Protein unc-13 homolog B

Overview
NameProtein unc-13 homolog B
Smed IDSMED30035906
Length (bp)7097
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein unc-13 homolog B (SMED30035906) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein unc-13 homolog B (SMED30035906) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein unc-13 homolog B (SMED30035906) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein unc-13 homolog B (SMED30035906) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035906

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30035906SMESG000061526.1 Contig3663newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035906SMESG000061526.1 Contig3663uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035906SMESG000068909.1 Contig3663newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035906SMESG000068909.1 Contig3663uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
headSMED30035906SMESG000061526.1 SmedASXL_017385SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30035906SMESG000061526.1 dd_Smed_v4_11394_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30035906SMESG000061526.1 dd_Smed_v6_11394_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein unc-13 homolog B vs. Ensembl Human
Match: UNC13B (unc-13 homolog B [Source:HGNC Symbol;Acc:HGNC:12566])

HSP 1 Score: 1519.98 bits (3934), Expect = 0.000e+0
Identity = 706/1213 (58.20%), Postives = 937/1213 (77.25%), Query Frame = 2
Query: 2888 GGFYKSIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRDQEPGDKIQNSDETGP--KNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNP--KLNLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKDISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIRQS 6514
            GG Y  IDS PD++ RKK + LVSDL L  + ++K  + +A   + TR SL DEELK HVYKKTLQA+IYPIS  TPH+F+V  AT PT+CYECEGLLWG+ARQG+RC ECGVKCHEKC++LLNADCLQRAAEKS KHGAE +TQ II +M D M+ R +N PEIF++I+DVF+VN+ AH   +K+++QS+LDGTSKWSAKI ITV CAQGL  KDKTG+SDPYVTVQV K KKRTKT+   LNP W+EKF+FECHNSS+RIKVRVWDED+D+KS+++Q+L RESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYH+QYTCLHEN+FH+L +   S G    +       ++ W++YFD  +++I++EFAMRYGIESIYQAMTHF+CL++K+MCPGVPAV+STLLANINAYYAHTT++TN SAS+RFAA+NFGKE+F+KLLDQLHNS++I+L  YRN F A  PERL DLKSTVDLLTSITFFRMKVQEL SPPRA QVV++CV+AC+ +TY+++F + ++LYSR  +   ++   +E GP  +NL+FW KLI L+VS+IE+DK  Y P LNQFPQE+N+ ++S   MW   ++ ++ AL  E+ +    K++DY+NL F++KW +N YV DLP  Q  +P YP WFE +V+QWL EN++VS  +L+ A ERDKKDGFQ++SEHAL+S SVVD+FTQLNQ F++I+KLECP+P+I +H+M+RF+ T+ KVL+ YA ++ KD+  Y  K+++ CILMNN+QQ+RV LEK+FEAMGG+ L+ +  D + +LQ +L+ V+D L+  F + F+  I+  ++++  +L  Q++ T   +P  + +  Q++  VLRPLMD+ + NL+L A+VCE+ VLKR+LKELWR+ +  +ER I+LPP            ++ Q   +++  +   LSH+      SK+   + ++   +L+P QC V+D+ LD IK YFHAGGNGLK ++LE+S +LQSLR+AL LY+QTTD LIK F+ SQ +Q +  ++D VGEVS++V+LF HP TGEHK+T  ++A   L WQT  +FRPFVE+ ++GP+  +KKRK+ TKSKSN W+P+YNE+F FL+ + E PE+YE+QICVKDYCF R D+++G  V+ L  +  +GS   W  LGRK+H D  G TILRILSQR+ D++A+EFV+LKS+ R +
Sbjct: 3157 GGLY-GIDSMPDLR-RKKPLPLVSDLSL--VQSRKAGITSA---MATRTSLKDEELKSHVYKKTLQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCSECGVKCHEKCQDLLNADCLQRAAEKSCKHGAEDRTQNIIMAMKDRMKIRERNKPEIFEVIRDVFTVNKAAHVQQMKTVKQSVLDGTSKWSAKITITVVCAQGLQAKDKTGSSDPYVTVQVSKTKKRTKTIFGNLNPVWEEKFHFECHNSSDRIKVRVWDEDDDIKSRVKQRLKRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHVQYTCLHENLFHYLTDIQGSGG----VRIPEARGDDAWKVYFDETAQEIVDEFAMRYGIESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSTYRNNFPAGSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHDLYSRQYQLKQELP-PEEQGPSIRNLDFWPKLITLIVSIIEEDKNSYTPVLNQFPQELNVGKVSAEVMWHLFAQDMKYALE-EHEKDHLCKSADYMNLHFKVKWLHNEYVRDLPVLQGQVPEYPAWFEQFVLQWLDENEDVSLEFLRGALERDKKDGFQQTSEHALFSCSVVDVFTQLNQSFEIIRKLECPDPSILAHYMRRFAKTIGKVLMQYADILSKDFPAYCTKEKLPCILMNNVQQLRVQLEKMFEAMGGKELDLEAADSLKELQVKLNTVLDELSMVFGNSFQVRIDECVRQMADIL-GQVRGTGNASPDARASAAQDADSVLRPLMDFLDGNLTLFATVCEKTVLKRVLKELWRVVMNTMERMIVLPP------------LTDQTGTQLIFTAAKELSHL------SKLKDHMVREETRNLTPKQCAVLDLALDTIKQYFHAGGNGLKKTFLEKSPDLQSLRYALSLYTQTTDTLIKTFVRSQTTQGS-GVDDPVGEVSIQVDLFTHPGTGEHKVTVKVVAANDLKWQTAGMFRPFVEVTMVGPHQSDKKRKFTTKSKSNNWAPKYNETFHFLLGNEEGPESYELQICVKDYCFAREDRVLGLAVMPLRDVTAKGSCACWCPLGRKIHMDETGLTILRILSQRSNDEVAREFVKLKSESRST 4336          
BLAST of Protein unc-13 homolog B vs. Ensembl Human
Match: UNC13B (unc-13 homolog B [Source:HGNC Symbol;Acc:HGNC:12566])

HSP 1 Score: 1509.2 bits (3906), Expect = 0.000e+0
Identity = 709/1214 (58.40%), Postives = 935/1214 (77.02%), Query Frame = 2
Query: 2888 GGFYKSIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRDQEPGDKIQNSDETGP--KNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNP--KLNLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKD-ISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIRQS 6514
            GG Y  IDS PD++ RKK + LVSDL L     Q R     +A + TR SL DEELK HVYKKTLQA+IYPIS  TPH+F+V  AT PT+CYECEGLLWG+ARQG+RC ECGVKCHEKC++LLNADCLQRAAEKS KHGAE +TQ II +M D M+ R +N PEIF++I+DVF+VN+ AH   +K+++QS+LDGTSKWSAKI ITV CAQGL  KDKTG+SDPYVTVQV K KKRTKT+   LNP W+EKF+FECHNSS+RIKVRVWDED+D+KS+++Q+L RESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYH+QYTCLHEN+FH+L +   S G    +       ++ W++YFD  +++I++EFAMRYGIESIYQAMTHF+CL++K+MCPGVPAV+STLLANINAYYAHTT++TN SAS+RFAA+NFGKE+F+KLLDQLHNS++I+L  YRN F A  PERL DLKSTVDLLTSITFFRMKVQEL SPPRA QVV++CV+AC+ +TY+++F + ++LYSR  +   ++   +E GP  +NL+FW KLI L+VS+IE+DK  Y P LNQFPQE+N+ ++S   MW   ++ ++ AL  E+ +    K++DY+NL F++KW +N YV DLP  Q  +P YP WFE +V+QWL EN++VS  +L+ A ERDKKDGFQ++SEHAL+S SVVD+FTQLNQ F++I+KLECP+P+I +H+M+RF+ T+ KVL+ YA ++ KD+  Y  K+++ CILMNN+QQ+RV LEK+FEAMGG+ L+ +  D + +LQ +L+ V+D L+  F + F+  I+  ++++  +L  Q++ T   +P  + +  Q++  VLRPLMD+ + NL+L A+VCE+ VLKR+LKELWR+ +  +ER I+LPP            ++ Q   +++  +   LSH+S        LKD + ++   +L+P QC V+D+ LD IK YFHAGGNGLK ++LE+S +LQSLR+AL LY+QTTD LIK F+ SQ +Q +  ++D VGEVS++V+LF HP TGEHK+T  ++A   L WQT  +FRPFVE+ ++GP+  +KKRK+ TKSKSN W+P+YNE+F FL+ + E PE+YE+QICVKDYCF R D+++G  V+ L  +  +GS   W  LGRK+H D  G TILRILSQR+ D++A+EFV+LKS+ R +
Sbjct:  408 GGLY-GIDSMPDLR-RKKPLPLVSDLSL----VQSRKAGITSA-MATRTSLKDEELKSHVYKKTLQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCSECGVKCHEKCQDLLNADCLQRAAEKSCKHGAEDRTQNIIMAMKDRMKIRERNKPEIFEVIRDVFTVNKAAHVQQMKTVKQSVLDGTSKWSAKITITVVCAQGLQAKDKTGSSDPYVTVQVSKTKKRTKTIFGNLNPVWEEKFHFECHNSSDRIKVRVWDEDDDIKSRVKQRLKRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHVQYTCLHENLFHYLTDIQGSGG----VRIPEARGDDAWKVYFDETAQEIVDEFAMRYGIESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSTYRNNFPAGSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHDLYSRQYQLKQELP-PEEQGPSIRNLDFWPKLITLIVSIIEEDKNSYTPVLNQFPQELNVGKVSAEVMWHLFAQDMKYALE-EHEKDHLCKSADYMNLHFKVKWLHNEYVRDLPVLQGQVPEYPAWFEQFVLQWLDENEDVSLEFLRGALERDKKDGFQQTSEHALFSCSVVDVFTQLNQSFEIIRKLECPDPSILAHYMRRFAKTIGKVLMQYADILSKDFPAYCTKEKLPCILMNNVQQLRVQLEKMFEAMGGKELDLEAADSLKELQVKLNTVLDELSMVFGNSFQVRIDECVRQMADIL-GQVRGTGNASPDARASAAQDADSVLRPLMDFLDGNLTLFATVCEKTVLKRVLKELWRVVMNTMERMIVLPP------------LTDQTGTQLIFTAAKELSHLSK-------LKDHMVREETRNLTPKQCAVLDLALDTIKQYFHAGGNGLKKTFLEKSPDLQSLRYALSLYTQTTDTLIKTFVRSQTTQGS-GVDDPVGEVSIQVDLFTHPGTGEHKVTVKVVAANDLKWQTAGMFRPFVEVTMVGPHQSDKKRKFTTKSKSNNWAPKYNETFHFLLGNEEGPESYELQICVKDYCFAREDRVLGLAVMPLRDVTAKGSCACWCPLGRKIHMDETGLTILRILSQRSNDEVAREFVKLKSESRST 1587          
BLAST of Protein unc-13 homolog B vs. Ensembl Human
Match: UNC13B (unc-13 homolog B [Source:HGNC Symbol;Acc:HGNC:12566])

HSP 1 Score: 1507.66 bits (3902), Expect = 0.000e+0
Identity = 709/1232 (57.55%), Postives = 934/1232 (75.81%), Query Frame = 2
Query: 2888 GGFYKSIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRDQEPGDKIQNSDETGP--KNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNP--KLNLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKD-ISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQ------------------DTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIRQS 6514
            GG Y  IDS PD++ RKK + LVSDL L     Q R     +A + TR SL DEELK HVYKKTLQA+IYPIS  TPH+F+V  AT PT+CYECEGLLWG+ARQG+RC ECGVKCHEKC++LLNADCLQRAAEKS KHGAE +TQ II +M D M+ R +N PEIF++I+DVF+VN+ AH   +K+++QS+LDGTSKWSAKI ITV CAQGL  KDKTG+SDPYVTVQV K KKRTKT+   LNP W+EKF+FECHNSS+RIKVRVWDED+D+KS+++Q+L RESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYH+QYTCLHEN+FH+L +   S G    +       ++ W++YFD  +++I++EFAMRYGIESIYQAMTHF+CL++K+MCPGVPAV+STLLANINAYYAHTT++TN SAS+RFAA+NFGKE+F+KLLDQLHNS++I+L  YRN F A  PERL DLKSTVDLLTSITFFRMKVQEL SPPRA QVV++CV+AC+ +TY+++F + ++LYSR  +   ++   +E GP  +NL+FW KLI L+VS+IE+DK  Y P LNQFPQE+N+ ++S   MW   ++ ++ AL  E+ +    K++DY+NL F++KW +N YV DLP  Q  +P YP WFE +V+QWL EN++VS  +L+ A ERDKKDGFQ++SEHAL+S SVVD+FTQLNQ F++I+KLECP+P+I +H+M+RF+ T+ KVL+ YA ++ KD+  Y  K+++ CILMNN+QQ+RV LEK+FEAMGG+ L+ +  D + +LQ +L+ V+D L+  F + F+  I+  ++++  +L  Q++ T   +P  + +  Q++  VLRPLMD+ + NL+L A+VCE+ VLKR+LKELWR+ +  +ER I+LPP            ++ Q   +++  +   LSH+S        LKD + ++   +L+P QC V+D+ LD IK YFHAGGNGLK ++LE+S +LQSLR+AL LY+QTTD LIK F+ SQ +Q                      ++D VGEVS++V+LF HP TGEHK+T  ++A   L WQT  +FRPFVE+ ++GP+  +KKRK+ TKSKSN W+P+YNE+F FL+ + E PE+YE+QICVKDYCF R D+++G  V+ L  +  +GS   W  LGRK+H D  G TILRILSQR+ D++A+EFV+LKS+ R +
Sbjct:  788 GGLY-GIDSMPDLR-RKKPLPLVSDLSL----VQSRKAGITSA-MATRTSLKDEELKSHVYKKTLQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCSECGVKCHEKCQDLLNADCLQRAAEKSCKHGAEDRTQNIIMAMKDRMKIRERNKPEIFEVIRDVFTVNKAAHVQQMKTVKQSVLDGTSKWSAKITITVVCAQGLQAKDKTGSSDPYVTVQVSKTKKRTKTIFGNLNPVWEEKFHFECHNSSDRIKVRVWDEDDDIKSRVKQRLKRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHVQYTCLHENLFHYLTDIQGSGG----VRIPEARGDDAWKVYFDETAQEIVDEFAMRYGIESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSTYRNNFPAGSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHDLYSRQYQLKQELP-PEEQGPSIRNLDFWPKLITLIVSIIEEDKNSYTPVLNQFPQELNVGKVSAEVMWHLFAQDMKYALE-EHEKDHLCKSADYMNLHFKVKWLHNEYVRDLPVLQGQVPEYPAWFEQFVLQWLDENEDVSLEFLRGALERDKKDGFQQTSEHALFSCSVVDVFTQLNQSFEIIRKLECPDPSILAHYMRRFAKTIGKVLMQYADILSKDFPAYCTKEKLPCILMNNVQQLRVQLEKMFEAMGGKELDLEAADSLKELQVKLNTVLDELSMVFGNSFQVRIDECVRQMADIL-GQVRGTGNASPDARASAAQDADSVLRPLMDFLDGNLTLFATVCEKTVLKRVLKELWRVVMNTMERMIVLPP------------LTDQTGTQLIFTAAKELSHLSK-------LKDHMVREETRNLTPKQCAVLDLALDTIKQYFHAGGNGLKKTFLEKSPDLQSLRYALSLYTQTTDTLIKTFVRSQTTQVHDGKGIRFTANEDIRPEKGSGVDDPVGEVSIQVDLFTHPGTGEHKVTVKVVAANDLKWQTAGMFRPFVEVTMVGPHQSDKKRKFTTKSKSNNWAPKYNETFHFLLGNEEGPESYELQICVKDYCFAREDRVLGLAVMPLRDVTAKGSCACWCPLGRKIHMDETGLTILRILSQRSNDEVAREFVKLKSESRST 1986          
BLAST of Protein unc-13 homolog B vs. Ensembl Human
Match: UNC13B (unc-13 homolog B [Source:HGNC Symbol;Acc:HGNC:12566])

HSP 1 Score: 1502.26 bits (3888), Expect = 0.000e+0
Identity = 709/1232 (57.55%), Postives = 934/1232 (75.81%), Query Frame = 2
Query: 2888 GGFYKSIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRDQEPGDKIQNSDETGP--KNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNP--KLNLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKD-ISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQ------------------DTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIRQS 6514
            GG Y  IDS PD++ RKK + LVSDL L     Q R     +A + TR SL DEELK HVYKKTLQA+IYPIS  TPH+F+V  AT PT+CYECEGLLWG+ARQG+RC ECGVKCHEKC++LLNADCLQRAAEKS KHGAE +TQ II +M D M+ R +N PEIF++I+DVF+VN+ AH   +K+++QS+LDGTSKWSAKI ITV CAQGL  KDKTG+SDPYVTVQV K KKRTKT+   LNP W+EKF+FECHNSS+RIKVRVWDED+D+KS+++Q+L RESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYH+QYTCLHEN+FH+L +   S G    +       ++ W++YFD  +++I++EFAMRYGIESIYQAMTHF+CL++K+MCPGVPAV+STLLANINAYYAHTT++TN SAS+RFAA+NFGKE+F+KLLDQLHNS++I+L  YRN F A  PERL DLKSTVDLLTSITFFRMKVQEL SPPRA QVV++CV+AC+ +TY+++F + ++LYSR  +   ++   +E GP  +NL+FW KLI L+VS+IE+DK  Y P LNQFPQE+N+ ++S   MW   ++ ++ AL  E+ +    K++DY+NL F++KW +N YV DLP  Q  +P YP WFE +V+QWL EN++VS  +L+ A ERDKKDGFQ++SEHAL+S SVVD+FTQLNQ F++I+KLECP+P+I +H+M+RF+ T+ KVL+ YA ++ KD+  Y  K+++ CILMNN+QQ+RV LEK+FEAMGG+ L+ +  D + +LQ +L+ V+D L+  F + F+  I+  ++++  +L  Q++ T   +P  + +  Q++  VLRPLMD+ + NL+L A+VCE+ VLKR+LKELWR+ +  +ER I+LPP            ++ Q   +++  +   LSH+S        LKD + ++   +L+P QC V+D+ LD IK YFHAGGNGLK ++LE+S +LQSLR+AL LY+QTTD LIK F+ SQ +Q                      ++D VGEVS++V+LF HP TGEHK+T  ++A   L WQT  +FRPFVE+ ++GP+  +KKRK+ TKSKSN W+P+YNE+F FL+ + E PE+YE+QICVKDYCF R D+++G  V+ L  +  +GS   W  LGRK+H D  G TILRILSQR+ D++A+EFV+LKS+ R +
Sbjct:  408 GGLY-GIDSMPDLR-RKKPLPLVSDLSL----VQSRKAGITSA-MATRTSLKDEELKSHVYKKTLQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCSECGVKCHEKCQDLLNADCLQRAAEKSCKHGAEDRTQNIIMAMKDRMKIRERNKPEIFEVIRDVFTVNKAAHVQQMKTVKQSVLDGTSKWSAKITITVVCAQGLQAKDKTGSSDPYVTVQVSKTKKRTKTIFGNLNPVWEEKFHFECHNSSDRIKVRVWDEDDDIKSRVKQRLKRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHVQYTCLHENLFHYLTDIQGSGG----VRIPEARGDDAWKVYFDETAQEIVDEFAMRYGIESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSTYRNNFPAGSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHDLYSRQYQLKQELP-PEEQGPSIRNLDFWPKLITLIVSIIEEDKNSYTPVLNQFPQELNVGKVSAEVMWHLFAQDMKYALE-EHEKDHLCKSADYMNLHFKVKWLHNEYVRDLPVLQGQVPEYPAWFEQFVLQWLDENEDVSLEFLRGALERDKKDGFQQTSEHALFSCSVVDVFTQLNQSFEIIRKLECPDPSILAHYMRRFAKTIGKVLMQYADILSKDFPAYCTKEKLPCILMNNVQQLRVQLEKMFEAMGGKELDLEAADSLKELQVKLNTVLDELSMVFGNSFQVRIDECVRQMADIL-GQVRGTGNASPDARASAAQDADSVLRPLMDFLDGNLTLFATVCEKTVLKRVLKELWRVVMNTMERMIVLPP------------LTDQTGTQLIFTAAKELSHLSK-------LKDHMVREETRNLTPKQCAVLDLALDTIKQYFHAGGNGLKKTFLEKSPDLQSLRYALSLYTQTTDTLIKTFVRSQTTQVHDGKGIRFTANEDIRPEKGSGVDDPVGEVSIQVDLFTHPGTGEHKVTVKVVAANDLKWQTAGMFRPFVEVTMVGPHQSDKKRKFTTKSKSNNWAPKYNETFHFLLGNEEGPESYELQICVKDYCFAREDRVLGLAVMPLRDVTAKGSCACWCPLGRKIHMDETGLTILRILSQRSNDEVAREFVKLKSESRST 1606          
BLAST of Protein unc-13 homolog B vs. Ensembl Human
Match: UNC13B (unc-13 homolog B [Source:HGNC Symbol;Acc:HGNC:12566])

