++EDR+ ++I+ + IDQ  I+EN II  ++       EL + N++L EK N+
Sbjct:    5 KPKLNSIDFDVEIITAVDYQGDTIAIYEMKNRQFKLYTIDLTFKSSFDGKFDLNCLKLYQDRWICAGDSWGKLHLFDIHKNSYVKSFSTYSNESIIEIVISSDQNHIFACYENGQISVVNLKLDKSRMFSWIDEYITCCTINPWENGHLLMGSVDGIIGLYDTEIEKIINKSHCHSKRVNTVSYSYYNESLMLSGSDNNQVVLWNCNE-KSIRVHKTNSPITSCSMSDGVLYGFGEANGNVSIFDIRNSREPVYTQKNYNSIDYVQFCFKSFQNK-TDDFFDCLNSSENLINKENLDDSLASCFSVGAHS-KSSQKSNLSLD-FSVSSNNSF--------NDFNSSGKDSAIK--SFNTPIASKKIFGDFDTPKNQSSHKPKQPIKPSNLP--------LRDVIQNKIEISLRSMEDRIHTNIMSQIIDQFAISENIIINKLMQFRETNEELRRINENLKEKCNQ 447          
The following BLAST results are available for this feature:
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NEDD11.692e-825.41NEDD1 gamma-tubulin ring complex targeting factor ... [more]
NEDD11.692e-825.41NEDD1 gamma-tubulin ring complex targeting factor ... [more]
NEDD11.716e-825.41NEDD1 gamma-tubulin ring complex targeting factor ... [more]
NEDD11.233e-730.16NEDD1 gamma-tubulin ring complex targeting factor ... [more]
NEDD11.233e-730.16NEDD1 gamma-tubulin ring complex targeting factor ... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nedd12.835e-630.56NEDD1 gamma-tubulin ring complex targeting factor ... [more]
nedd12.938e-630.56NEDD1 gamma-tubulin ring complex targeting factor ... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nedd12.706e-1129.78NEDD1 gamma-tubulin ring complex targeting factor ... [more]
nedd13.510e-1129.78NEDD1 gamma-tubulin ring complex targeting factor ... [more]
nedd14.066e-1129.78NEDD1 gamma-tubulin ring complex targeting factor ... [more]
nedd14.642e-1129.78NEDD1 gamma-tubulin ring complex targeting factor ... [more]
nedd14.957e-1129.78NEDD1 gamma-tubulin ring complex targeting factor ... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Nedd12.801e-931.75neural precursor cell expressed, developmentally d... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|P33215|NEDD1_MOUSE1.959e-831.75Protein NEDD1 OS=Mus musculus OX=10090 GN=Nedd1 PE... [more]
sp|Q3B7M6|NEDD1_BOVIN3.073e-825.74Protein NEDD1 OS=Bos taurus OX=9913 GN=NEDD1 PE=2 ... [more]
sp|Q8NHV4|NEDD1_HUMAN8.124e-825.41Protein NEDD1 OS=Homo sapiens OX=9606 GN=NEDD1 PE=... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T2M8K81.076e-1127.00Protein NEDD1 OS=Hydra vulgaris OX=6087 GN=NEDD1 P... [more]
V8NU282.443e-1028.82Protein NEDD1 (Fragment) OS=Ophiophagus hannah OX=... [more]
I7M3Y61.996e-926.76Cytochrome d1 heme domain protein OS=Tetrahymena t... [more]
A0A2D4H1482.198e-928.32WD_REPEATS_REGION domain-containing protein (Fragm... [more]
G1KNP65.832e-927.47WD_REPEATS_REGION domain-containing protein OS=Ano... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nedd18.194e-835.24NEDD1 gamma-tubulin ring complex targeting factor ... [more]
wdr912.406e-627.49WD repeat domain 91 [Source:NCBI gene;Acc:10302361... [more]
wdr912.406e-627.49WD repeat domain 91 [Source:NCBI gene;Acc:10302361... [more]
wdr912.898e-627.49WD repeat domain 91 [Source:NCBI gene;Acc:10302361... [more]
wdr913.119e-627.49WD repeat domain 91 [Source:NCBI gene;Acc:10302361... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000006164.12.612e-931.78pep scaffold:Pmarinus_7.0:GL480460:21134:25454:1 g... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO459989.627e-722.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nedd11.333e-625.91NEDD1 gamma-tubulin ring complex targeting factor ... [more]
ENSORLT00000022611.21.846e-625.51protein NEDD1 [Source:NCBI gene;Acc:101174063][more]
ENSORLT00000025739.22.617e-625.83autophagy related 16 like 2 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000039027.10.000e+098.38SMESG000039027.1[more]