HSP 1 Score: 1499.95 bits (3882), Expect = 0.000e+0
Identity = 709/1232 (57.55%), Postives = 934/1232 (75.81%), Query Frame = 2
Query: 2888 GGFYKSIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRDQEPGDKIQNSDETGP--KNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNP--KLNLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKD-ISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQ------------------DTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIRQS 6514
            GG Y  IDS PD++ RKK + LVSDL L     Q R     +A + TR SL DEELK HVYKKTLQA+IYPIS  TPH+F+V  AT PT+CYECEGLLWG+ARQG+RC ECGVKCHEKC++LLNADCLQRAAEKS KHGAE +TQ II +M D M+ R +N PEIF++I+DVF+VN+ AH   +K+++QS+LDGTSKWSAKI ITV CAQGL  KDKTG+SDPYVTVQV K KKRTKT+   LNP W+EKF+FECHNSS+RIKVRVWDED+D+KS+++Q+L RESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYH+QYTCLHEN+FH+L +   S G    +       ++ W++YFD  +++I++EFAMRYGIESIYQAMTHF+CL++K+MCPGVPAV+STLLANINAYYAHTT++TN SAS+RFAA+NFGKE+F+KLLDQLHNS++I+L  YRN F A  PERL DLKSTVDLLTSITFFRMKVQEL SPPRA QVV++CV+AC+ +TY+++F + ++LYSR  +   ++   +E GP  +NL+FW KLI L+VS+IE+DK  Y P LNQFPQE+N+ ++S   MW   ++ ++ AL  E+ +    K++DY+NL F++KW +N YV DLP  Q  +P YP WFE +V+QWL EN++VS  +L+ A ERDKKDGFQ++SEHAL+S SVVD+FTQLNQ F++I+KLECP+P+I +H+M+RF+ T+ KVL+ YA ++ KD+  Y  K+++ CILMNN+QQ+RV LEK+FEAMGG+ L+ +  D + +LQ +L+ V+D L+  F + F+  I+  ++++  +L  Q++ T   +P  + +  Q++  VLRPLMD+ + NL+L A+VCE+ VLKR+LKELWR+ +  +ER I+LPP            ++ Q   +++  +   LSH+S        LKD + ++   +L+P QC V+D+ LD IK YFHAGGNGLK ++LE+S +LQSLR+AL LY+QTTD LIK F+ SQ +Q                      ++D VGEVS++V+LF HP TGEHK+T  ++A   L WQT  +FRPFVE+ ++GP+  +KKRK+ TKSKSN W+P+YNE+F FL+ + E PE+YE+QICVKDYCF R D+++G  V+ L  +  +GS   W  LGRK+H D  G TILRILSQR+ D++A+EFV+LKS+ R +
Sbjct:  420 GGLY-GIDSMPDLR-RKKPLPLVSDLSL----VQSRKAGITSA-MATRTSLKDEELKSHVYKKTLQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCSECGVKCHEKCQDLLNADCLQRAAEKSCKHGAEDRTQNIIMAMKDRMKIRERNKPEIFEVIRDVFTVNKAAHVQQMKTVKQSVLDGTSKWSAKITITVVCAQGLQAKDKTGSSDPYVTVQVSKTKKRTKTIFGNLNPVWEEKFHFECHNSSDRIKVRVWDEDDDIKSRVKQRLKRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHVQYTCLHENLFHYLTDIQGSGG----VRIPEARGDDAWKVYFDETAQEIVDEFAMRYGIESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSTYRNNFPAGSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHDLYSRQYQLKQELP-PEEQGPSIRNLDFWPKLITLIVSIIEEDKNSYTPVLNQFPQELNVGKVSAEVMWHLFAQDMKYALE-EHEKDHLCKSADYMNLHFKVKWLHNEYVRDLPVLQGQVPEYPAWFEQFVLQWLDENEDVSLEFLRGALERDKKDGFQQTSEHALFSCSVVDVFTQLNQSFEIIRKLECPDPSILAHYMRRFAKTIGKVLMQYADILSKDFPAYCTKEKLPCILMNNVQQLRVQLEKMFEAMGGKELDLEAADSLKELQVKLNTVLDELSMVFGNSFQVRIDECVRQMADIL-GQVRGTGNASPDARASAAQDADSVLRPLMDFLDGNLTLFATVCEKTVLKRVLKELWRVVMNTMERMIVLPP------------LTDQTGTQLIFTAAKELSHLSK-------LKDHMVREETRNLTPKQCAVLDLALDTIKQYFHAGGNGLKKTFLEKSPDLQSLRYALSLYTQTTDTLIKTFVRSQTTQVHDGKGIRFTANEDIRPEKGSGVDDPVGEVSIQVDLFTHPGTGEHKVTVKVVAANDLKWQTAGMFRPFVEVTMVGPHQSDKKRKFTTKSKSNNWAPKYNETFHFLLGNEEGPESYELQICVKDYCFAREDRVLGLAVMPLRDVTAKGSCACWCPLGRKIHMDETGLTILRILSQRSNDEVAREFVKLKSESRST 1618          
BLAST of Protein unc-13 homolog B vs. Ensembl Celegans
Match: unc-13 (Phorbol ester/diacylglycerol-binding protein unc-13 [Source:UniProtKB/Swiss-Prot;Acc:P27715])

HSP 1 Score: 1344.72 bits (3479), Expect = 0.000e+0
Identity = 669/1304 (51.30%), Postives = 903/1304 (69.25%), Query Frame = 2
Query: 2621 SPVPMDSENMDIIVMSAEEM--KRQEEEEIVNSKDTETPKESNKPENKISNEIRKLPGPKFAKIVQKHFIHIDTDMTDGTRRHEDGLDHDYGGFYKSIDSQPD--IKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRDQEPGDKIQNSDETGPKNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKLNLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILK---DISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQ-GSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIR 6508
            +P PM S++M  I +  + +    ++E +IV  K      ES+   +K                 +K+ + +  DM   T    +G       FYKSID+ P+  +   K SI LVS+LVL+TM  ++     ANA+   R + +D ELK HVYKKTLQA+IYPIS+ TPH+F       PTFCYECEGLLWG+ARQGLRC +C VK H+KC+ELL+ADCLQRAAEKS+KHG   +TQ+++  + D M+ + +N PE+F++I+ VF V+E   +  LK+++ SIL+G+SKWSAKI +TV CAQGLI KDKTG SDPYVT QVGK K+RT+T+ QELNP W+EKF+FECHNS++RIKVRVWDEDNDLKSK+RQKLTRESDDFLGQT+IEVRTLSGEMDVWYNLEKRTDKSAVSGAIRL I+VEIKGEEK+APYH+QYTCLHE++F   C +       E+     R  E++W++ F    ++I EEFAMRYGIESIYQAMTHF+CL T++MC GVPAVLSTLLANINAYYAHTT+T+  SA +RFAA+NFGKE+F+KLLDQLHNS++I+L  YRN F +S P +L DLKSTVDLLTSITFFRMKV EL+SPPRA  VVREC +ACM+ TYQ +FE   E +         I ++      +++FW + I  ++ VIE+D+K Y P LNQFPQE+N+  +S   +W      L+ AL  E+ + +  KT +Y+NL F++K FY  YV DL   +  IP +P WF P+V+ WL ENDE S + L+ AY  DK D F ++SEH  +SNSVVD+FTQLN    ++K+++CPNP + +  MKRFS T+NKVLL+YA M++KD+ ++   +++ACILMNN+QQ+RV LEK++E MGG  L+      +  LQ +L+ V+D L+  F    E  I     +L  LL   ++    +  K  ++ E+  VL PLMD  E +L   A  CE+ VLK +LKELW+ITI  +E++++LPP S       + ++  Q  N  +G    L+S     +     +K   D++++++ SL+P QC V+D  LDAIK  FHA G GLK S+ E+S ELQSL++AL LY+QTT+ LIK FI+SQ  QD  + E  VGEVSV+V+LF HP TGE K+T  I+A   L WQT+S F+PFVE++L+GP++ +KKRK++TK+K+  W+P++NE+F F + +   PE+YE+   VKDYCF R D+++G  V+QL  +++Q GS   W+ LG +LH D  G  +LRILSQR  D++AK+FV+LK++ R
Sbjct:  199 TPHPMKSKSMTCIRIPKKTVIAPLRKEIKIVRMKPPAARCESDSKAHK-----------------KKNLLDVYKDMGKSTVLDGNG-SSAANAFYKSIDAAPNMNVARTKTSIPLVSELVLKTMATKRAQAGLANAA---RTTFSDTELKTHVYKKTLQALIYPISATTPHNFATTTFQTPTFCYECEGLLWGLARQGLRCTQCQVKVHDKCRELLSADCLQRAAEKSTKHGEADRTQSLVNVIRDRMKIQEQNKPEVFQMIRTVFDVDENIQKETLKTVKASILEGSSKWSAKITLTVLCAQGLIAKDKTGKSDPYVTAQVGKTKRRTRTIHQELNPVWNEKFHFECHNSTDRIKVRVWDEDNDLKSKLRQKLTRESDDFLGQTVIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLHINVEIKGEEKLAPYHVQYTCLHEHLFAAHCVDE------EVKLPKVRG-EDSWKVCFQETGQEIAEEFAMRYGIESIYQAMTHFACLCTRYMCAGVPAVLSTLLANINAYYAHTTATSAVSAPDRFAASNFGKERFVKLLDQLHNSLRIDLSAYRNHFPSSSPAKLQDLKSTVDLLTSITFFRMKVLELASPPRASTVVRECAKACMQQTYQLMFESCAEQFP--------ILDT------SVQFWYEFIDYIMRVIEEDQKNYTPALNQFPQELNVGNLSAETLWSMYKNDLKMALE-EHAQKKRCKTPEYMNLYFKVKGFYFKYVADLSTYKSSIPEFPAWFIPFVMDWLNENDEHSMDILRNAYNVDKADNFPQTSEHTKFSNSVVDVFTQLNAALKLLKQMDCPNPEVAADMMKRFSKTLNKVLLAYADMVQKDFPKFAHDEKLACILMNNVQQLRVQLEKIYETMGGAELDEHIGQVLTVLQKKLNSVLDRLSAEFVTTLEPHIHEQTIKLGMLL---VKIKGPQLQKTQVQPEADAVLEPLMDLLEGSLRRYADQCEKTVLKYILKELWKITIVNMEKRVVLPPLS-------DKALLKQLPNAKIGDVTKLMSTNIQSIKGMNSVKDMMDMARESEKSLTPRQCTVLDCALDAIKDSFHASGKGLKKSFFEKSPELQSLKYALSLYTQTTEQLIKTFITSQRQQDLPSQEQPVGEVSVQVDLFSHPGTGEQKVTVKILAANDLRWQTSSAFKPFVEVHLVGPHLSDKKRKWSTKTKAGNWAPKFNETFHFFLGNEGEPEHYELMFQVKDYCFARDDRVVGVGVLQLSSVVDQAGSCAMWVQLGTRLHIDETGLILLRILSQRQTDEVAKDFVRLKTECR 1449          
BLAST of Protein unc-13 homolog B vs. Ensembl Celegans
Match: unc-13 (Phorbol ester/diacylglycerol-binding protein unc-13 [Source:UniProtKB/Swiss-Prot;Acc:P27715])

HSP 1 Score: 1340.87 bits (3469), Expect = 0.000e+0
Identity = 651/1212 (53.71%), Postives = 869/1212 (71.70%), Query Frame = 2
Query: 2891 GFYKSIDSQPD--IKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRDQEPGDKIQNSDETGPKNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKLNLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILK---DISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQ-GSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIR 6508
             FYKSID+ P+  +   K SI LVS+LVL+TM  ++     ANA+   R + +D ELK HVYKKTLQA+IYPIS+ TPH+F       PTFCYECEGLLWG+ARQGLRC +C VK H+KC+ELL+ADCLQRAAEKS+KHG   +TQ+++  + D M+ + +N PE+F++I+ VF V+E   +  LK+++ SIL+G+SKWSAKI +TV CAQGLI KDKTG SDPYVT QVGK K+RT+T+ QELNP W+EKF+FECHNS++RIKVRVWDEDNDLKSK+RQKLTRESDDFLGQT+IEVRTLSGEMDVWYNLEKRTDKSAVSGAIRL I+VEIKGEEK+APYH+QYTCLHE++F   C +       E+     R  E++W++ F    ++I EEFAMRYGIESIYQAMTHF+CL T++MC GVPAVLSTLLANINAYYAHTT+T+  SA +RFAA+NFGKE+F+KLLDQLHNS++I+L  YRN F +S P +L DLKSTVDLLTSITFFRMKV EL+SPPRA  VVREC +ACM+ TYQ +FE   E +         I ++      +++FW + I  ++ VIE+D+K Y P LNQFPQE+N+  +S   +W      L+ AL  E+ + +  KT +Y+NL F++K FY  YV DL   +  IP +P WF P+V+ WL ENDE S + L+ AY  DK D F ++SEH  +SNSVVD+FTQLN    ++K+++CPNP + +  MKRFS T+NKVLL+YA M++KD+ ++   +++ACILMNN+QQ+RV LEK++E MGG  L+      +  LQ +L+ V+D L+  F    E  I     +L  LL   ++    +  K  ++ E+  VL PLMD  E +L   A  CE+ VLK +LKELW+ITI  +E++++LPP S       + ++  Q  N  +G    L+S     +     +K   D++++++ SL+P QC V+D  LDAIK  FHA G GLK S+ E+S ELQSL++AL LY+QTT+ LIK FI+SQ  QD  + E  VGEVSV+V+LF HP TGE K+T  I+A   L WQT+S F+PFVE++L+GP++ +KKRK++TK+K+  W+P++NE+F F + +   PE+YE+   VKDYCF R D+++G  V+QL  +++Q GS   W+ LG +LH D  G  +LRILSQR  D++AK+FV+LK++ R
Sbjct:  960 AFYKSIDAAPNMNVARTKTSIPLVSELVLKTMATKRAQAGLANAA---RTTFSDTELKTHVYKKTLQALIYPISATTPHNFATTTFQTPTFCYECEGLLWGLARQGLRCTQCQVKVHDKCRELLSADCLQRAAEKSTKHGEADRTQSLVNVIRDRMKIQEQNKPEVFQMIRTVFDVDENIQKETLKTVKASILEGSSKWSAKITLTVLCAQGLIAKDKTGKSDPYVTAQVGKTKRRTRTIHQELNPVWNEKFHFECHNSTDRIKVRVWDEDNDLKSKLRQKLTRESDDFLGQTVIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLHINVEIKGEEKLAPYHVQYTCLHEHLFAAHCVDE------EVKLPKVRG-EDSWKVCFQETGQEIAEEFAMRYGIESIYQAMTHFACLCTRYMCAGVPAVLSTLLANINAYYAHTTATSAVSAPDRFAASNFGKERFVKLLDQLHNSLRIDLSAYRNHFPSSSPAKLQDLKSTVDLLTSITFFRMKVLELASPPRASTVVRECAKACMQQTYQLMFESCAEQFP--------ILDT------SVQFWYEFIDYIMRVIEEDQKNYTPALNQFPQELNVGNLSAETLWSMYKNDLKMALE-EHAQKKRCKTPEYMNLYFKVKGFYFKYVADLSTYKSSIPEFPAWFIPFVMDWLNENDEHSMDILRNAYNVDKADNFPQTSEHTKFSNSVVDVFTQLNAALKLLKQMDCPNPEVAADMMKRFSKTLNKVLLAYADMVQKDFPKFAHDEKLACILMNNVQQLRVQLEKIYETMGGAELDEHIGQVLTVLQKKLNSVLDRLSAEFVTTLEPHIHEQTIKLGMLL---VKIKGPQLQKTQVQPEADAVLEPLMDLLEGSLRRYADQCEKTVLKYILKELWKITIVNMEKRVVLPPLS-------DKALLKQLPNAKIGDVTKLMSTNIQSIKGMNSVKDMMDMARESEKSLTPRQCTVLDCALDAIKDSFHASGKGLKKSFFEKSPELQSLKYALSLYTQTTEQLIKTFITSQRQQDLPSQEQPVGEVSVQVDLFSHPGTGEQKVTVKILAANDLRWQTSSAFKPFVEVHLVGPHLSDKKRKWSTKTKAGNWAPKFNETFHFFLGNEGEPEHYELMFQVKDYCFARDDRVVGVGVLQLSSVVDQAGSCAMWVQLGTRLHIDETGLILLRILSQRQTDEVAKDFVRLKTECR 2136          
BLAST of Protein unc-13 homolog B vs. Ensembl Celegans
Match: unc-13 (Phorbol ester/diacylglycerol-binding protein unc-13 [Source:UniProtKB/Swiss-Prot;Acc:P27715])

HSP 1 Score: 1339.71 bits (3466), Expect = 0.000e+0
Identity = 651/1212 (53.71%), Postives = 869/1212 (71.70%), Query Frame = 2
Query: 2891 GFYKSIDSQPD--IKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRDQEPGDKIQNSDETGPKNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKLNLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILK---DISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQ-GSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIR 6508
             FYKSID+ P+  +   K SI LVS+LVL+TM  ++     ANA+   R + +D ELK HVYKKTLQA+IYPIS+ TPH+F       PTFCYECEGLLWG+ARQGLRC +C VK H+KC+ELL+ADCLQRAAEKS+KHG   +TQ+++  + D M+ + +N PE+F++I+ VF V+E   +  LK+++ SIL+G+SKWSAKI +TV CAQGLI KDKTG SDPYVT QVGK K+RT+T+ QELNP W+EKF+FECHNS++RIKVRVWDEDNDLKSK+RQKLTRESDDFLGQT+IEVRTLSGEMDVWYNLEKRTDKSAVSGAIRL I+VEIKGEEK+APYH+QYTCLHE++F   C +       E+     R  E++W++ F    ++I EEFAMRYGIESIYQAMTHF+CL T++MC GVPAVLSTLLANINAYYAHTT+T+  SA +RFAA+NFGKE+F+KLLDQLHNS++I+L  YRN F +S P +L DLKSTVDLLTSITFFRMKV EL+SPPRA  VVREC +ACM+ TYQ +FE   E +         I ++      +++FW + I  ++ VIE+D+K Y P LNQFPQE+N+  +S   +W      L+ AL  E+ + +  KT +Y+NL F++K FY  YV DL   +  IP +P WF P+V+ WL ENDE S + L+ AY  DK D F ++SEH  +SNSVVD+FTQLN    ++K+++CPNP + +  MKRFS T+NKVLL+YA M++KD+ ++   +++ACILMNN+QQ+RV LEK++E MGG  L+      +  LQ +L+ V+D L+  F    E  I     +L  LL   ++    +  K  ++ E+  VL PLMD  E +L   A  CE+ VLK +LKELW+ITI  +E++++LPP S       + ++  Q  N  +G    L+S     +     +K   D++++++ SL+P QC V+D  LDAIK  FHA G GLK S+ E+S ELQSL++AL LY+QTT+ LIK FI+SQ  QD  + E  VGEVSV+V+LF HP TGE K+T  I+A   L WQT+S F+PFVE++L+GP++ +KKRK++TK+K+  W+P++NE+F F + +   PE+YE+   VKDYCF R D+++G  V+QL  +++Q GS   W+ LG +LH D  G  +LRILSQR  D++AK+FV+LK++ R
Sbjct:  280 AFYKSIDAAPNMNVARTKTSIPLVSELVLKTMATKRAQAGLANAA---RTTFSDTELKTHVYKKTLQALIYPISATTPHNFATTTFQTPTFCYECEGLLWGLARQGLRCTQCQVKVHDKCRELLSADCLQRAAEKSTKHGEADRTQSLVNVIRDRMKIQEQNKPEVFQMIRTVFDVDENIQKETLKTVKASILEGSSKWSAKITLTVLCAQGLIAKDKTGKSDPYVTAQVGKTKRRTRTIHQELNPVWNEKFHFECHNSTDRIKVRVWDEDNDLKSKLRQKLTRESDDFLGQTVIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLHINVEIKGEEKLAPYHVQYTCLHEHLFAAHCVDE------EVKLPKVRG-EDSWKVCFQETGQEIAEEFAMRYGIESIYQAMTHFACLCTRYMCAGVPAVLSTLLANINAYYAHTTATSAVSAPDRFAASNFGKERFVKLLDQLHNSLRIDLSAYRNHFPSSSPAKLQDLKSTVDLLTSITFFRMKVLELASPPRASTVVRECAKACMQQTYQLMFESCAEQFP--------ILDT------SVQFWYEFIDYIMRVIEEDQKNYTPALNQFPQELNVGNLSAETLWSMYKNDLKMALE-EHAQKKRCKTPEYMNLYFKVKGFYFKYVADLSTYKSSIPEFPAWFIPFVMDWLNENDEHSMDILRNAYNVDKADNFPQTSEHTKFSNSVVDVFTQLNAALKLLKQMDCPNPEVAADMMKRFSKTLNKVLLAYADMVQKDFPKFAHDEKLACILMNNVQQLRVQLEKIYETMGGAELDEHIGQVLTVLQKKLNSVLDRLSAEFVTTLEPHIHEQTIKLGMLL---VKIKGPQLQKTQVQPEADAVLEPLMDLLEGSLRRYADQCEKTVLKYILKELWKITIVNMEKRVVLPPLS-------DKALLKQLPNAKIGDVTKLMSTNIQSIKGMNSVKDMMDMARESEKSLTPRQCTVLDCALDAIKDSFHASGKGLKKSFFEKSPELQSLKYALSLYTQTTEQLIKTFITSQRQQDLPSQEQPVGEVSVQVDLFSHPGTGEQKVTVKILAANDLRWQTSSAFKPFVEVHLVGPHLSDKKRKWSTKTKAGNWAPKFNETFHFFLGNEGEPEHYELMFQVKDYCFARDDRVVGVGVLQLSSVVDQAGSCAMWVQLGTRLHIDETGLILLRILSQRQTDEVAKDFVRLKTECR 1456          
BLAST of Protein unc-13 homolog B vs. Ensembl Celegans
Match: unc-13 (Phorbol ester/diacylglycerol-binding protein unc-13 [Source:UniProtKB/Swiss-Prot;Acc:P27715])

HSP 1 Score: 1338.55 bits (3463), Expect = 0.000e+0
Identity = 651/1212 (53.71%), Postives = 869/1212 (71.70%), Query Frame = 2
Query: 2891 GFYKSIDSQPD--IKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRDQEPGDKIQNSDETGPKNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKLNLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILK---DISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQ-GSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIR 6508
             FYKSID+ P+  +   K SI LVS+LVL+TM  ++     ANA+   R + +D ELK HVYKKTLQA+IYPIS+ TPH+F       PTFCYECEGLLWG+ARQGLRC +C VK H+KC+ELL+ADCLQRAAEKS+KHG   +TQ+++  + D M+ + +N PE+F++I+ VF V+E   +  LK+++ SIL+G+SKWSAKI +TV CAQGLI KDKTG SDPYVT QVGK K+RT+T+ QELNP W+EKF+FECHNS++RIKVRVWDEDNDLKSK+RQKLTRESDDFLGQT+IEVRTLSGEMDVWYNLEKRTDKSAVSGAIRL I+VEIKGEEK+APYH+QYTCLHE++F   C +       E+     R  E++W++ F    ++I EEFAMRYGIESIYQAMTHF+CL T++MC GVPAVLSTLLANINAYYAHTT+T+  SA +RFAA+NFGKE+F+KLLDQLHNS++I+L  YRN F +S P +L DLKSTVDLLTSITFFRMKV EL+SPPRA  VVREC +ACM+ TYQ +FE   E +         I ++      +++FW + I  ++ VIE+D+K Y P LNQFPQE+N+  +S   +W      L+ AL  E+ + +  KT +Y+NL F++K FY  YV DL   +  IP +P WF P+V+ WL ENDE S + L+ AY  DK D F ++SEH  +SNSVVD+FTQLN    ++K+++CPNP + +  MKRFS T+NKVLL+YA M++KD+ ++   +++ACILMNN+QQ+RV LEK++E MGG  L+      +  LQ +L+ V+D L+  F    E  I     +L  LL   ++    +  K  ++ E+  VL PLMD  E +L   A  CE+ VLK +LKELW+ITI  +E++++LPP S       + ++  Q  N  +G    L+S     +     +K   D++++++ SL+P QC V+D  LDAIK  FHA G GLK S+ E+S ELQSL++AL LY+QTT+ LIK FI+SQ  QD  + E  VGEVSV+V+LF HP TGE K+T  I+A   L WQT+S F+PFVE++L+GP++ +KKRK++TK+K+  W+P++NE+F F + +   PE+YE+   VKDYCF R D+++G  V+QL  +++Q GS   W+ LG +LH D  G  +LRILSQR  D++AK+FV+LK++ R
Sbjct:  624 AFYKSIDAAPNMNVARTKTSIPLVSELVLKTMATKRAQAGLANAA---RTTFSDTELKTHVYKKTLQALIYPISATTPHNFATTTFQTPTFCYECEGLLWGLARQGLRCTQCQVKVHDKCRELLSADCLQRAAEKSTKHGEADRTQSLVNVIRDRMKIQEQNKPEVFQMIRTVFDVDENIQKETLKTVKASILEGSSKWSAKITLTVLCAQGLIAKDKTGKSDPYVTAQVGKTKRRTRTIHQELNPVWNEKFHFECHNSTDRIKVRVWDEDNDLKSKLRQKLTRESDDFLGQTVIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLHINVEIKGEEKLAPYHVQYTCLHEHLFAAHCVDE------EVKLPKVRG-EDSWKVCFQETGQEIAEEFAMRYGIESIYQAMTHFACLCTRYMCAGVPAVLSTLLANINAYYAHTTATSAVSAPDRFAASNFGKERFVKLLDQLHNSLRIDLSAYRNHFPSSSPAKLQDLKSTVDLLTSITFFRMKVLELASPPRASTVVRECAKACMQQTYQLMFESCAEQFP--------ILDT------SVQFWYEFIDYIMRVIEEDQKNYTPALNQFPQELNVGNLSAETLWSMYKNDLKMALE-EHAQKKRCKTPEYMNLYFKVKGFYFKYVADLSTYKSSIPEFPAWFIPFVMDWLNENDEHSMDILRNAYNVDKADNFPQTSEHTKFSNSVVDVFTQLNAALKLLKQMDCPNPEVAADMMKRFSKTLNKVLLAYADMVQKDFPKFAHDEKLACILMNNVQQLRVQLEKIYETMGGAELDEHIGQVLTVLQKKLNSVLDRLSAEFVTTLEPHIHEQTIKLGMLL---VKIKGPQLQKTQVQPEADAVLEPLMDLLEGSLRRYADQCEKTVLKYILKELWKITIVNMEKRVVLPPLS-------DKALLKQLPNAKIGDVTKLMSTNIQSIKGMNSVKDMMDMARESEKSLTPRQCTVLDCALDAIKDSFHASGKGLKKSFFEKSPELQSLKYALSLYTQTTEQLIKTFITSQRQQDLPSQEQPVGEVSVQVDLFSHPGTGEQKVTVKILAANDLRWQTSSAFKPFVEVHLVGPHLSDKKRKWSTKTKAGNWAPKFNETFHFFLGNEGEPEHYELMFQVKDYCFARDDRVVGVGVLQLSSVVDQAGSCAMWVQLGTRLHIDETGLILLRILSQRQTDEVAKDFVRLKTECR 1800          
BLAST of Protein unc-13 homolog B vs. Ensembl Celegans
Match: unc-13 (Phorbol ester/diacylglycerol-binding protein unc-13 [Source:UniProtKB/Swiss-Prot;Acc:P27715])

HSP 1 Score: 1338.55 bits (3463), Expect = 0.000e+0
Identity = 651/1212 (53.71%), Postives = 869/1212 (71.70%), Query Frame = 2
Query: 2891 GFYKSIDSQPD--IKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRDQEPGDKIQNSDETGPKNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKLNLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILK---DISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQ-GSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIR 6508
             FYKSID+ P+  +   K SI LVS+LVL+TM  ++     ANA+   R + +D ELK HVYKKTLQA+IYPIS+ TPH+F       PTFCYECEGLLWG+ARQGLRC +C VK H+KC+ELL+ADCLQRAAEKS+KHG   +TQ+++  + D M+ + +N PE+F++I+ VF V+E   +  LK+++ SIL+G+SKWSAKI +TV CAQGLI KDKTG SDPYVT QVGK K+RT+T+ QELNP W+EKF+FECHNS++RIKVRVWDEDNDLKSK+RQKLTRESDDFLGQT+IEVRTLSGEMDVWYNLEKRTDKSAVSGAIRL I+VEIKGEEK+APYH+QYTCLHE++F   C +       E+     R  E++W++ F    ++I EEFAMRYGIESIYQAMTHF+CL T++MC GVPAVLSTLLANINAYYAHTT+T+  SA +RFAA+NFGKE+F+KLLDQLHNS++I+L  YRN F +S P +L DLKSTVDLLTSITFFRMKV EL+SPPRA  VVREC +ACM+ TYQ +FE   E +         I ++      +++FW + I  ++ VIE+D+K Y P LNQFPQE+N+  +S   +W      L+ AL  E+ + +  KT +Y+NL F++K FY  YV DL   +  IP +P WF P+V+ WL ENDE S + L+ AY  DK D F ++SEH  +SNSVVD+FTQLN    ++K+++CPNP + +  MKRFS T+NKVLL+YA M++KD+ ++   +++ACILMNN+QQ+RV LEK++E MGG  L+      +  LQ +L+ V+D L+  F    E  I     +L  LL   ++    +  K  ++ E+  VL PLMD  E +L   A  CE+ VLK +LKELW+ITI  +E++++LPP S       + ++  Q  N  +G    L+S     +     +K   D++++++ SL+P QC V+D  LDAIK  FHA G GLK S+ E+S ELQSL++AL LY+QTT+ LIK FI+SQ  QD  + E  VGEVSV+V+LF HP TGE K+T  I+A   L WQT+S F+PFVE++L+GP++ +KKRK++TK+K+  W+P++NE+F F + +   PE+YE+   VKDYCF R D+++G  V+QL  +++Q GS   W+ LG +LH D  G  +LRILSQR  D++AK+FV+LK++ R
Sbjct:  621 AFYKSIDAAPNMNVARTKTSIPLVSELVLKTMATKRAQAGLANAA---RTTFSDTELKTHVYKKTLQALIYPISATTPHNFATTTFQTPTFCYECEGLLWGLARQGLRCTQCQVKVHDKCRELLSADCLQRAAEKSTKHGEADRTQSLVNVIRDRMKIQEQNKPEVFQMIRTVFDVDENIQKETLKTVKASILEGSSKWSAKITLTVLCAQGLIAKDKTGKSDPYVTAQVGKTKRRTRTIHQELNPVWNEKFHFECHNSTDRIKVRVWDEDNDLKSKLRQKLTRESDDFLGQTVIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLHINVEIKGEEKLAPYHVQYTCLHEHLFAAHCVDE------EVKLPKVRG-EDSWKVCFQETGQEIAEEFAMRYGIESIYQAMTHFACLCTRYMCAGVPAVLSTLLANINAYYAHTTATSAVSAPDRFAASNFGKERFVKLLDQLHNSLRIDLSAYRNHFPSSSPAKLQDLKSTVDLLTSITFFRMKVLELASPPRASTVVRECAKACMQQTYQLMFESCAEQFP--------ILDT------SVQFWYEFIDYIMRVIEEDQKNYTPALNQFPQELNVGNLSAETLWSMYKNDLKMALE-EHAQKKRCKTPEYMNLYFKVKGFYFKYVADLSTYKSSIPEFPAWFIPFVMDWLNENDEHSMDILRNAYNVDKADNFPQTSEHTKFSNSVVDVFTQLNAALKLLKQMDCPNPEVAADMMKRFSKTLNKVLLAYADMVQKDFPKFAHDEKLACILMNNVQQLRVQLEKIYETMGGAELDEHIGQVLTVLQKKLNSVLDRLSAEFVTTLEPHIHEQTIKLGMLL---VKIKGPQLQKTQVQPEADAVLEPLMDLLEGSLRRYADQCEKTVLKYILKELWKITIVNMEKRVVLPPLS-------DKALLKQLPNAKIGDVTKLMSTNIQSIKGMNSVKDMMDMARESEKSLTPRQCTVLDCALDAIKDSFHASGKGLKKSFFEKSPELQSLKYALSLYTQTTEQLIKTFITSQRQQDLPSQEQPVGEVSVQVDLFSHPGTGEQKVTVKILAANDLRWQTSSAFKPFVEVHLVGPHLSDKKRKWSTKTKAGNWAPKFNETFHFFLGNEGEPEHYELMFQVKDYCFARDDRVVGVGVLQLSSVVDQAGSCAMWVQLGTRLHIDETGLILLRILSQRQTDEVAKDFVRLKTECR 1797          
BLAST of Protein unc-13 homolog B vs. Ensembl Fly
Match: unc-13 (gene:FBgn0025726 transcript:FBtr0089246)

HSP 1 Score: 1550.41 bits (4013), Expect = 0.000e+0
Identity = 742/1227 (60.47%), Postives = 949/1227 (77.34%), Query Frame = 2
Query: 2894 FYKSIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRD--QEPGDKIQNSDETGPK--NLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKLNLEQ-------ESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQ---AQNKILGMSQSLLSHVSNQVPNSKILK---DISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQ-DTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTS-VFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIRQSP 6517
            FY +IDS PDI+ R+KSI LVS+LVL+TM A KRN  A   S V R +LNDE+LKMHVYKK LQA+IYPISS TPH+F +  AT PT+CYECEGLLWG+ARQG+RC ECGVKCHEKCK+LLNADCLQRAAEKSSKHGAE K  +II +M D M+ R +  PEIF++I+ VFSV E++H  H+K+++QS+LDGTSKWSAKIAITV CAQGLI KDK+GTSDPYVTVQV K KKRT+T+ QELNP W+EKF+FECHNSS+RIKVRVWDEDNDLKSK+RQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRL ISVEIKGEEKVAPYH+QYTCLHEN+FH+LCEENT      ++    +  ++ W++YFD   E+I++EF+MRYGIE+IYQAMTHF CL+ K++CPGVPAV+STLLANINAYYAHTT+++  SAS+RFAA+NFGKEKF+KLLDQLHNS++I+L +YRN F AS PE+L DLKSTVDLLTSITFFRMKVQELSSPPRA  VV++CV+AC+++TYQFLFE+  ELY+R+   +P +  +  D+  PK  +++FW KLI L+VSVI++DK  Y   LNQFPQE+N+ Q+S S+MW   +  ++ AL  E+ + +  K+S Y+NL FR+KW Y+ YV ++P  +  +P+YP WFEP+V+QWL END+VS  YL  A++RDKKDGFQKSSEHAL+SNSVVD+FTQL QCFDV+ KLECP+P I   +M+RF+ T+ KVL++YA ++K ++ E+++ + +ACILMNNIQQ+RV LEK+FE+MGG+ LE D  + + +LQ  L+  +D LA  FA   E  I  +++EL  +L + I+  +      NL         E+  VLRPLMD  + +L+L A  CE+ VLKRLLKELW+I ++ LE+ I+LPP +    +F +++ +++   +  KI  M +   SH++ +      L    DISK+ + +LSP QC V+D+ LD IK YFHAGGNGLK ++LE+S ELQSLR+AL LY+Q TD LIK FISSQ  + D    E++VGE+SV+++LF HP TGEHK+   ++A   L WQ  S +FRPFV+I L+GP++  KKRK+ATKSKSN WSP+YNESFSF I + E  + +E+ ICVKDYCF R D+L+G  VI L  + E+GS   WL L R++  D  GWTILRILSQR  D++AKEFV+LKS+IRQ P
Sbjct: 1653 FYSNIDSMPDIRPRRKSIPLVSELVLKTMAATKRN--AGLTSAVPRATLNDEDLKMHVYKKALQALIYPISSTTPHNFLLWTATSPTYCYECEGLLWGIARQGVRCTECGVKCHEKCKDLLNADCLQRAAEKSSKHGAEDKANSIITAMKDRMKQREREKPEIFELIRAVFSVEEKSHAGHMKAVKQSVLDGTSKWSAKIAITVICAQGLIAKDKSGTSDPYVTVQVSKVKKRTRTMPQELNPVWNEKFHFECHNSSDRIKVRVWDEDNDLKSKLRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLHISVEIKGEEKVAPYHVQYTCLHENLFHYLCEENTG-----MVKLPTQKGDDAWKLYFDEIPEEIVDEFSMRYGIENIYQAMTHFHCLSAKYLCPGVPAVMSTLLANINAYYAHTTASSAVSASDRFAASNFGKEKFVKLLDQLHNSLRIDLSMYRNNFPASSPEKLMDLKSTVDLLTSITFFRMKVQELSSPPRASTVVKDCVKACLRSTYQFLFENCYELYNREFQVDPNEAKRAPDDHEPKLDSVDFWHKLIALIVSVIDEDKNSYGTVLNQFPQELNIGQLSASSMWHLFAVDMKYALE-EHEQHRLCKSSAYMNLHFRVKWLYSNYVKEVPPYKGAVPDYPAWFEPFVMQWLNENDDVSLEYLHGAFKRDKKDGFQKSSEHALFSNSVVDVFTQLTQCFDVVSKLECPDPEIWKRYMRRFAKTIVKVLIAYADIVKLEFPEHMKDERIACILMNNIQQLRVQLEKMFESMGGDKLEEDAANILKELQQNLNSALDDLASQFAISLEPRITQSVRELGDMLLS-IKGGSGTLAAGNLAAQRNAVAVEADEVLRPLMDLLDGSLTLYAQSCEKTVLKRLLKELWKIVMRILEKTIVLPPMTDKTMMFKHLTDNAKNLASNAKIEDMGRLFKSHMAGKQDVKSALSGVMDISKEVEKNLSPKQCAVLDVALDTIKQYFHAGGNGLKKTFLEKSPELQSLRYALSLYTQMTDTLIKTFISSQVHEVDLENSEESVGEISVQIDLFSHPGTGEHKVNVKVVAANDLKWQIPSGMFRPFVDINLIGPHLQEKKRKFATKSKSNNWSPKYNESFSFTIGNEEQLDFFELHICVKDYCFARDDRLVGVAVIPLKDISEKGSVACWLPLMRRIEMDETGWTILRILSQRNNDEVAKEFVKLKSEIRQEP 2870          
BLAST of Protein unc-13 homolog B vs. Ensembl Fly
Match: unc-13 (gene:FBgn0025726 transcript:FBtr0308806)