SMESG000038919.12.518e-11741.77SMESG000038919.1[more]
SMESG000059975.12.207e-7835.05SMESG000059975.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035927 ID=SMED30035927|Name=WD_REPEATS_REGION domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1575bp
TTATTTTAATTGTTATTATTTTTTTACACAGTTACAATTGTATTTTTAAA
TGTCTGTTCATGATGAACCAGGTGTTCTCTTATGTGCATCGTGGAATAAA
AATCCCCAGTTAAGTATATTTAATTTCAAACAATATTCGAAGCCTAAAAT
ACGAGAAATTAATTGCGAGGATGATATATTAGTTGCATCGGATTATAATG
GAGATAATATTGCAGTTTTGGAAAAATTGAATAATAAAATGAACATTTAC
ACAGCAGAAGGGACATTAAAATCATCGTTGAATGGAAATTTCAATTTCAA
TTGCATGGTTTTATATGGAAGTGATTGTTTGTTGACTGGAGAAAATCATG
GAAAAATTCGTGTTTATGATTTAAAAAACAATTTAACTAGAAAATTATTT
GATACGAATTATCCAATTACAGTTGATCTCATCGATGTTTCAATAGATAA
TAAAAATATATTTGTTTGTTATGCTGATGGAAAATTATCTAAACTAGAAA
TTAAAACCGCTAGAGTTGATAATTTAACCTGGATTTCAGAGAAAATCAAA
TGCTTGAAAATCTCTCCTTGGGTAGCAAATAATTTACTTGTAGGATCTGT
TAATGGAAGTGTGTCGTTGTATGATGCTAATAATCATAGTAGAGTTTTTA
CATCTAATACTCACAAAGGAATGGTGAACTGCGTTTCATATTCTTATTTC
AATGATAAAATAGCCATATCTGTTGGAGAAGACAAACAAGCAATTTTATA
TGGAATAAACGAAAGTAGACCACTAAAAACCTATAAAACAATATCACCGG
TTACACATTGCTCAATTAGTGATGGAGTTCTATTTTCTTTCGGAGAAGCT
AATGGTGATATTTCAATATACGATATCAGAAAACTGAATAAATTTGTATA
TTTCCACAAATTGAATGATAGAATAAGTTACCTCCAATTCACTTACAAAT
CTCATCAAAATGGCGATAGCATAGAATATTTAAGTACAATCGAACAAAGT
GGTGGATATGCCAATAAGTTGTCTTATGATTGCTCCCTCGAGTCGTGTTT
CTCGGAAGGCGAATATTCAGTCCATTACAATAACAATCATCAAATCTCTT
GTGACGGTTTCAATATCAGTCATATGAATCAACGTAAATCCTCTTTGTCG
CCTGTTTCGAATGAATTTAAATTGTCCAATGAAAATAAGCTACGAAAACA
AGTTCAGTTTGAGACTCCAGTCAATAATAATAATAATCCATCAGTACCTA
TCGATTCAGTAGCCAAACCCGAATCGATAATAGAGTCCAATATCCAATCA
GGGGGATTCGATAAGGAATTCCTGAGGCAAACTATTCACGAGGAACTAAA
CAAGCAATTAATGGCATTGGAGGATCGATTGAGCAGTGATATTCTGATGA
AAACTATTGATCAATTATTTATCACGGAAAATAATATTATCCAATCGATC
TTGCCAGTCGTTACAGAAACTCGAGAATTGTTGAAAGAAAATAAATCGTT
ATGTGAAAAATTAAATAGACACAATTTTTTTTGATTAGTTTTTGAATAAA
TTGTGTTGTCTGTTATTGATTAGAT
back to top

protein sequence of SMED30035927-orf-1

>SMED30035927-orf-1 ID=SMED30035927-orf-1|Name=SMED30035927-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=495bp
MSVHDEPGVLLCASWNKNPQLSIFNFKQYSKPKIREINCEDDILVASDYN
GDNIAVLEKLNNKMNIYTAEGTLKSSLNGNFNFNCMVLYGSDCLLTGENH
GKIRVYDLKNNLTRKLFDTNYPITVDLIDVSIDNKNIFVCYADGKLSKLE
IKTARVDNLTWISEKIKCLKISPWVANNLLVGSVNGSVSLYDANNHSRVF
TSNTHKGMVNCVSYSYFNDKIAISVGEDKQAILYGINESRPLKTYKTISP
VTHCSISDGVLFSFGEANGDISIYDIRKLNKFVYFHKLNDRISYLQFTYK
SHQNGDSIEYLSTIEQSGGYANKLSYDCSLESCFSEGEYSVHYNNNHQIS
CDGFNISHMNQRKSSLSPVSNEFKLSNENKLRKQVQFETPVNNNNNPSVP
IDSVAKPESIIESNIQSGGFDKEFLRQTIHEELNKQLMALEDRLSSDILM
KTIDQLFITENNIIQSILPVVTETRELLKENKSLCEKLNRHNFF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0000086G2/M transition of mitotic cell cycle
GO:0007049cell cycle
GO:0007067mitotic nuclear division
GO:0051301cell division
GO:0071539protein localization to centrosome
GO:0097711ciliary basal body docking
Vocabulary: cellular component
TermDefinition
GO:0000242pericentriolar material
GO:0000922spindle pole
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005814centriole
GO:0005815microtubule organizing center
GO:0005829cytosol
GO:0005856cytoskeleton
GO:0036064ciliary basal body
GO:0045177apical part of cell
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 152..192
e-value: 5.9
score: 12.1
coord: 70..107
e-value: 96.0
score: 4.5
coord: 195..235
e-value: 0.33
score: 20.0
coord: 238..275
e-value: 60.0
score: 5.8
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 10..331
e-value: 7.8E-24
score: 86.4
NoneNo IPR availablePANTHERPTHR44414FAMILY NOT NAMEDcoord: 90..348
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 159..244
score: 9.784
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 71..297