HSP 1 Score: 1550.03 bits (4012), Expect = 0.000e+0
Identity = 742/1227 (60.47%), Postives = 949/1227 (77.34%), Query Frame = 2
Query: 2894 FYKSIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRD--QEPGDKIQNSDETGPK--NLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKLNLEQ-------ESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQ---AQNKILGMSQSLLSHVSNQVPNSKILK---DISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQ-DTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTS-VFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIRQSP 6517
            FY +IDS PDI+ R+KSI LVS+LVL+TM A KRN  A   S V R +LNDE+LKMHVYKK LQA+IYPISS TPH+F +  AT PT+CYECEGLLWG+ARQG+RC ECGVKCHEKCK+LLNADCLQRAAEKSSKHGAE K  +II +M D M+ R +  PEIF++I+ VFSV E++H  H+K+++QS+LDGTSKWSAKIAITV CAQGLI KDK+GTSDPYVTVQV K KKRT+T+ QELNP W+EKF+FECHNSS+RIKVRVWDEDNDLKSK+RQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRL ISVEIKGEEKVAPYH+QYTCLHEN+FH+LCEENT      ++    +  ++ W++YFD   E+I++EF+MRYGIE+IYQAMTHF CL+ K++CPGVPAV+STLLANINAYYAHTT+++  SAS+RFAA+NFGKEKF+KLLDQLHNS++I+L +YRN F AS PE+L DLKSTVDLLTSITFFRMKVQELSSPPRA  VV++CV+AC+++TYQFLFE+  ELY+R+   +P +  +  D+  PK  +++FW KLI L+VSVI++DK  Y   LNQFPQE+N+ Q+S S+MW   +  ++ AL  E+ + +  K+S Y+NL FR+KW Y+ YV ++P  +  +P+YP WFEP+V+QWL END+VS  YL  A++RDKKDGFQKSSEHAL+SNSVVD+FTQL QCFDV+ KLECP+P I   +M+RF+ T+ KVL++YA ++K ++ E+++ + +ACILMNNIQQ+RV LEK+FE+MGG+ LE D  + + +LQ  L+  +D LA  FA   E  I  +++EL  +L + I+  +      NL         E+  VLRPLMD  + +L+L A  CE+ VLKRLLKELW+I ++ LE+ I+LPP +    +F +++ +++   +  KI  M +   SH++ +      L    DISK+ + +LSP QC V+D+ LD IK YFHAGGNGLK ++LE+S ELQSLR+AL LY+Q TD LIK FISSQ  + D    E++VGE+SV+++LF HP TGEHK+   ++A   L WQ  S +FRPFV+I L+GP++  KKRK+ATKSKSN WSP+YNESFSF I + E  + +E+ ICVKDYCF R D+L+G  VI L  + E+GS   WL L R++  D  GWTILRILSQR  D++AKEFV+LKS+IRQ P
Sbjct: 1965 FYSNIDSMPDIRPRRKSIPLVSELVLKTMAATKRN--AGLTSAVPRATLNDEDLKMHVYKKALQALIYPISSTTPHNFLLWTATSPTYCYECEGLLWGIARQGVRCTECGVKCHEKCKDLLNADCLQRAAEKSSKHGAEDKANSIITAMKDRMKQREREKPEIFELIRAVFSVEEKSHAGHMKAVKQSVLDGTSKWSAKIAITVICAQGLIAKDKSGTSDPYVTVQVSKVKKRTRTMPQELNPVWNEKFHFECHNSSDRIKVRVWDEDNDLKSKLRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLHISVEIKGEEKVAPYHVQYTCLHENLFHYLCEENTG-----MVKLPTQKGDDAWKLYFDEIPEEIVDEFSMRYGIENIYQAMTHFHCLSAKYLCPGVPAVMSTLLANINAYYAHTTASSAVSASDRFAASNFGKEKFVKLLDQLHNSLRIDLSMYRNNFPASSPEKLMDLKSTVDLLTSITFFRMKVQELSSPPRASTVVKDCVKACLRSTYQFLFENCYELYNREFQVDPNEAKRAPDDHEPKLDSVDFWHKLIALIVSVIDEDKNSYGTVLNQFPQELNIGQLSASSMWHLFAVDMKYALE-EHEQHRLCKSSAYMNLHFRVKWLYSNYVKEVPPYKGAVPDYPAWFEPFVMQWLNENDDVSLEYLHGAFKRDKKDGFQKSSEHALFSNSVVDVFTQLTQCFDVVSKLECPDPEIWKRYMRRFAKTIVKVLIAYADIVKLEFPEHMKDERIACILMNNIQQLRVQLEKMFESMGGDKLEEDAANILKELQQNLNSALDDLASQFAISLEPRITQSVRELGDMLLS-IKGGSGTLAAGNLAAQRNAVAVEADEVLRPLMDLLDGSLTLYAQSCEKTVLKRLLKELWKIVMRILEKTIVLPPMTDKTMMFKHLTDNAKNLASNAKIEDMGRLFKSHMAGKQDVKSALSGVMDISKEVEKNLSPKQCAVLDVALDTIKQYFHAGGNGLKKTFLEKSPELQSLRYALSLYTQMTDTLIKTFISSQVHEVDLENSEESVGEISVQIDLFSHPGTGEHKVNVKVVAANDLKWQIPSGMFRPFVDINLIGPHLQEKKRKFATKSKSNNWSPKYNESFSFTIGNEEQLDFFELHICVKDYCFARDDRLVGVAVIPLKDISEKGSVACWLPLMRRIEMDETGWTILRILSQRNNDEVAKEFVKLKSEIRQEP 3182          
BLAST of Protein unc-13 homolog B vs. Ensembl Fly
Match: unc-13 (gene:FBgn0025726 transcript:FBtr0344971)

HSP 1 Score: 1541.55 bits (3990), Expect = 0.000e+0
Identity = 740/1227 (60.31%), Postives = 946/1227 (77.10%), Query Frame = 2
Query: 2894 FYKSIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRD--QEPGDKIQNSDETGPK--NLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKLNLEQ-------ESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQ---AQNKILGMSQSLLSHVSNQVPNSKILK---DISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQ-DTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTS-VFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIRQSP 6517
            FY +IDS PDI+ R+KSI LVS+L   TM A KRN  A   S V R +LNDE+LKMHVYKK LQA+IYPISS TPH+F +  AT PT+CYECEGLLWG+ARQG+RC ECGVKCHEKCK+LLNADCLQRAAEKSSKHGAE K  +II +M D M+ R +  PEIF++I+ VFSV E++H  H+K+++QS+LDGTSKWSAKIAITV CAQGLI KDK+GTSDPYVTVQV K KKRT+T+ QELNP W+EKF+FECHNSS+RIKVRVWDEDNDLKSK+RQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRL ISVEIKGEEKVAPYH+QYTCLHEN+FH+LCEENT      ++    +  ++ W++YFD   E+I++EF+MRYGIE+IYQAMTHF CL+ K++CPGVPAV+STLLANINAYYAHTT+++  SAS+RFAA+NFGKEKF+KLLDQLHNS++I+L +YRN F AS PE+L DLKSTVDLLTSITFFRMKVQELSSPPRA  VV++CV+AC+++TYQFLFE+  ELY+R+   +P +  +  D+  PK  +++FW KLI L+VSVI++DK  Y   LNQFPQE+N+ Q+S S+MW   +  ++ AL  E+ + +  K+S Y+NL FR+KW Y+ YV ++P  +  +P+YP WFEP+V+QWL END+VS  YL  A++RDKKDGFQKSSEHAL+SNSVVD+FTQL QCFDV+ KLECP+P I   +M+RF+ T+ KVL++YA ++K ++ E+++ + +ACILMNNIQQ+RV LEK+FE+MGG+ LE D  + + +LQ  L+  +D LA  FA   E  I  +++EL  +L + I+  +      NL         E+  VLRPLMD  + +L+L A  CE+ VLKRLLKELW+I ++ LE+ I+LPP +    +F +++ +++   +  KI  M +   SH++ +      L    DISK+ + +LSP QC V+D+ LD IK YFHAGGNGLK ++LE+S ELQSLR+AL LY+Q TD LIK FISSQ  + D    E++VGE+SV+++LF HP TGEHK+   ++A   L WQ  S +FRPFV+I L+GP++  KKRK+ATKSKSN WSP+YNESFSF I + E  + +E+ ICVKDYCF R D+L+G  VI L  + E+GS   WL L R++  D  GWTILRILSQR  D++AKEFV+LKS+IRQ P
Sbjct: 1653 FYSNIDSMPDIRPRRKSIPLVSEL---TMAATKRN--AGLTSAVPRATLNDEDLKMHVYKKALQALIYPISSTTPHNFLLWTATSPTYCYECEGLLWGIARQGVRCTECGVKCHEKCKDLLNADCLQRAAEKSSKHGAEDKANSIITAMKDRMKQREREKPEIFELIRAVFSVEEKSHAGHMKAVKQSVLDGTSKWSAKIAITVICAQGLIAKDKSGTSDPYVTVQVSKVKKRTRTMPQELNPVWNEKFHFECHNSSDRIKVRVWDEDNDLKSKLRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLHISVEIKGEEKVAPYHVQYTCLHENLFHYLCEENTG-----MVKLPTQKGDDAWKLYFDEIPEEIVDEFSMRYGIENIYQAMTHFHCLSAKYLCPGVPAVMSTLLANINAYYAHTTASSAVSASDRFAASNFGKEKFVKLLDQLHNSLRIDLSMYRNNFPASSPEKLMDLKSTVDLLTSITFFRMKVQELSSPPRASTVVKDCVKACLRSTYQFLFENCYELYNREFQVDPNEAKRAPDDHEPKLDSVDFWHKLIALIVSVIDEDKNSYGTVLNQFPQELNIGQLSASSMWHLFAVDMKYALE-EHEQHRLCKSSAYMNLHFRVKWLYSNYVKEVPPYKGAVPDYPAWFEPFVMQWLNENDDVSLEYLHGAFKRDKKDGFQKSSEHALFSNSVVDVFTQLTQCFDVVSKLECPDPEIWKRYMRRFAKTIVKVLIAYADIVKLEFPEHMKDERIACILMNNIQQLRVQLEKMFESMGGDKLEEDAANILKELQQNLNSALDDLASQFAISLEPRITQSVRELGDMLLS-IKGGSGTLAAGNLAAQRNAVAVEADEVLRPLMDLLDGSLTLYAQSCEKTVLKRLLKELWKIVMRILEKTIVLPPMTDKTMMFKHLTDNAKNLASNAKIEDMGRLFKSHMAGKQDVKSALSGVMDISKEVEKNLSPKQCAVLDVALDTIKQYFHAGGNGLKKTFLEKSPELQSLRYALSLYTQMTDTLIKTFISSQVHEVDLENSEESVGEISVQIDLFSHPGTGEHKVNVKVVAANDLKWQIPSGMFRPFVDINLIGPHLQEKKRKFATKSKSNNWSPKYNESFSFTIGNEEQLDFFELHICVKDYCFARDDRLVGVAVIPLKDISEKGSVACWLPLMRRIEMDETGWTILRILSQRNNDEVAKEFVKLKSEIRQEP 2867          
BLAST of Protein unc-13 homolog B vs. Ensembl Fly
Match: unc-13 (gene:FBgn0025726 transcript:FBtr0089247)

HSP 1 Score: 1540.78 bits (3988), Expect = 0.000e+0
Identity = 740/1227 (60.31%), Postives = 946/1227 (77.10%), Query Frame = 2
Query: 2894 FYKSIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRD--QEPGDKIQNSDETGPK--NLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKLNLEQ-------ESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQ---AQNKILGMSQSLLSHVSNQVPNSKILK---DISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQ-DTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTS-VFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIRQSP 6517
            FY +IDS PDI+ R+KSI LVS+L   TM A KRN  A   S V R +LNDE+LKMHVYKK LQA+IYPISS TPH+F +  AT PT+CYECEGLLWG+ARQG+RC ECGVKCHEKCK+LLNADCLQRAAEKSSKHGAE K  +II +M D M+ R +  PEIF++I+ VFSV E++H  H+K+++QS+LDGTSKWSAKIAITV CAQGLI KDK+GTSDPYVTVQV K KKRT+T+ QELNP W+EKF+FECHNSS+RIKVRVWDEDNDLKSK+RQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRL ISVEIKGEEKVAPYH+QYTCLHEN+FH+LCEENT      ++    +  ++ W++YFD   E+I++EF+MRYGIE+IYQAMTHF CL+ K++CPGVPAV+STLLANINAYYAHTT+++  SAS+RFAA+NFGKEKF+KLLDQLHNS++I+L +YRN F AS PE+L DLKSTVDLLTSITFFRMKVQELSSPPRA  VV++CV+AC+++TYQFLFE+  ELY+R+   +P +  +  D+  PK  +++FW KLI L+VSVI++DK  Y   LNQFPQE+N+ Q+S S+MW   +  ++ AL  E+ + +  K+S Y+NL FR+KW Y+ YV ++P  +  +P+YP WFEP+V+QWL END+VS  YL  A++RDKKDGFQKSSEHAL+SNSVVD+FTQL QCFDV+ KLECP+P I   +M+RF+ T+ KVL++YA ++K ++ E+++ + +ACILMNNIQQ+RV LEK+FE+MGG+ LE D  + + +LQ  L+  +D LA  FA   E  I  +++EL  +L + I+  +      NL         E+  VLRPLMD  + +L+L A  CE+ VLKRLLKELW+I ++ LE+ I+LPP +    +F +++ +++   +  KI  M +   SH++ +      L    DISK+ + +LSP QC V+D+ LD IK YFHAGGNGLK ++LE+S ELQSLR+AL LY+Q TD LIK FISSQ  + D    E++VGE+SV+++LF HP TGEHK+   ++A   L WQ  S +FRPFV+I L+GP++  KKRK+ATKSKSN WSP+YNESFSF I + E  + +E+ ICVKDYCF R D+L+G  VI L  + E+GS   WL L R++  D  GWTILRILSQR  D++AKEFV+LKS+IRQ P
Sbjct: 1965 FYSNIDSMPDIRPRRKSIPLVSEL---TMAATKRN--AGLTSAVPRATLNDEDLKMHVYKKALQALIYPISSTTPHNFLLWTATSPTYCYECEGLLWGIARQGVRCTECGVKCHEKCKDLLNADCLQRAAEKSSKHGAEDKANSIITAMKDRMKQREREKPEIFELIRAVFSVEEKSHAGHMKAVKQSVLDGTSKWSAKIAITVICAQGLIAKDKSGTSDPYVTVQVSKVKKRTRTMPQELNPVWNEKFHFECHNSSDRIKVRVWDEDNDLKSKLRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLHISVEIKGEEKVAPYHVQYTCLHENLFHYLCEENTG-----MVKLPTQKGDDAWKLYFDEIPEEIVDEFSMRYGIENIYQAMTHFHCLSAKYLCPGVPAVMSTLLANINAYYAHTTASSAVSASDRFAASNFGKEKFVKLLDQLHNSLRIDLSMYRNNFPASSPEKLMDLKSTVDLLTSITFFRMKVQELSSPPRASTVVKDCVKACLRSTYQFLFENCYELYNREFQVDPNEAKRAPDDHEPKLDSVDFWHKLIALIVSVIDEDKNSYGTVLNQFPQELNIGQLSASSMWHLFAVDMKYALE-EHEQHRLCKSSAYMNLHFRVKWLYSNYVKEVPPYKGAVPDYPAWFEPFVMQWLNENDDVSLEYLHGAFKRDKKDGFQKSSEHALFSNSVVDVFTQLTQCFDVVSKLECPDPEIWKRYMRRFAKTIVKVLIAYADIVKLEFPEHMKDERIACILMNNIQQLRVQLEKMFESMGGDKLEEDAANILKELQQNLNSALDDLASQFAISLEPRITQSVRELGDMLLS-IKGGSGTLAAGNLAAQRNAVAVEADEVLRPLMDLLDGSLTLYAQSCEKTVLKRLLKELWKIVMRILEKTIVLPPMTDKTMMFKHLTDNAKNLASNAKIEDMGRLFKSHMAGKQDVKSALSGVMDISKEVEKNLSPKQCAVLDVALDTIKQYFHAGGNGLKKTFLEKSPELQSLRYALSLYTQMTDTLIKTFISSQVHEVDLENSEESVGEISVQIDLFSHPGTGEHKVNVKVVAANDLKWQIPSGMFRPFVDINLIGPHLQEKKRKFATKSKSNNWSPKYNESFSFTIGNEEQLDFFELHICVKDYCFARDDRLVGVAVIPLKDISEKGSVACWLPLMRRIEMDETGWTILRILSQRNNDEVAKEFVKLKSEIRQEP 3179          
BLAST of Protein unc-13 homolog B vs. Ensembl Fly
Match: unc-13 (gene:FBgn0025726 transcript:FBtr0308805)

HSP 1 Score: 1514.59 bits (3920), Expect = 0.000e+0
Identity = 729/1227 (59.41%), Postives = 935/1227 (76.20%), Query Frame = 2
Query: 2894 FYKSIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRD--QEPGDKIQNSDETGPK--NLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKLNLEQ-------ESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQ---AQNKILGMSQSLLSHVSNQVPNSKILK---DISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQ-DTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTS-VFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIRQSP 6517
            FY +IDS PDI+ R+KSI LVS+L   TM A KRN  A   S V R +LNDE+LKMHVYKK LQA+IYPISS TPH+F +  AT PT+CYECEGLLWG+ARQG+RC ECGVKCHEKCK+LLNADCLQRAAEKSSKHGAE K  +II +M D M+ R +  PEIF++I+  F V+ + H   L+    + ++GTSKWS K+ ITV CAQGLI KDK+GTSDPYVTVQV K KKRT+T+ QELNP W+EKF+FECHNSS+RIKVRVWDEDNDLKSK+RQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRL ISVEIKGEEKVAPYH+QYTCLHEN+FH+LCEENT      ++    +  ++ W++YFD   E+I++EF+MRYGIE+IYQAMTHF CL+ K++CPGVPAV+STLLANINAYYAHTT+++  SAS+RFAA+NFGKEKF+KLLDQLHNS++I+L +YRN F AS PE+L DLKSTVDLLTSITFFRMKVQELSSPPRA  VV++CV+AC+++TYQFLFE+  ELY+R+   +P +  +  D+  PK  +++FW KLI L+VSVI++DK  Y   LNQFPQE+N+ Q+S S+MW   +  ++ AL  E+ + +  K+S Y+NL FR+KW Y+ YV ++P  +  +P+YP WFEP+V+QWL END+VS  YL  A++RDKKDGFQKSSEHAL+SNSVVD+FTQL QCFDV+ KLECP+P I   +M+RF+ T+ KVL++YA ++K ++ E+++ + +ACILMNNIQQ+RV LEK+FE+MGG+ LE D  + + +LQ  L+  +D LA  FA   E  I  +++EL  +L + I+  +      NL         E+  VLRPLMD  + +L+L A  CE+ VLKRLLKELW+I ++ LE+ I+LPP +    +F +++ +++   +  KI  M +   SH++ +      L    DISK+ + +LSP QC V+D+ LD IK YFHAGGNGLK ++LE+S ELQSLR+AL LY+Q TD LIK FISSQ  + D    E++VGE+SV+++LF HP TGEHK+   ++A   L WQ  S +FRPFV+I L+GP++  KKRK+ATKSKSN WSP+YNESFSF I + E  + +E+ ICVKDYCF R D+L+G  VI L  + E+GS   WL L R++  D  GWTILRILSQR  D++AKEFV+LKS+IRQ P
Sbjct: 1653 FYSNIDSMPDIRPRRKSIPLVSEL---TMAATKRN--AGLTSAVPRATLNDEDLKMHVYKKALQALIYPISSTTPHNFLLWTATSPTYCYECEGLLWGIARQGVRCTECGVKCHEKCKDLLNADCLQRAAEKSSKHGAEDKANSIITAMKDRMKQREREKPEIFELIRMTFGVDPDTHIDSLEQAEHATVEGTSKWSCKLTITVICAQGLIAKDKSGTSDPYVTVQVSKVKKRTRTMPQELNPVWNEKFHFECHNSSDRIKVRVWDEDNDLKSKLRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLHISVEIKGEEKVAPYHVQYTCLHENLFHYLCEENTG-----MVKLPTQKGDDAWKLYFDEIPEEIVDEFSMRYGIENIYQAMTHFHCLSAKYLCPGVPAVMSTLLANINAYYAHTTASSAVSASDRFAASNFGKEKFVKLLDQLHNSLRIDLSMYRNNFPASSPEKLMDLKSTVDLLTSITFFRMKVQELSSPPRASTVVKDCVKACLRSTYQFLFENCYELYNREFQVDPNEAKRAPDDHEPKLDSVDFWHKLIALIVSVIDEDKNSYGTVLNQFPQELNIGQLSASSMWHLFAVDMKYALE-EHEQHRLCKSSAYMNLHFRVKWLYSNYVKEVPPYKGAVPDYPAWFEPFVMQWLNENDDVSLEYLHGAFKRDKKDGFQKSSEHALFSNSVVDVFTQLTQCFDVVSKLECPDPEIWKRYMRRFAKTIVKVLIAYADIVKLEFPEHMKDERIACILMNNIQQLRVQLEKMFESMGGDKLEEDAANILKELQQNLNSALDDLASQFAISLEPRITQSVRELGDMLLS-IKGGSGTLAAGNLAAQRNAVAVEADEVLRPLMDLLDGSLTLYAQSCEKTVLKRLLKELWKIVMRILEKTIVLPPMTDKTMMFKHLTDNAKNLASNAKIEDMGRLFKSHMAGKQDVKSALSGVMDISKEVEKNLSPKQCAVLDVALDTIKQYFHAGGNGLKKTFLEKSPELQSLRYALSLYTQMTDTLIKTFISSQVHEVDLENSEESVGEISVQIDLFSHPGTGEHKVNVKVVAANDLKWQIPSGMFRPFVDINLIGPHLQEKKRKFATKSKSNNWSPKYNESFSFTIGNEEQLDFFELHICVKDYCFARDDRLVGVAVIPLKDISEKGSVACWLPLMRRIEMDETGWTILRILSQRNNDEVAKEFVKLKSEIRQEP 2867          
BLAST of Protein unc-13 homolog B vs. Ensembl Zebrafish
Match: UNC13B (unc-13 homolog Bb (C. elegans) [Source:NCBI gene;Acc:100329499])

HSP 1 Score: 1494.17 bits (3867), Expect = 0.000e+0
Identity = 708/1212 (58.42%), Postives = 934/1212 (77.06%), Query Frame = 2
Query: 2903 SIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRDQEPGDKIQNSDETGP-------KNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKLNLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILP-PNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKDISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIRQS 6514
             IDS PD++ +KK+I LVSD+ L     Q R    A+A + +R S+ DEELK HVYKKTLQA+IYPIS  TPH+F+V  AT PT+CYECEGLLWG+ARQG+RC ECGVKCHEKC+ELLNADCLQRAAEKSSKHGAE +TQ II +M D M+ R +N PEIF++I+DVF V++  H   +K+I+QS+LDGTSKWSAKI ITV CAQGL  KDKTG+SDPYVTVQVGK KKRTKT+   LNP W+EKF+FECHNSS+RIKVRVWDED+D+KS+++Q+L RESDDFLGQ+IIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYH+QYTCLHEN+FH + +    QG  ++  A     ++ W++YFD   ++I++EFAMRYGIESIYQAMTHF+CL++K+MCPGVPAV+STLLANINAYYAHTT++TN SAS+RFAA+NFGKE+F+KLLDQLHNS++I+L +YRN F AS  +RL DLKSTVDLLTSITFFRMKVQEL SPPRA QVVR+CV+AC+ +TY ++F +  ELYSR Q P  +I ++D+  P       KNL+FW KLI L+VS+ E+D+  Y P LNQFPQE+N+ ++S   MW   S+ ++ A+  E+ + +  K++DY+NL F++KW YN YV DLP  + ++P YP WF+ +V+QWL EN++VS  ++  A ERDKKDGFQ++SEHAL+S SVVD+FTQLNQ F++IKKLECP+P + + + +RF+ T++KVLL Y++++KK +  Y  K+++ C+LMNN+QQ+RV LEK+FE+MG + L+T+  D +NDLQ +L++V+D L+ +F + F+  I++ ++++  LL+ QI+     N K  +E +S  +LRPLMD+ +ANL L ASVCE+ VLKR+LKELWRI +  LE+ IILP  N  F  IF        +  K LG    L  H+S +                SL+P QC VMD+ LD IK YFHAGGNGLK ++LE+S EL SLRHAL LY+QTTD LIK F++SQ +Q +  ++  VGEVS++++LF HP TGEHK+T  ++A   L WQT+ +FRPFVEI ++GP++ +KKRK+ TKSK+N+W+P++NE+F F++ + + PE YE+Q+CVKDYCFGRAD+++G  VIQL  +  + S   W  LG ++H D+ G T++RILSQR+GD++AKEFV+LKS  R +
Sbjct:  395 GIDSMPDLR-KKKAIPLVSDVSL----VQARKAGIASA-MASRSSIKDEELKNHVYKKTLQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKCHEKCQELLNADCLQRAAEKSSKHGAEDRTQNIIMAMKDRMKIRERNKPEIFEVIRDVFVVSKAIHAQQMKTIKQSVLDGTSKWSAKITITVFCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIYGNLNPVWEEKFHFECHNSSDRIKVRVWDEDDDIKSRVKQRLKRESDDFLGQSIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHVQYTCLHENLFHHITDV-LGQGVVKIPEARG---DDAWKVYFDDVPQEIVDEFAMRYGIESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSMYRNNFPASSKDRLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVRDCVKACLNSTYDYIFNNCQELYSR-QYP--QIGDTDDCSPEDQGPSIKNLDFWPKLITLIVSITEEDRNSYTPVLNQFPQELNVGKLSAEVMWSQFSQDMKYAME-EHEKHRLCKSADYMNLHFKVKWLYNEYVKDLPAFKGIVPEYPTWFQQFVLQWLDENEDVSMEFMHGALERDKKDGFQQTSEHALFSCSVVDVFTQLNQSFEIIKKLECPDPKVMALYSRRFAKTIDKVLLQYSAILKKSFPSYCDKEKIPCVLMNNVQQLRVQLEKMFESMGAKQLDTEASDLLNDLQVKLNNVLDELSSTFGNTFQSRIDDCMRQMASLLY-QIKGPVNTNNKNQVEADSDNMLRPLMDFLDANLMLFASVCEKTVLKRVLKELWRIVMNSLEKTIILPQGNDTFGMIF--------SAAKELGQLSKLKDHMSGEA--------------KSLTPKQCAVMDVALDTIKQYFHAGGNGLKKAFLEKSPELSSLRHALSLYTQTTDTLIKTFVTSQHAQGS-GVDKPVGEVSIQIDLFTHPGTGEHKVTVKVVAANDLKWQTSGMFRPFVEITMIGPHLSDKKRKFTTKSKNNSWAPKFNETFHFILGNEDGPECYELQVCVKDYCFGRADRVVGIAVIQLRDVAPRASCACWCPLGPRIHMDDTGLTVMRILSQRSGDEVAKEFVKLKSDTRSA 1568          
BLAST of Protein unc-13 homolog B vs. Ensembl Zebrafish
Match: unc13a (unc-13 homolog A (C. elegans) [Source:ZFIN;Acc:ZDB-GENE-140722-1])

HSP 1 Score: 1472.6 bits (3811), Expect = 0.000e+0
Identity = 701/1219 (57.51%), Postives = 933/1219 (76.54%), Query Frame = 2
Query: 2903 SIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNR-SASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRD--QEPGDKIQ-NSDETGP--KNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKL--NLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKDISKDTDH-------SLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIRQS 6514
            SIDS PD++ ++K+I LV DL L    ++K  + +A AS     +LN+EELK HVYKKTLQA+IYPIS  TPH+F+V  AT PT+CYECEGLLWG+ARQG+RC ECGVKCHEKC++LLNADCLQRAAEKSSKHGAE +TQ II  + D M+ R +N PEIF++I+DVF+V +  H   +K I+QS+LDGTSKWSAKI+ITV CAQGL  KDKTG+SDPYVTVQVGK KKRTKT+   LNP WDE F FECHNSS+RIKVRVWDED+D+KS+++QK  RESDDFLGQTIIEVRTLSGEMDVWYNL+KRTDKSAVSGAIR+ ISVEIKGEE VAPYH+QYTCLHEN+FH+L +   +     ++   +   ++ W++YF+   ++I++EFAMRYG+ESIYQAMTHF+CL++K+MCPGVPAV+STLLANINAYYAHTT  TN  SAS+RFAA+NFGKE+F+KLLDQLHNS++I+L +YRN F AS PERL DLKSTVDLLTSITFFRMKVQEL SPPRA QVV++CV+AC+ +TY+++F + +ELYSR+   +P  K +   +E GP  KNL+FW KLI L+VS+IE+DK  Y P LNQFPQE+N+ +IS   MW   ++ ++ A+  E+ +++  K++DY+NL F++KW YN Y  DLP  +  +P YP WFEP+VIQWL EN+EVS ++L  A ERDKKDG+Q++SEHAL+S SVVD+F+QLNQ F++IKKLECP+P I  H+MKRF+ T++ VLLSYA +I +D+  +  K++V CIL+NNIQQ+RV LEK+FEAMGG+ L  +  D + +LQ +L++V+D LA+ FA  F+  IE N+K++  +L +Q++ T         ++ Q++  VL+P+MD+ ++NL+L A +CE+ VLKR+LKELW++ +  +E+ I+LPP         + ++ S ++  +   S  L +        +K L  +SK  +H       +LSP QC V+++ LD IK YFHAGG GLK ++LE+S +LQSL +AL LY+Q TD LIK F+ SQ +Q T  ++D VGEVS+ VE+F HP+TGEHK+T  ++A   L WQT+ +FRPFVE+Y++GP++ +KKRKYATKSK+N+W+P+YNE+F+F +S+   PE YE+Q+CVKDYCF R D+ +G  V+QL  +  +GS   WL LG+++H D  G T+LRILSQR  DD+AKEFV+LKS  R +
Sbjct:  456 SIDSMPDLR-KRKAIPLVRDLSL-VQNSRKAGITSAMAS----STLNNEELKSHVYKKTLQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKCHEKCQDLLNADCLQRAAEKSSKHGAEDRTQNIIMVLKDRMKIRERNKPEIFELIQDVFAVIKATHVAQMKQIKQSVLDGTSKWSAKISITVLCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIYGNLNPVWDESFNFECHNSSDRIKVRVWDEDDDIKSRVKQKFKRESDDFLGQTIIEVRTLSGEMDVWYNLDKRTDKSAVSGAIRMHISVEIKGEETVAPYHVQYTCLHENLFHYLTDIQNNG----VVKIPDAKGDDAWKVYFEETPQEIVDEFAMRYGVESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTQATNNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSMYRNNFPASSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHELYSREYQTDPNKKGEVPPEEQGPSIKNLDFWSKLITLIVSIIEEDKNSYTPCLNQFPQELNVGKISAEVMWNLFAQDMKYAME-EHEKNRLCKSADYMNLHFKVKWLYNEYCKDLPFFKSRVPEYPTWFEPFVIQWLDENEEVSRDFLHGALERDKKDGYQQTSEHALFSCSVVDVFSQLNQSFEIIKKLECPDPQIVGHYMKRFAKTISNVLLSYADIISRDFPNHCTKEKVPCILINNIQQLRVQLEKMFEAMGGKDLNVEASDILKELQLKLNNVLDDLARIFATSFQPNIEENVKQMGDIL-SQVKGTGNVPASACSSVAQDADNVLQPIMDFLDSNLTLFAKICEKTVLKRVLKELWKLVMNTMEKTIVLPP-------LTDQTVMSCSEIYVHKFSLGLFTGTQLIFNAAKELGQLSKLKEHMVREEAKALSPKQCAVIELALDTIKQYFHAGGVGLKKTFLEKSPDLQSLHYALSLYTQATDKLIKTFVQSQNTQGT-GVDDAVGEVSIHVEIFTHPNTGEHKVTVKVVAANDLRWQTSGIFRPFVEVYIIGPHLSDKKRKYATKSKNNSWAPKYNETFTFTLSNEVGPECYELQVCVKDYCFAREDRTVGMAVLQLKDVAPRGSVACWLPLGKRIHMDETGLTVLRILSQRNNDDVAKEFVKLKSDQRSA 1654          
BLAST of Protein unc-13 homolog B vs. Ensembl Zebrafish
Match: unc13a (unc-13 homolog A (C. elegans) [Source:ZFIN;Acc:ZDB-GENE-140722-1])

HSP 1 Score: 1471.45 bits (3808), Expect = 0.000e+0
Identity = 701/1219 (57.51%), Postives = 933/1219 (76.54%), Query Frame = 2
Query: 2903 SIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNR-SASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRD--QEPGDKIQ-NSDETGP--KNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKL--NLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKDISKDTDH-------SLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIRQS 6514
            SIDS PD++ ++K+I LV DL L    ++K  + +A AS     +LN+EELK HVYKKTLQA+IYPIS  TPH+F+V  AT PT+CYECEGLLWG+ARQG+RC ECGVKCHEKC++LLNADCLQRAAEKSSKHGAE +TQ II  + D M+ R +N PEIF++I+DVF+V +  H   +K I+QS+LDGTSKWSAKI+ITV CAQGL  KDKTG+SDPYVTVQVGK KKRTKT+   LNP WDE F FECHNSS+RIKVRVWDED+D+KS+++QK  RESDDFLGQTIIEVRTLSGEMDVWYNL+KRTDKSAVSGAIR+ ISVEIKGEE VAPYH+QYTCLHEN+FH+L +   +     ++   +   ++ W++YF+   ++I++EFAMRYG+ESIYQAMTHF+CL++K+MCPGVPAV+STLLANINAYYAHTT  TN  SAS+RFAA+NFGKE+F+KLLDQLHNS++I+L +YRN F AS PERL DLKSTVDLLTSITFFRMKVQEL SPPRA QVV++CV+AC+ +TY+++F + +ELYSR+   +P  K +   +E GP  KNL+FW KLI L+VS+IE+DK  Y P LNQFPQE+N+ +IS   MW   ++ ++ A+  E+ +++  K++DY+NL F++KW YN Y  DLP  +  +P YP WFEP+VIQWL EN+EVS ++L  A ERDKKDG+Q++SEHAL+S SVVD+F+QLNQ F++IKKLECP+P I  H+MKRF+ T++ VLLSYA +I +D+  +  K++V CIL+NNIQQ+RV LEK+FEAMGG+ L  +  D + +LQ +L++V+D LA+ FA  F+  IE N+K++  +L +Q++ T         ++ Q++  VL+P+MD+ ++NL+L A +CE+ VLKR+LKELW++ +  +E+ I+LPP         + ++ S ++  +   S  L +        +K L  +SK  +H       +LSP QC V+++ LD IK YFHAGG GLK ++LE+S +LQSL +AL LY+Q TD LIK F+ SQ +Q T  ++D VGEVS+ VE+F HP+TGEHK+T  ++A   L WQT+ +FRPFVE+Y++GP++ +KKRKYATKSK+N+W+P+YNE+F+F +S+   PE YE+Q+CVKDYCF R D+ +G  V+QL  +  +GS   WL LG+++H D  G T+LRILSQR  DD+AKEFV+LKS  R +
Sbjct:  454 SIDSMPDLR-KRKAIPLVRDLSL-VQNSRKAGITSAMAS----STLNNEELKSHVYKKTLQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKCHEKCQDLLNADCLQRAAEKSSKHGAEDRTQNIIMVLKDRMKIRERNKPEIFELIQDVFAVIKATHVAQMKQIKQSVLDGTSKWSAKISITVLCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIYGNLNPVWDESFNFECHNSSDRIKVRVWDEDDDIKSRVKQKFKRESDDFLGQTIIEVRTLSGEMDVWYNLDKRTDKSAVSGAIRMHISVEIKGEETVAPYHVQYTCLHENLFHYLTDIQNNG----VVKIPDAKGDDAWKVYFEETPQEIVDEFAMRYGVESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTQATNNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSMYRNNFPASSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHELYSREYQTDPNKKGEVPPEEQGPSIKNLDFWSKLITLIVSIIEEDKNSYTPCLNQFPQELNVGKISAEVMWNLFAQDMKYAME-EHEKNRLCKSADYMNLHFKVKWLYNEYCKDLPFFKSRVPEYPTWFEPFVIQWLDENEEVSRDFLHGALERDKKDGYQQTSEHALFSCSVVDVFSQLNQSFEIIKKLECPDPQIVGHYMKRFAKTISNVLLSYADIISRDFPNHCTKEKVPCILINNIQQLRVQLEKMFEAMGGKDLNVEASDILKELQLKLNNVLDDLARIFATSFQPNIEENVKQMGDIL-SQVKGTGNVPASACSSVAQDADNVLQPIMDFLDSNLTLFAKICEKTVLKRVLKELWKLVMNTMEKTIVLPP-------LTDQTVMSCSEIYVHKFSLGLFTGTQLIFNAAKELGQLSKLKEHMVREEAKALSPKQCAVIELALDTIKQYFHAGGVGLKKTFLEKSPDLQSLHYALSLYTQATDKLIKTFVQSQNTQGT-GVDDAVGEVSIHVEIFTHPNTGEHKVTVKVVAANDLRWQTSGIFRPFVEVYIIGPHLSDKKRKYATKSKNNSWAPKYNETFTFTLSNEVGPECYELQVCVKDYCFAREDRTVGMAVLQLKDVAPRGSVACWLPLGKRIHMDETGLTVLRILSQRNNDDVAKEFVKLKSDQRSA 1652          
BLAST of Protein unc-13 homolog B vs. Ensembl Zebrafish
Match: unc13a (unc-13 homolog A (C. elegans) [Source:ZFIN;Acc:ZDB-GENE-140722-1])

HSP 1 Score: 1470.68 bits (3806), Expect = 0.000e+0
Identity = 701/1219 (57.51%), Postives = 936/1219 (76.78%), Query Frame = 2
Query: 2888 GGFYKSIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNR-SASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRD--QEPGDKIQ-NSDETGP--KNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVA--CILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKL--NLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKDISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIRQS 6514
            GG   SIDS PD++ ++K+I LV DL L    ++K  + +A AS     +LN+EELK HVYKKTLQA+IYPIS  TPH+F+V  AT PT+CYECEGLLWG+ARQG+RC ECGVKCHEKC++LLNADCLQRAAEKSSKHGAE +TQ II  + D M+ R +N PEIF++I+DVF+V +  H   +K I+QS+LDGTSKWSAKI+ITV CAQGL  KDKTG+SDPYVTVQVGK KKRTKT+   LNP WDE F FECHNSS+RIKVRVWDED+D+KS+++QK  RESDDFLGQTIIEVRTLSGEMDVWYNL+KRTDKSAVSGAIR+ ISVEIKGEE VAPYH+QYTCLHEN+FH+L +   +     ++   +   ++ W++YF+   ++I++EFAMRYG+ESIYQAMTHF+CL++K+MCPGVPAV+STLLANINAYYAHTT  TN  SAS+RFAA+NFGKE+F+KLLDQLHNS++I+L +YRN F AS PERL DLKSTVDLLTSITFFRMKVQEL SPPRA QVV++CV+AC+ +TY+++F + +ELYSR+   +P  K +   +E GP  KNL+FW KLI L+VS+IE+DK  Y P LNQFPQE+N+ +IS   MW   ++ ++ A+  E+ +++  K++DY+NL F++KW YN Y  DLP  +  +P YP WFEP+VIQWL EN+EVS ++L  A ERDKKDG+Q++SEHAL+S SVVD+F+QLNQ F++IKKLECP+P I  H+MKRF+ T++ VLLSYA +I +D+  +  K++V   CIL+NNIQQ+RV LEK+FEAMGG+ L  +  D + +LQ +L++V+D LA+ FA  F+  IE N+K++  +L +Q++ T         ++ Q++  VL+P+MD+ ++NL+L A +CE+ VLKR+LKELW++ +  +E+ I+LPP +  +   + ++  S     I   ++ L      Q+  SK+ + + ++   +LSP QC V+++ LD IK YFHAGG GLK ++LE+S +LQSL +AL LY+Q TD LIK F+ SQ +Q T  ++D VGEVS+ VE+F HP+TGEHK+T  ++A   L WQT+ +FRPFVE+Y++GP++ +KKRKYATKSK+N+W+P+YNE+F+F +S+   PE YE+Q+CVKDYCF R D+ +G  V+QL  +  +GS   WL LG+++H D  G T+LRILSQR  DD+AKEFV+LKS  R +
Sbjct:  540 GGALYSIDSMPDLR-KRKAIPLVRDLSL-VQNSRKAGITSAMAS----STLNNEELKSHVYKKTLQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKCHEKCQDLLNADCLQRAAEKSSKHGAEDRTQNIIMVLKDRMKIRERNKPEIFELIQDVFAVIKATHVAQMKQIKQSVLDGTSKWSAKISITVLCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIYGNLNPVWDESFNFECHNSSDRIKVRVWDEDDDIKSRVKQKFKRESDDFLGQTIIEVRTLSGEMDVWYNLDKRTDKSAVSGAIRMHISVEIKGEETVAPYHVQYTCLHENLFHYLTDIQNNG----VVKIPDAKGDDAWKVYFEETPQEIVDEFAMRYGVESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTQATNNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSMYRNNFPASSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHELYSREYQTDPNKKGEVPPEEQGPSIKNLDFWSKLITLIVSIIEEDKNSYTPCLNQFPQELNVGKISAEVMWNLFAQDMKYAME-EHEKNRLCKSADYMNLHFKVKWLYNEYCKDLPFFKSRVPEYPTWFEPFVIQWLDENEEVSRDFLHGALERDKKDGYQQTSEHALFSCSVVDVFSQLNQSFEIIKKLECPDPQIVGHYMKRFAKTISNVLLSYADIISRDFPNHCTKEKVVIPCILINNIQQLRVQLEKMFEAMGGKDLNVEASDILKELQLKLNNVLDDLARIFATSFQPNIEENVKQMGDIL-SQVKGTGNVPASACSSVAQDADNVLQPIMDFLDSNLTLFAKICEKTVLKRVLKELWKLVMNTMEKTIVLPPLTD-QTGRVKLACHSDGTQLIFNAAKEL-----GQL--SKLKEHMVREEAKALSPKQCAVIELALDTIKQYFHAGGVGLKKTFLEKSPDLQSLHYALSLYTQATDKLIKTFVQSQNTQGT-GVDDAVGEVSIHVEIFTHPNTGEHKVTVKVVAANDLRWQTSGIFRPFVEVYIIGPHLSDKKRKYATKSKNNSWAPKYNETFTFTLSNEVGPECYELQVCVKDYCFAREDRTVGMAVLQLKDVAPRGSVACWLPLGKRIHMDETGLTVLRILSQRNNDDVAKEFVKLKSDQRSA 1737          
BLAST of Protein unc-13 homolog B vs. Ensembl Zebrafish
Match: unc13a (unc-13 homolog A (C. elegans) [Source:ZFIN;Acc:ZDB-GENE-140722-1])

HSP 1 Score: 1464.9 bits (3791), Expect = 0.000e+0
Identity = 698/1232 (56.66%), Postives = 933/1232 (75.73%), Query Frame = 2
Query: 2888 GGFYKSIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNR-SASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRDQEPGDKIQNSDETGP--KNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKL--NLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKDISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQ-------------DTH-----AMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIRQS 6514
            GG   SIDS PD++ ++K+I LV DL L    ++K  + +A AS     +LN+EELK HVYKKTLQA+IYPIS  TPH+F+V  AT PT+CYECEGLLWG+ARQG+RC ECGVKCHEKC++LLNADCLQRAAEKSSKHGAE +TQ II  + D M+ R +N PEIF++I+DVF+V +  H   +K I+QS+LDGTSKWSAKI+ITV CAQGL  KDKTG+SDPYVTVQVGK KKRTKT+   LNP WDE F FECHNSS+RIKVRVWDED+D+KS+++QK  RESDDFLGQTIIEVRTLSGEMDVWYNL+KRTDKSAVSGAIR+ ISVEIKGEE VAPYH+QYTCLHEN+FH+L +   +     ++   +   ++ W++YF+   ++I++EFAMRYG+ESIYQAMTHF+CL++K+MCPGVPAV+STLLANINAYYAHTT  TN  SAS+RFAA+NFGKE+F+KLLDQLHNS++I+L +YRN F AS PERL DLKSTVDLLTSITFFRMKVQEL SPPRA QVV++CV+AC+ +TY+++F + +ELYSR+ +  D +   +E GP  KNL+FW KLI L+VS+IE+DK  Y P LNQFPQE+N+ +IS   MW   ++ ++ A+  E+ +++  K++DY+NL F++KW YN Y  DLP  +  +P YP WFEP+VIQWL EN+EVS ++L  A ERDKKDG+Q++SEHAL+S SVVD+F+QLNQ F++IKKLECP+P I  H+MKRF+ T++ VLLSYA +I +D+  +  K++V CIL+NNIQQ+RV LEK+FEAMGG+ L  +  D + +LQ +L++V+D LA+ FA  F+  IE N+K++  +L +Q++ T         ++ Q++  VL+P+MD+ ++NL+L A +CE+ VLKR+LKELW++ +  +E+ I+LPP            ++ Q   +++  +   L  +      SK+ + + ++   +LSP QC V+++ LD IK YFHAGG GLK ++LE+S +LQSL +AL LY+Q TD LIK F+ SQ +Q             D +      ++D VGEVS+ VE+F HP+TGEHK+T  ++A   L WQT+ +FRPFVE+Y++GP++ +KKRKYATKSK+N+W+P+YNE+F+F +S+   PE YE+Q+CVKDYCF R D+ +G  V+QL  +  +GS   WL LG+++H D  G T+LRILSQR  DD+AKEFV+LKS  R +
Sbjct:  384 GGALYSIDSMPDLR-KRKAIPLVRDLSL-VQNSRKAGITSAMAS----STLNNEELKSHVYKKTLQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKCHEKCQDLLNADCLQRAAEKSSKHGAEDRTQNIIMVLKDRMKIRERNKPEIFELIQDVFAVIKATHVAQMKQIKQSVLDGTSKWSAKISITVLCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIYGNLNPVWDESFNFECHNSSDRIKVRVWDEDDDIKSRVKQKFKRESDDFLGQTIIEVRTLSGEMDVWYNLDKRTDKSAVSGAIRMHISVEIKGEETVAPYHVQYTCLHENLFHYLTDIQNNG----VVKIPDAKGDDAWKVYFEETPQEIVDEFAMRYGVESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTQATNNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSMYRNNFPASSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHELYSREYQ-TDPVP-PEEQGPSIKNLDFWSKLITLIVSIIEEDKNSYTPCLNQFPQELNVGKISAEVMWNLFAQDMKYAME-EHEKNRLCKSADYMNLHFKVKWLYNEYCKDLPFFKSRVPEYPTWFEPFVIQWLDENEEVSRDFLHGALERDKKDGYQQTSEHALFSCSVVDVFSQLNQSFEIIKKLECPDPQIVGHYMKRFAKTISNVLLSYADIISRDFPNHCTKEKVPCILINNIQQLRVQLEKMFEAMGGKDLNVEASDILKELQLKLNNVLDDLARIFATSFQPNIEENVKQMGDIL-SQVKGTGNVPASACSSVAQDADNVLQPIMDFLDSNLTLFAKICEKTVLKRVLKELWKLVMNTMEKTIVLPP------------LTDQTGTQLIFNAAKELGQL------SKLKEHMVREEAKALSPKQCAVIELALDTIKQYFHAGGVGLKKTFLEKSPDLQSLHYALSLYTQATDKLIKTFVQSQNTQVHGGKGVRFTQSEDVYPEKGTGVDDAVGEVSIHVEIFTHPNTGEHKVTVKVVAANDLRWQTSGIFRPFVEVYIIGPHLSDKKRKYATKSKNNSWAPKYNETFTFTLSNEVGPECYELQVCVKDYCFAREDRTVGMAVLQLKDVAPRGSVACWLPLGKRIHMDETGLTVLRILSQRNNDDVAKEFVKLKSDQRSA 1583          
BLAST of Protein unc-13 homolog B vs. Ensembl Xenopus
Match: ctcf (CCCTC-binding factor [Source:Xenbase;Acc:XB-GENE-862914])

HSP 1 Score: 1470.68 bits (3806), Expect = 0.000e+0
Identity = 735/1363 (53.93%), Postives = 992/1363 (72.78%), Query Frame = 2
Query: 2480 EVEYLDPYSNNQLSRKFDSDNDDISEKYYRRGRGSIVEFIQERSSITSPVPMDSENMDIIVMSAEEMKRQEEEEIVNSKDTETPKESNKPENKISNEIRKLPGPKFAK-----IVQKHFIHIDTDMTDGTRRHEDGL---DHDYGGFYKSIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRD--QEPGDKIQ-NSDETGP--KNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYL---QKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKLN---LEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKD-ISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIR 6508
            E EY  P S  QLS +   D+D + E+  ++GR   + + QE S   S    + E +DI +    E  R  E           P+E  +P     +   + PG   AK        K  + +     +GT      L   D   GG    IDS PDI+ ++K I LVSDL L  + ++K  + +A A+     +LN+EELK HVYKKTLQA+IYPISS TPH+F+V  AT PT+CYECEGLLWG+ARQG+RC ECGVKCHEKC++LLNADCLQRAAEKSSKHGAE +TQ II  + D M+ R +N PEIF++I++VF V +  H   +K+++QS+LDGTSKWSAKI+ITV CAQGL  KDKTG+SDPYVTVQVGK KKRTKT+   LNP W+E F+FECHNSS+RIKVRVWDED+D+KS+++Q+  RESDDFLGQTIIEVRTLSGEMDVWYNL+KRTDKSAVSGAIRL ISVEIKGEEKVAPYH+QYTCLHEN+FH+L +   +     ++   +   ++ W++YFD  +++I++EFAMRYG+ESIYQAMTHF+CL++K+MCPGVPAV+STLLANINAYYAHTT++TN SAS+RF+A+NFGKE+F+KLLDQLHNS++I+L +YRN F AS PERL DLKSTVDLLTSITFFRMKVQEL SPPRA QVV++CV+AC+ +TY+++F + +ELYSR+   +P  K +   +E GP  KNL+FW KLI L+VS+IE+DK  Y P LNQFPQE+N+ +IS   MW   ++ +  A+  E+ + +  K++DY+NL F++KW YN YV +LP  +  +P YP WFEP+VIQWL EN+EVS ++L  A ERDKKDGFQ++SEHAL+S SVVD+F+QLNQ F++IKKLECP+P I  H+M+RF+ T++ VLL YA +I KD+  +    +K+E  CILMNNIQQ+RV LEK+FEAMGG+ L+ +T D + +LQ +L++V+D L++ F   F+ +IE  +K++  +L +Q++ T    P  N   + Q++  VL+P++D  ++NL+L A +CE+ VLKR+LKELW++ +  +E+ I+LPP +   Q    +    +   K+ G    L+ + + ++     LKD + ++   SL+P QC V+++ LD IK YFHAGG GLK ++LE+S +LQSLR+AL LY+Q TD LIK F+ +Q +Q +  ++D+VGEVS+ VELF HP TGEHKI+  ++A   L WQT+ +FRPF+E+ ++GPN+ +KKRK+ TKSK+N+W+P+YNESF F + +   PE+YE+Q+CVKDYCF R D+ +G  V+QL  L ++GS   WL LGR++H D  G TILRILSQR  D++AKEFV+LKS  R
Sbjct:  314 EEEY--PDSRGQLSDQELYDDDQLEEEE-KKGR---LAYGQEDSIYQSLEAEEKEPLDIPL----EKDRTPEA---------VPEEVVEPTVPAVHYREEEPGMSRAKSNWLRAFNKVRLQLQEARGEGTGEMSKSLWFKDGPAGGLI-IIDSMPDIR-KRKPIPLVSDLSL--VQSRKAGITSALAT----STLNNEELKNHVYKKTLQALIYPISSTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKCHEKCQDLLNADCLQRAAEKSSKHGAEDRTQNIIMVLKDRMKIRERNKPEIFELIQEVFGVLKATHAQQIKAVKQSVLDGTSKWSAKISITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIYGNLNPVWEENFHFECHNSSDRIKVRVWDEDDDIKSRVKQRFKRESDDFLGQTIIEVRTLSGEMDVWYNLDKRTDKSAVSGAIRLHISVEIKGEEKVAPYHVQYTCLHENLFHYLTDVQNNG----VVKIPDAKGDDAWKVYFDETAQEIVDEFAMRYGVESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTASTNVSASDRFSASNFGKERFVKLLDQLHNSLRIDLSMYRNNFPASSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHELYSREYQSDPAKKGEVPPEEQGPSIKNLDFWSKLITLIVSIIEEDKNSYTPCLNQFPQELNVGKISAEVMWSLFAQDMRYAME-EHDKHRLCKSADYMNLHFKVKWLYNEYVTELPSFKSKVPEYPAWFEPFVIQWLDENEEVSRDFLHGALERDKKDGFQQTSEHALFSCSVVDVFSQLNQSFEIIKKLECPDPQIVGHYMRRFAKTISNVLLQYAEIISKDFASHCSKEKKEEKPCILMNNIQQLRVQLEKMFEAMGGKELDAETSDILKELQVKLNNVLDELSRVFTTSFQAQIEECVKQMGDIL-SQVKGTGNV-PASNCSSVAQDADNVLQPILDPLDSNLTLFAKICEKTVLKRVLKELWKLVMNTMEKTIVLPPLTD--QTGTLLRKHGKGIEKVNGT--HLIINAAKELGQLSKLKDHMVREEAKSLTPKQCAVVELALDTIKQYFHAGGVGLKKTFLEKSPDLQSLRYALSLYTQATDTLIKTFVQTQSAQGS-GVDDSVGEVSIHVELFTHPGTGEHKISVKVVAANDLKWQTSGIFRPFIEVNMIGPNLSDKKRKFTTKSKNNSWAPKYNESFQFTLGNETGPESYELQVCVKDYCFAREDRTVGMAVMQLRDLAQRGSCACWLPLGRRIHMDETGLTILRILSQRNNDEVAKEFVKLKSDTR 1637          
BLAST of Protein unc-13 homolog B vs. Ensembl Xenopus
Match: ctcf (CCCTC-binding factor [Source:Xenbase;Acc:XB-GENE-862914])

HSP 1 Score: 1470.29 bits (3805), Expect = 0.000e+0
Identity = 700/1224 (57.19%), Postives = 934/1224 (76.31%), Query Frame = 2
Query: 2861 HEDGLDHDYGGFYKSIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRDQEPGDKIQNSDETGP--KNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYL---QKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKLN---LEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKDISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIR 6508
             ED +    GG    IDS PDI+ ++K I LVSDL L  + ++K  + +A A+     +LN+EELK HVYKKTLQA+IYPISS TPH+F+V  AT PT+CYECEGLLWG+ARQG+RC ECGVKCHEKC++LLNADCLQRAAEKSSKHGAE +TQ II  + D M+ R +N PEIF++I++VF V +  H   +K+++QS+LDGTSKWSAKI+ITV CAQGL  KDKTG+SDPYVTVQVGK KKRTKT+   LNP W+E F+FECHNSS+RIKVRVWDED+D+KS+++Q+  RESDDFLGQTIIEVRTLSGEMDVWYNL+KRTDKSAVSGAIRL ISVEIKGEEKVAPYH+QYTCLHEN+FH+L +   +     ++   +   ++ W++YFD  +++I++EFAMRYG+ESIYQAMTHF+CL++K+MCPGVPAV+STLLANINAYYAHTT++TN SAS+RF+A+NFGKE+F+KLLDQLHNS++I+L +YRN F AS PERL DLKSTVDLLTSITFFRMKVQEL SPPRA QVV++CV+AC+ +TY+++F + +ELYSR+ +   +    +E GP  KNL+FW KLI L+VS+IE+DK  Y P LNQFPQE+N+ +IS   MW   ++ +  A+  E+ + +  K++DY+NL F++KW YN YV +LP  +  +P YP WFEP+VIQWL EN+EVS ++L  A ERDKKDGFQ++SEHAL+S SVVD+F+QLNQ F++IKKLECP+P I  H+M+RF+ T++ VLL YA +I KD+  +    +K+E  CILMNNIQQ+RV LEK+FEAMGG+ L+ +T D + +LQ +L++V+D L++ F   F+ +IE  +K++  +L +Q++ T    P  N   + Q++  VL+P++D  ++NL+L A +CE+ VLKR+LKELW++ +  +E+ I+LPP +      L I+ +     K LG    L  H             + ++   SL+P QC V+++ LD IK YFHAGG GLK ++LE+S +LQSLR+AL LY+Q TD LIK F+ +Q +Q +  ++D+VGEVS+ VELF HP TGEHKI+  ++A   L WQT+ +FRPF+E+ ++GPN+ +KKRK+ TKSK+N+W+P+YNESF F + +   PE+YE+Q+CVKDYCF R D+ +G  V+QL  L ++GS   WL LGR++H D  G TILRILSQR  D++AKEFV+LKS  R
Sbjct:  344 QEDSIYQPAGGLI-IIDSMPDIR-KRKPIPLVSDLSL--VQSRKAGITSALAT----STLNNEELKNHVYKKTLQALIYPISSTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKCHEKCQDLLNADCLQRAAEKSSKHGAEDRTQNIIMVLKDRMKIRERNKPEIFELIQEVFGVLKATHAQQIKAVKQSVLDGTSKWSAKISITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIYGNLNPVWEENFHFECHNSSDRIKVRVWDEDDDIKSRVKQRFKRESDDFLGQTIIEVRTLSGEMDVWYNLDKRTDKSAVSGAIRLHISVEIKGEEKVAPYHVQYTCLHENLFHYLTDVQNNG----VVKIPDAKGDDAWKVYFDETAQEIVDEFAMRYGVESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTASTNVSASDRFSASNFGKERFVKLLDQLHNSLRIDLSMYRNNFPASSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHELYSREYQ---REVPPEEQGPSIKNLDFWSKLITLIVSIIEEDKNSYTPCLNQFPQELNVGKISAEVMWSLFAQDMRYAME-EHDKHRLCKSADYMNLHFKVKWLYNEYVTELPSFKSKVPEYPAWFEPFVIQWLDENEEVSRDFLHGALERDKKDGFQQTSEHALFSCSVVDVFSQLNQSFEIIKKLECPDPQIVGHYMRRFAKTISNVLLQYAEIISKDFASHCSKEKKEEKPCILMNNIQQLRVQLEKMFEAMGGKELDAETSDILKELQVKLNNVLDELSRVFTTSFQAQIEECVKQMGDIL-SQVKGTGNV-PASNCSSVAQDADNVLQPILDPLDSNLTLFAKICEKTVLKRVLKELWKLVMNTMEKTIVLPPLTDQTGTHLIINAA-----KELGQLSKLKDH-------------MVREEAKSLTPKQCAVVELALDTIKQYFHAGGVGLKKTFLEKSPDLQSLRYALSLYTQATDTLIKTFVQTQSAQGS-GVDDSVGEVSIHVELFTHPGTGEHKISVKVVAANDLKWQTSGIFRPFIEVNMIGPNLSDKKRKFTTKSKNNSWAPKYNESFQFTLGNETGPESYELQVCVKDYCFAREDRTVGMAVMQLRDLAQRGSCACWLPLGRRIHMDETGLTILRILSQRNNDEVAKEFVKLKSDTR 1530          
BLAST of Protein unc-13 homolog B vs. Ensembl Xenopus
Match: ctcf (CCCTC-binding factor [Source:Xenbase;Acc:XB-GENE-862914])

HSP 1 Score: 1464.13 bits (3789), Expect = 0.000e+0
Identity = 736/1385 (53.14%), Postives = 999/1385 (72.13%), Query Frame = 2
Query: 2480 EVEYLDPYSNNQLSRKFDSDNDDISEKYYRRGRGSIVEFIQERSSITSPVPMDSENMDIIVMSAEEMKRQEEEEIVNSK--DTETPKESNK-PENKISNEIRKLPGPKFAK-----IVQKHFIHIDTDMTDGTRRHEDGL---DHDYGGFYKSIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRD--QEPGDKIQ-NSDETGP--KNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYL---QKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKLN---LEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQS-LLSHVSNQVPNSKILKD-ISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQ------------------DTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIR 6508
            E EY  P S  QLS +   D+D + E+  ++GR   + + QE S   S    + E +DI  +  +       EE+V       ++P+ +++   N I    ++ PG   AK        K  + +     +GT      L   D   GG    IDS PDI+ ++K I LVSDL L  + ++K  + +A A+     +LN+EELK HVYKKTLQA+IYPISS TPH+F+V  AT PT+CYECEGLLWG+ARQG+RC ECGVKCHEKC++LLNADCLQRAAEKSSKHGAE +TQ II  + D M+ R +N PEIF++I++VF V +  H   +K+++QS+LDGTSKWSAKI+ITV CAQGL  KDKTG+SDPYVTVQVGK KKRTKT+   LNP W+E F+FECHNSS+RIKVRVWDED+D+KS+++Q+  RESDDFLGQTIIEVRTLSGEMDVWYNL+KRTDKSAVSGAIRL ISVEIKGEEKVAPYH+QYTCLHEN+FH+L +   +     ++   +   ++ W++YFD  +++I++EFAMRYG+ESIYQAMTHF+CL++K+MCPGVPAV+STLLANINAYYAHTT++TN SAS+RF+A+NFGKE+F+KLLDQLHNS++I+L +YRN F AS PERL DLKSTVDLLTSITFFRMKVQEL SPPRA QVV++CV+AC+ +TY+++F + +ELYSR+   +P  K +   +E GP  KNL+FW KLI L+VS+IE+DK  Y P LNQFPQE+N+ +IS   MW   ++ +  A+  E+ + +  K++DY+NL F++KW YN YV +LP  +  +P YP WFEP+VIQWL EN+EVS ++L  A ERDKKDGFQ++SEHAL+S SVVD+F+QLNQ F++IKKLECP+P I  H+M+RF+ T++ VLL YA +I KD+  +    +K+E  CILMNNIQQ+RV LEK+FEAMGG+ L+ +T D + +LQ +L++V+D L++ F   F+ +IE  +K++  +L +Q++ T    P  N   + Q++  VL+P++D  ++NL+L A +CE+ VLKR+LKELW++ +  +E+ I+LPP +        +SI        LG++ + L+ + + ++     LKD + ++   SL+P QC V+++ LD IK YFHAGG GLK ++LE+S +LQSLR+AL LY+Q TD LIK F+ +Q +Q                      ++D+VGEVS+ VELF HP TGEHKI+  ++A   L WQT+ +FRPF+E+ ++GPN+ +KKRK+ TKSK+N+W+P+YNESF F + +   PE+YE+Q+CVKDYCF R D+ +G  V+QL  L ++GS   WL LGR++H D  G TILRILSQR  D++AKEFV+LKS  R
Sbjct:  314 EEEY--PDSRGQLSDQELYDDDQLEEEE-KKGR---LAYGQEDSIYQSLEAEEKEPLDI-PLEKDRTPEAVPEEVVEPTVPAVQSPQAADRWVSNIILMSRKEEPGMSRAKSNWLRAFNKVRLQLQEARGEGTGEMSKSLWFKDGPAGGLI-IIDSMPDIR-KRKPIPLVSDLSL--VQSRKAGITSALAT----STLNNEELKNHVYKKTLQALIYPISSTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKCHEKCQDLLNADCLQRAAEKSSKHGAEDRTQNIIMVLKDRMKIRERNKPEIFELIQEVFGVLKATHAQQIKAVKQSVLDGTSKWSAKISITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIYGNLNPVWEENFHFECHNSSDRIKVRVWDEDDDIKSRVKQRFKRESDDFLGQTIIEVRTLSGEMDVWYNLDKRTDKSAVSGAIRLHISVEIKGEEKVAPYHVQYTCLHENLFHYLTDVQNNG----VVKIPDAKGDDAWKVYFDETAQEIVDEFAMRYGVESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTASTNVSASDRFSASNFGKERFVKLLDQLHNSLRIDLSMYRNNFPASSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHELYSREYQSDPAKKGEVPPEEQGPSIKNLDFWSKLITLIVSIIEEDKNSYTPCLNQFPQELNVGKISAEVMWSLFAQDMRYAME-EHDKHRLCKSADYMNLHFKVKWLYNEYVTELPSFKSKVPEYPAWFEPFVIQWLDENEEVSRDFLHGALERDKKDGFQQTSEHALFSCSVVDVFSQLNQSFEIIKKLECPDPQIVGHYMRRFAKTISNVLLQYAEIISKDFASHCSKEKKEEKPCILMNNIQQLRVQLEKMFEAMGGKELDAETSDILKELQVKLNNVLDELSRVFTTSFQAQIEECVKQMGDIL-SQVKGTGNV-PASNCSSVAQDADNVLQPILDPLDSNLTLFAKICEKTVLKRVLKELWKLVMNTMEKTIVLPPLTD-----QTVSIMC----TFLGIAGTHLIINAAKELGQLSKLKDHMVREEAKSLTPKQCAVVELALDTIKQYFHAGGVGLKKTFLEKSPDLQSLRYALSLYTQATDTLIKTFVQTQSAQVHGGKGIRFTLNEETYPEKGSGVDDSVGEVSIHVELFTHPGTGEHKISVKVVAANDLKWQTSGIFRPFIEVNMIGPNLSDKKRKFTTKSKNNSWAPKYNESFQFTLGNETGPESYELQVCVKDYCFAREDRTVGMAVMQLRDLAQRGSCACWLPLGRRIHMDETGLTILRILSQRNNDEVAKEFVKLKSDTR 1667          
BLAST of Protein unc-13 homolog B vs. Ensembl Xenopus
Match: ctcf (CCCTC-binding factor [Source:Xenbase;Acc:XB-GENE-862914])

HSP 1 Score: 1448.72 bits (3749), Expect = 0.000e+0
Identity = 700/1243 (56.32%), Postives = 931/1243 (74.90%), Query Frame = 2
Query: 2861 HEDGLDHDYGGFYKSIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHE-NIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRDQEPGDKIQNSDETGP--KNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYL---QKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKLN---LEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKDISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQ-------------DTH-----AMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIR 6508
             ED +    GG    IDS PDI+ ++K I LVSDL L  + ++K  + +A A+     +LN+EELK HVYKKTLQA+IYPISS TPH+F+V  AT PT+CYECEGLLWG+ARQG+RC ECGVKCHEKC++LLNADCLQRAAEKSSKHGAE +TQ II  + D M+ R +N PEIF++I++VF V +  H   +K+++QS+LDGTSKWSAKI+ITV CAQGL  KDKTG+SDPYVTVQVGK KKRTKT+   LNP W+E F+FECHNSS+RIKVRVWDED+D+KS+++Q+  RESDDFLGQTIIEVRTLSGEMDVWYNL+KRTDKSAVSGAIRL ISVEIKGEEKVAPYH+QYTCLHE N+F +            L    +   ++ W++YFD  +++I++EFAMRYG+ESIYQAMTHF+CL++K+MCPGVPAV+STLLANINAYYAHTT++TN SAS+RF+A+NFGKE+F+KLLDQLHNS++I+L +YRN F AS PERL DLKSTVDLLTSITFFRMKVQEL SPPRA QVV++CV+AC+ +TY+++F + +ELYSR+ +   +    +E GP  KNL+FW KLI L+VS+IE+DK  Y P LNQFPQE+N+ +IS   MW   ++ +  A+  E+ + +  K++DY+NL F++KW YN YV +LP  +  +P YP WFEP+VIQWL EN+EVS ++L  A ERDKKDGFQ++SEHAL+S SVVD+F+QLNQ F++IKKLECP+P I  H+M+RF+ T++ VLL YA +I KD+  +    +K+E  CILMNNIQQ+RV LEK+FEAMGG+ L+ +T D + +LQ +L++V+D L++ F   F+ +IE  +K++  +L +Q++ T    P  N   + Q++  VL+P++D  ++NL+L A +CE+ VLKR+LKELW++ +  +E+ I+LPP +      L I+ +     K LG    L  H             + ++   SL+P QC V+++ LD IK YFHAGG GLK ++LE+S +LQSLR+AL LY+Q TD LIK F+ +Q +Q             +T+      ++D+VGEVS+ VELF HP TGEHKI+  ++A   L WQT+ +FRPF+E+ ++GPN+ +KKRK+ TKSK+N+W+P+YNESF F + +   PE+YE+Q+CVKDYCF R D+ +G  V+QL  L ++GS   WL LGR++H D  G TILRILSQR  D++AKEFV+LKS  R
Sbjct:  362 QEDSIYQPAGGLI-IIDSMPDIR-KRKPIPLVSDLSL--VQSRKAGITSALAT----STLNNEELKNHVYKKTLQALIYPISSTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKCHEKCQDLLNADCLQRAAEKSSKHGAEDRTQNIIMVLKDRMKIRERNKPEIFELIQEVFGVLKATHAQQIKAVKQSVLDGTSKWSAKISITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIYGNLNPVWEENFHFECHNSSDRIKVRVWDEDDDIKSRVKQRFKRESDDFLGQTIIEVRTLSGEMDVWYNLDKRTDKSAVSGAIRLHISVEIKGEEKVAPYHVQYTCLHEVNLFLYT-----------LKVIPDAKGDDAWKVYFDETAQEIVDEFAMRYGVESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTASTNVSASDRFSASNFGKERFVKLLDQLHNSLRIDLSMYRNNFPASSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHELYSREYQ---REVPPEEQGPSIKNLDFWSKLITLIVSIIEEDKNSYTPCLNQFPQELNVGKISAEVMWSLFAQDMRYAME-EHDKHRLCKSADYMNLHFKVKWLYNEYVTELPSFKSKVPEYPAWFEPFVIQWLDENEEVSRDFLHGALERDKKDGFQQTSEHALFSCSVVDVFSQLNQSFEIIKKLECPDPQIVGHYMRRFAKTISNVLLQYAEIISKDFASHCSKEKKEEKPCILMNNIQQLRVQLEKMFEAMGGKELDAETSDILKELQVKLNNVLDELSRVFTTSFQAQIEECVKQMGDIL-SQVKGTGNV-PASNCSSVAQDADNVLQPILDPLDSNLTLFAKICEKTVLKRVLKELWKLVMNTMEKTIVLPPLTDQTGTHLIINAA-----KELGQLSKLKDH-------------MVREEAKSLTPKQCAVVELALDTIKQYFHAGGVGLKKTFLEKSPDLQSLRYALSLYTQATDTLIKTFVQTQSAQVHGGKGIRFTLNEETYPEKGSGVDDSVGEVSIHVELFTHPGTGEHKISVKVVAANDLKWQTSGIFRPFIEVNMIGPNLSDKKRKFTTKSKNNSWAPKYNESFQFTLGNETGPESYELQVCVKDYCFAREDRTVGMAVMQLRDLAQRGSCACWLPLGRRIHMDETGLTILRILSQRNNDEVAKEFVKLKSDTR 1561          
BLAST of Protein unc-13 homolog B vs. Ensembl Xenopus
Match: ctcf (CCCTC-binding factor [Source:Xenbase;Acc:XB-GENE-862914])

HSP 1 Score: 1446.03 bits (3742), Expect = 0.000e+0
Identity = 681/1194 (57.04%), Postives = 908/1194 (76.05%), Query Frame = 2
Query: 3005 AANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRDQEPGDKIQNSDETGP--KNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYL---QKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKLN---LEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKDISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQ-------------DTH-----AMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIR 6508
            A   S +   +LN+EELK HVYKKTLQA+IYPISS TPH+F+V  AT PT+CYECEGLLWG+ARQG+RC ECGVKCHEKC++LLNADCLQRAAEKSSKHGAE +TQ II  + D M+ R +N PEIF++I++VF V +  H   +K+++QS+LDGTSKWSAKI+ITV CAQGL  KDKTG+SDPYVTVQVGK KKRTKT+   LNP W+E F+FECHNSS+RIKVRVWDED+D+KS+++Q+  RESDDFLGQTIIEVRTLSGEMDVWYNL+KRTDKSAVSGAIRL ISVEIKGEEKVAPYH+QYTCLHEN+FH+L +   +     ++   +   ++ W++YFD  +++I++EFAMRYG+ESIYQAMTHF+CL++K+MCPGVPAV+STLLANINAYYAHTT++TN SAS+RF+A+NFGKE+F+KLLDQLHNS++I+L +YRN F AS PERL DLKSTVDLLTSITFFRMKVQEL SPPRA QVV++CV+AC+ +TY+++F + +ELYSR+ +   +    +E GP  KNL+FW KLI L+VS+IE+DK  Y P LNQFPQE+N+ +IS   MW   ++ +  A+  E+ + +  K++DY+NL F++KW YN YV +LP  +  +P YP WFEP+VIQWL EN+EVS ++L  A ERDKKDGFQ++SEHAL+S SVVD+F+QLNQ F++IKKLECP+P I  H+M+RF+ T++ VLL YA +I KD+  +    +K+E  CILMNNIQQ+RV LEK+FEAMGG+ L+ +T D + +LQ +L++V+D L++ F   F+ +IE  +K++  +L +Q++ T    P  N   + Q++  VL+P++D  ++NL+L A +CE+ VLKR+LKELW++ +  +E+ I+LPP +      L I+ + +     LG    L  H             + ++   SL+P QC V+++ LD IK YFHAGG GLK ++LE+S +LQSLR+AL LY+Q TD LIK F+ +Q +Q             +T+      ++D+VGEVS+ VELF HP TGEHKI+  ++A   L WQT+ +FRPF+E+ ++GPN+ +KKRK+ TKSK+N+W+P+YNESF F + +   PE+YE+Q+CVKDYCF R D+ +G  V+QL  L ++GS   WL LGR++H D  G TILRILSQR  D++AKEFV+LKS  R
Sbjct:   20 AGITSALATSTLNNEELKNHVYKKTLQALIYPISSTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKCHEKCQDLLNADCLQRAAEKSSKHGAEDRTQNIIMVLKDRMKIRERNKPEIFELIQEVFGVLKATHAQQIKAVKQSVLDGTSKWSAKISITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIYGNLNPVWEENFHFECHNSSDRIKVRVWDEDDDIKSRVKQRFKRESDDFLGQTIIEVRTLSGEMDVWYNLDKRTDKSAVSGAIRLHISVEIKGEEKVAPYHVQYTCLHENLFHYLTDVQNNG----VVKIPDAKGDDAWKVYFDETAQEIVDEFAMRYGVESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTASTNVSASDRFSASNFGKERFVKLLDQLHNSLRIDLSMYRNNFPASSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHELYSREYQ---REVPPEEQGPSIKNLDFWSKLITLIVSIIEEDKNSYTPCLNQFPQELNVGKISAEVMWSLFAQDMRYAME-EHDKHRLCKSADYMNLHFKVKWLYNEYVTELPSFKSKVPEYPAWFEPFVIQWLDENEEVSRDFLHGALERDKKDGFQQTSEHALFSCSVVDVFSQLNQSFEIIKKLECPDPQIVGHYMRRFAKTISNVLLQYAEIISKDFASHCSKEKKEEKPCILMNNIQQLRVQLEKMFEAMGGKELDAETSDILKELQVKLNNVLDELSRVFTTSFQAQIEECVKQMGDIL-SQVKGTGNV-PASNCSSVAQDADNVLQPILDPLDSNLTLFAKICEKTVLKRVLKELWKLVMNTMEKTIVLPPLTDQTGTHLIINAAKE-----LGQLSKLKDH-------------MVREEAKSLTPKQCAVVELALDTIKQYFHAGGVGLKKTFLEKSPDLQSLRYALSLYTQATDTLIKTFVQTQSAQVHGGKGIRFTLNEETYPEKGSGVDDSVGEVSIHVELFTHPGTGEHKISVKVVAANDLKWQTSGIFRPFIEVNMIGPNLSDKKRKFTTKSKNNSWAPKYNESFQFTLGNETGPESYELQVCVKDYCFAREDRTVGMAVMQLRDLAQRGSCACWLPLGRRIHMDETGLTILRILSQRNNDEVAKEFVKLKSDTR 1185          
BLAST of Protein unc-13 homolog B vs. Ensembl Mouse
Match: Unc13b (unc-13 homolog B [Source:MGI Symbol;Acc:MGI:1342278])

HSP 1 Score: 1511.51 bits (3912), Expect = 0.000e+0
Identity = 705/1213 (58.12%), Postives = 938/1213 (77.33%), Query Frame = 2
Query: 2888 GGFYKSIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRDQEPGDKIQNSDETGP--KNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNP--KLNLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKDISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIRQS 6514
            GG Y  IDS PD++ RKK + LVSDL L  + ++K  + +A   + TR SL DEELK HVYKKTLQA+IYPIS  TPH+F+V +AT PT+CYECEGLLWG+ARQG+RC ECGVKCHEKC++LLNADCLQRAAEKSSKHGAE +TQ II +M D M+ R +N PEIF++I+DVF+V++ AH   +K+++QS+LDGTSKWSAKI ITV CAQGL  KDKTG+SDPYVTVQVGK KKRTKT+   LNP W+EKF+FECHNSS+RIKVRVWDED+D+KS+++Q+L RESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYH+QYTCLHEN+FH+L +   S G    ++      ++ W++YFD  +++I++EFAMRYGIESIYQAMTHF+CL++K+MCPGVPAV+STLLANINAYYAHTT++TN SAS+RFAA+NFGKE+F+KLLDQLHNS++I+L  YRN F A  PERL DLKSTVDLLTSITFFRMKVQEL SPPRA QVV++CV+AC+ +TY+++F + ++LYS   +  +  Q  +E GP  +NL+FW KLI L+VS+IE+DK  Y P L+QFPQE+N+ ++S   MW   ++ ++ AL  E+ + +  K++DY+NL F++KW +N YV DLP  Q  +P YP WFE +V+QWL EN++VS  +L+ A ERDKKDGFQ++SEHAL+S SVVD+FTQLNQ F++I+KLECP+P I +H+M+RF+ T+ KVL+ YA ++ K++  Y  K+ + CILMNN+QQ+RV LEK+FEAMGG+ L+++  D + +LQ +L+ V+D L+  F + F+  I+  ++++  +L  Q++ T   +P  + ++ Q++  VLRPLMD+ + NL+L A+VCE+ VLKR+LKELWR+ +  +ER I+LPP            ++ Q   +++  +   LS +      SK+   + ++   +L+P QC V+D+ LD IK YFHAGGNGLK ++LE+S +LQSLR+AL LY+QTTD LIK F+ SQ +Q    ++D VGEVS++V+LF HP TGEHK+T  ++A   L WQT  +FRPFVE+ ++GP+  +KKRK+ TKSKSN W+P+YNE+F FL+ + E PE YE+QICVKDYCF R D++IG  V+ L  +  +GS   W  LGRK+H D  G TILRILSQR+ D++A+EFV+LKS+ R +
Sbjct: 3208 GGLY-GIDSMPDLR-RKKPLPLVSDLSL--VQSRKAGITSA---MATRTSLKDEELKSHVYKKTLQALIYPISCTTPHNFEVWSATTPTYCYECEGLLWGLARQGMRCSECGVKCHEKCQDLLNADCLQRAAEKSSKHGAEDRTQNIIMAMKDRMKIRERNKPEIFEVIRDVFTVSKVAHVQQMKTVKQSVLDGTSKWSAKITITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIFGNLNPVWEEKFHFECHNSSDRIKVRVWDEDDDIKSRVKQRLKRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHVQYTCLHENLFHYLTDIQGSGG----VWIPEARGDDAWKVYFDETAQEIVDEFAMRYGIESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSTYRNNFPAGSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHDLYSHQYQLQE--QPLEEPGPSIRNLDFWPKLITLIVSIIEEDKNSYTPVLSQFPQELNVGKVSAEVMWHLFAQDMKYALE-EHEKDRLCKSADYMNLHFKVKWLHNEYVRDLPALQGQVPEYPAWFEQFVLQWLDENEDVSLEFLRGALERDKKDGFQQTSEHALFSCSVVDVFTQLNQSFEIIRKLECPDPNILAHYMRRFAKTIGKVLMQYADILSKNFPAYCTKERLPCILMNNMQQLRVQLEKMFEAMGGKELDSEAADSLKELQVKLNTVLDELSMVFGNSFQVRIDECVRQMADIL-GQVRGTGNASPNARASVAQDADSVLRPLMDFLDGNLTLFATVCEKTVLKRVLKELWRVVMNTMERVIVLPP------------LTDQTGTQLILTAAKELSQL------SKLKDHMVREETRNLTPKQCAVLDLALDTIKQYFHAGGNGLKKTFLEKSPDLQSLRYALSLYTQTTDTLIKTFVRSQTAQGA-GVDDPVGEVSIQVDLFTHPGTGEHKVTVKVVAANDLKWQTAGMFRPFVEVTMVGPHQSDKKRKFTTKSKSNNWTPKYNETFHFLLGNEEGPEAYELQICVKDYCFAREDRVIGLAVMPLRDVAAKGSCACWCPLGRKIHMDETGMTILRILSQRSNDEVAREFVKLKSESRST 4386          
BLAST of Protein unc-13 homolog B vs. Ensembl Mouse
Match: Unc13b (unc-13 homolog B [Source:MGI Symbol;Acc:MGI:1342278])

HSP 1 Score: 1504.96 bits (3895), Expect = 0.000e+0
Identity = 708/1214 (58.32%), Postives = 936/1214 (77.10%), Query Frame = 2
Query: 2888 GGFYKSIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRDQEPGDKIQNSDETGP--KNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNP--KLNLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKD-ISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIRQS 6514
            GG Y  IDS PD++ RKK + LVSDL L     Q R     +A + TR SL DEELK HVYKKTLQA+IYPIS  TPH+F+V +AT PT+CYECEGLLWG+ARQG+RC ECGVKCHEKC++LLNADCLQRAAEKSSKHGAE +TQ II +M D M+ R +N PEIF++I+DVF+V++ AH   +K+++QS+LDGTSKWSAKI ITV CAQGL  KDKTG+SDPYVTVQVGK KKRTKT+   LNP W+EKF+FECHNSS+RIKVRVWDED+D+KS+++Q+L RESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYH+QYTCLHEN+FH+L +   S G    ++      ++ W++YFD  +++I++EFAMRYGIESIYQAMTHF+CL++K+MCPGVPAV+STLLANINAYYAHTT++TN SAS+RFAA+NFGKE+F+KLLDQLHNS++I+L  YRN F A  PERL DLKSTVDLLTSITFFRMKVQEL SPPRA QVV++CV+AC+ +TY+++F + ++LYS   +  +  Q  +E GP  +NL+FW KLI L+VS+IE+DK  Y P L+QFPQE+N+ ++S   MW   ++ ++ AL  E+ + +  K++DY+NL F++KW +N YV DLP  Q  +P YP WFE +V+QWL EN++VS  +L+ A ERDKKDGFQ++SEHAL+S SVVD+FTQLNQ F++I+KLECP+P I +H+M+RF+ T+ KVL+ YA ++ K++  Y  K+ + CILMNN+QQ+RV LEK+FEAMGG+ L+++  D + +LQ +L+ V+D L+  F + F+  I+  ++++  +L  Q++ T   +P  + ++ Q++  VLRPLMD+ + NL+L A+VCE+ VLKR+LKELWR+ +  +ER I+LPP            ++ Q   +++  +   LS +S        LKD + ++   +L+P QC V+D+ LD IK YFHAGGNGLK ++LE+S +LQSLR+AL LY+QTTD LIK F+ SQ +Q    ++D VGEVS++V+LF HP TGEHK+T  ++A   L WQT  +FRPFVE+ ++GP+  +KKRK+ TKSKSN W+P+YNE+F FL+ + E PE YE+QICVKDYCF R D++IG  V+ L  +  +GS   W  LGRK+H D  G TILRILSQR+ D++A+EFV+LKS+ R +
Sbjct:  408 GGLY-GIDSMPDLR-RKKPLPLVSDLSL----VQSRKAGITSA-MATRTSLKDEELKSHVYKKTLQALIYPISCTTPHNFEVWSATTPTYCYECEGLLWGLARQGMRCSECGVKCHEKCQDLLNADCLQRAAEKSSKHGAEDRTQNIIMAMKDRMKIRERNKPEIFEVIRDVFTVSKVAHVQQMKTVKQSVLDGTSKWSAKITITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIFGNLNPVWEEKFHFECHNSSDRIKVRVWDEDDDIKSRVKQRLKRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHVQYTCLHENLFHYLTDIQGSGG----VWIPEARGDDAWKVYFDETAQEIVDEFAMRYGIESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSTYRNNFPAGSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHDLYSHQYQLQE--QPLEEPGPSIRNLDFWPKLITLIVSIIEEDKNSYTPVLSQFPQELNVGKVSAEVMWHLFAQDMKYALE-EHEKDRLCKSADYMNLHFKVKWLHNEYVRDLPALQGQVPEYPAWFEQFVLQWLDENEDVSLEFLRGALERDKKDGFQQTSEHALFSCSVVDVFTQLNQSFEIIRKLECPDPNILAHYMRRFAKTIGKVLMQYADILSKNFPAYCTKERLPCILMNNMQQLRVQLEKMFEAMGGKELDSEAADSLKELQVKLNTVLDELSMVFGNSFQVRIDECVRQMADIL-GQVRGTGNASPNARASVAQDADSVLRPLMDFLDGNLTLFATVCEKTVLKRVLKELWRVVMNTMERVIVLPP------------LTDQTGTQLILTAAKELSQLSK-------LKDHMVREETRNLTPKQCAVLDLALDTIKQYFHAGGNGLKKTFLEKSPDLQSLRYALSLYTQTTDTLIKTFVRSQTAQGA-GVDDPVGEVSIQVDLFTHPGTGEHKVTVKVVAANDLKWQTAGMFRPFVEVTMVGPHQSDKKRKFTTKSKSNNWTPKYNETFHFLLGNEEGPEAYELQICVKDYCFAREDRVIGLAVMPLRDVAAKGSCACWCPLGRKIHMDETGMTILRILSQRSNDEVAREFVKLKSESRST 1586          
BLAST of Protein unc-13 homolog B vs. Ensembl Mouse
Match: Unc13b (unc-13 homolog B [Source:MGI Symbol;Acc:MGI:1342278])

HSP 1 Score: 1503.8 bits (3892), Expect = 0.000e+0
Identity = 708/1214 (58.32%), Postives = 936/1214 (77.10%), Query Frame = 2
Query: 2888 GGFYKSIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRDQEPGDKIQNSDETGP--KNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNP--KLNLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKD-ISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIRQS 6514
            GG Y  IDS PD++ RKK + LVSDL L     Q R     +A + TR SL DEELK HVYKKTLQA+IYPIS  TPH+F+V +AT PT+CYECEGLLWG+ARQG+RC ECGVKCHEKC++LLNADCLQRAAEKSSKHGAE +TQ II +M D M+ R +N PEIF++I+DVF+V++ AH   +K+++QS+LDGTSKWSAKI ITV CAQGL  KDKTG+SDPYVTVQVGK KKRTKT+   LNP W+EKF+FECHNSS+RIKVRVWDED+D+KS+++Q+L RESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYH+QYTCLHEN+FH+L +   S G    ++      ++ W++YFD  +++I++EFAMRYGIESIYQAMTHF+CL++K+MCPGVPAV+STLLANINAYYAHTT++TN SAS+RFAA+NFGKE+F+KLLDQLHNS++I+L  YRN F A  PERL DLKSTVDLLTSITFFRMKVQEL SPPRA QVV++CV+AC+ +TY+++F + ++LYS   +  +  Q  +E GP  +NL+FW KLI L+VS+IE+DK  Y P L+QFPQE+N+ ++S   MW   ++ ++ AL  E+ + +  K++DY+NL F++KW +N YV DLP  Q  +P YP WFE +V+QWL EN++VS  +L+ A ERDKKDGFQ++SEHAL+S SVVD+FTQLNQ F++I+KLECP+P I +H+M+RF+ T+ KVL+ YA ++ K++  Y  K+ + CILMNN+QQ+RV LEK+FEAMGG+ L+++  D + +LQ +L+ V+D L+  F + F+  I+  ++++  +L  Q++ T   +P  + ++ Q++  VLRPLMD+ + NL+L A+VCE+ VLKR+LKELWR+ +  +ER I+LPP            ++ Q   +++  +   LS +S        LKD + ++   +L+P QC V+D+ LD IK YFHAGGNGLK ++LE+S +LQSLR+AL LY+QTTD LIK F+ SQ +Q    ++D VGEVS++V+LF HP TGEHK+T  ++A   L WQT  +FRPFVE+ ++GP+  +KKRK+ TKSKSN W+P+YNE+F FL+ + E PE YE+QICVKDYCF R D++IG  V+ L  +  +GS   W  LGRK+H D  G TILRILSQR+ D++A+EFV+LKS+ R +
Sbjct:  420 GGLY-GIDSMPDLR-RKKPLPLVSDLSL----VQSRKAGITSA-MATRTSLKDEELKSHVYKKTLQALIYPISCTTPHNFEVWSATTPTYCYECEGLLWGLARQGMRCSECGVKCHEKCQDLLNADCLQRAAEKSSKHGAEDRTQNIIMAMKDRMKIRERNKPEIFEVIRDVFTVSKVAHVQQMKTVKQSVLDGTSKWSAKITITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIFGNLNPVWEEKFHFECHNSSDRIKVRVWDEDDDIKSRVKQRLKRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHVQYTCLHENLFHYLTDIQGSGG----VWIPEARGDDAWKVYFDETAQEIVDEFAMRYGIESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSTYRNNFPAGSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHDLYSHQYQLQE--QPLEEPGPSIRNLDFWPKLITLIVSIIEEDKNSYTPVLSQFPQELNVGKVSAEVMWHLFAQDMKYALE-EHEKDRLCKSADYMNLHFKVKWLHNEYVRDLPALQGQVPEYPAWFEQFVLQWLDENEDVSLEFLRGALERDKKDGFQQTSEHALFSCSVVDVFTQLNQSFEIIRKLECPDPNILAHYMRRFAKTIGKVLMQYADILSKNFPAYCTKERLPCILMNNMQQLRVQLEKMFEAMGGKELDSEAADSLKELQVKLNTVLDELSMVFGNSFQVRIDECVRQMADIL-GQVRGTGNASPNARASVAQDADSVLRPLMDFLDGNLTLFATVCEKTVLKRVLKELWRVVMNTMERVIVLPP------------LTDQTGTQLILTAAKELSQLSK-------LKDHMVREETRNLTPKQCAVLDLALDTIKQYFHAGGNGLKKTFLEKSPDLQSLRYALSLYTQTTDTLIKTFVRSQTAQGA-GVDDPVGEVSIQVDLFTHPGTGEHKVTVKVVAANDLKWQTAGMFRPFVEVTMVGPHQSDKKRKFTTKSKSNNWTPKYNETFHFLLGNEEGPEAYELQICVKDYCFAREDRVIGLAVMPLRDVAAKGSCACWCPLGRKIHMDETGMTILRILSQRSNDEVAREFVKLKSESRST 1598          
BLAST of Protein unc-13 homolog B vs. Ensembl Mouse
Match: Unc13b (unc-13 homolog B [Source:MGI Symbol;Acc:MGI:1342278])

HSP 1 Score: 1503.03 bits (3890), Expect = 0.000e+0
Identity = 708/1214 (58.32%), Postives = 935/1214 (77.02%), Query Frame = 2
Query: 2888 GGFYKSIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRDQEPGDKIQNSDETGP--KNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNP--KLNLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKD-ISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIRQS 6514
            GG Y  IDS PD++ RKK + LVSDL L     Q R     +A + TR SL DEELK HVYKKTLQA+IYPIS  TPH+F+V +AT PT+CYECEGLLWG+ARQG+RC ECGVKCHEKC++LLNADCLQRAAEKSSKHGAE +TQ II +M D M+ R +N PEIF++I+DVF+V++ AH   +K+++QS+LDGTSKWSAKI ITV CAQGL  KDKTG+SDPYVTVQVGK KKRTKT+   LNP W+EKF+FECHNSS+RIKVRVWDED+D+KS+++Q+L RESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYH+QYTCLHEN+FH+L +   S G    ++      ++ W++YFD  +++I++EFAMRYGIESIYQAMTHF+CL++K+MCPGVPAV+STLLANINAYYAHTT++TN SAS+RFAA+NFGKE+F+KLLDQLHNS++I+L  YRN F A  PERL DLKSTVDLLTSITFFRMKVQEL SPPRA QVV++CV+AC+ +TY+++F + ++LYS   +     Q  +E GP  +NL+FW KLI L+VS+IE+DK  Y P L+QFPQE+N+ ++S   MW   ++ ++ AL  E+ + +  K++DY+NL F++KW +N YV DLP  Q  +P YP WFE +V+QWL EN++VS  +L+ A ERDKKDGFQ++SEHAL+S SVVD+FTQLNQ F++I+KLECP+P I +H+M+RF+ T+ KVL+ YA ++ K++  Y  K+ + CILMNN+QQ+RV LEK+FEAMGG+ L+++  D + +LQ +L+ V+D L+  F + F+  I+  ++++  +L  Q++ T   +P  + ++ Q++  VLRPLMD+ + NL+L A+VCE+ VLKR+LKELWR+ +  +ER I+LPP            ++ Q   +++  +   LS +S        LKD + ++   +L+P QC V+D+ LD IK YFHAGGNGLK ++LE+S +LQSLR+AL LY+QTTD LIK F+ SQ +Q    ++D VGEVS++V+LF HP TGEHK+T  ++A   L WQT  +FRPFVE+ ++GP+  +KKRK+ TKSKSN W+P+YNE+F FL+ + E PE YE+QICVKDYCF R D++IG  V+ L  +  +GS   W  LGRK+H D  G TILRILSQR+ D++A+EFV+LKS+ R +
Sbjct:  420 GGLY-GIDSMPDLR-RKKPLPLVSDLSL----VQSRKAGITSA-MATRTSLKDEELKSHVYKKTLQALIYPISCTTPHNFEVWSATTPTYCYECEGLLWGLARQGMRCSECGVKCHEKCQDLLNADCLQRAAEKSSKHGAEDRTQNIIMAMKDRMKIRERNKPEIFEVIRDVFTVSKVAHVQQMKTVKQSVLDGTSKWSAKITITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIFGNLNPVWEEKFHFECHNSSDRIKVRVWDEDDDIKSRVKQRLKRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHVQYTCLHENLFHYLTDIQGSGG----VWIPEARGDDAWKVYFDETAQEIVDEFAMRYGIESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSTYRNNFPAGSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHDLYSHQYQLE---QPLEEPGPSIRNLDFWPKLITLIVSIIEEDKNSYTPVLSQFPQELNVGKVSAEVMWHLFAQDMKYALE-EHEKDRLCKSADYMNLHFKVKWLHNEYVRDLPALQGQVPEYPAWFEQFVLQWLDENEDVSLEFLRGALERDKKDGFQQTSEHALFSCSVVDVFTQLNQSFEIIRKLECPDPNILAHYMRRFAKTIGKVLMQYADILSKNFPAYCTKERLPCILMNNMQQLRVQLEKMFEAMGGKELDSEAADSLKELQVKLNTVLDELSMVFGNSFQVRIDECVRQMADIL-GQVRGTGNASPNARASVAQDADSVLRPLMDFLDGNLTLFATVCEKTVLKRVLKELWRVVMNTMERVIVLPP------------LTDQTGTQLILTAAKELSQLSK-------LKDHMVREETRNLTPKQCAVLDLALDTIKQYFHAGGNGLKKTFLEKSPDLQSLRYALSLYTQTTDTLIKTFVRSQTAQGA-GVDDPVGEVSIQVDLFTHPGTGEHKVTVKVVAANDLKWQTAGMFRPFVEVTMVGPHQSDKKRKFTTKSKSNNWTPKYNETFHFLLGNEEGPEAYELQICVKDYCFAREDRVIGLAVMPLRDVAAKGSCACWCPLGRKIHMDETGMTILRILSQRSNDEVAREFVKLKSESRST 1597          
BLAST of Protein unc-13 homolog B vs. Ensembl Mouse
Match: Unc13b (unc-13 homolog B [Source:MGI Symbol;Acc:MGI:1342278])

HSP 1 Score: 1499.57 bits (3881), Expect = 0.000e+0
Identity = 708/1232 (57.47%), Postives = 936/1232 (75.97%), Query Frame = 2
Query: 2888 GGFYKSIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRDQEPGDKIQNSDETGP--KNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNP--KLNLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKD-ISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQ------------------DTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIRQS 6514
            GG Y  IDS PD++ RKK + LVSDL L     Q R     +A + TR SL DEELK HVYKKTLQA+IYPIS  TPH+F+V +AT PT+CYECEGLLWG+ARQG+RC ECGVKCHEKC++LLNADCLQRAAEKSSKHGAE +TQ II +M D M+ R +N PEIF++I+DVF+V++ AH   +K+++QS+LDGTSKWSAKI ITV CAQGL  KDKTG+SDPYVTVQVGK KKRTKT+   LNP W+EKF+FECHNSS+RIKVRVWDED+D+KS+++Q+L RESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYH+QYTCLHEN+FH+L +   S G    ++      ++ W++YFD  +++I++EFAMRYGIESIYQAMTHF+CL++K+MCPGVPAV+STLLANINAYYAHTT++TN SAS+RFAA+NFGKE+F+KLLDQLHNS++I+L  YRN F A  PERL DLKSTVDLLTSITFFRMKVQEL SPPRA QVV++CV+AC+ +TY+++F + ++LYS   +  +  Q  +E GP  +NL+FW KLI L+VS+IE+DK  Y P L+QFPQE+N+ ++S   MW   ++ ++ AL  E+ + +  K++DY+NL F++KW +N YV DLP  Q  +P YP WFE +V+QWL EN++VS  +L+ A ERDKKDGFQ++SEHAL+S SVVD+FTQLNQ F++I+KLECP+P I +H+M+RF+ T+ KVL+ YA ++ K++  Y  K+ + CILMNN+QQ+RV LEK+FEAMGG+ L+++  D + +LQ +L+ V+D L+  F + F+  I+  ++++  +L  Q++ T   +P  + ++ Q++  VLRPLMD+ + NL+L A+VCE+ VLKR+LKELWR+ +  +ER I+LPP            ++ Q   +++  +   LS +S        LKD + ++   +L+P QC V+D+ LD IK YFHAGGNGLK ++LE+S +LQSLR+AL LY+QTTD LIK F+ SQ +Q                      ++D VGEVS++V+LF HP TGEHK+T  ++A   L WQT  +FRPFVE+ ++GP+  +KKRK+ TKSKSN W+P+YNE+F FL+ + E PE YE+QICVKDYCF R D++IG  V+ L  +  +GS   W  LGRK+H D  G TILRILSQR+ D++A+EFV+LKS+ R +
Sbjct:  781 GGLY-GIDSMPDLR-RKKPLPLVSDLSL----VQSRKAGITSA-MATRTSLKDEELKSHVYKKTLQALIYPISCTTPHNFEVWSATTPTYCYECEGLLWGLARQGMRCSECGVKCHEKCQDLLNADCLQRAAEKSSKHGAEDRTQNIIMAMKDRMKIRERNKPEIFEVIRDVFTVSKVAHVQQMKTVKQSVLDGTSKWSAKITITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIFGNLNPVWEEKFHFECHNSSDRIKVRVWDEDDDIKSRVKQRLKRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHVQYTCLHENLFHYLTDIQGSGG----VWIPEARGDDAWKVYFDETAQEIVDEFAMRYGIESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSTYRNNFPAGSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHDLYSHQYQLQE--QPLEEPGPSIRNLDFWPKLITLIVSIIEEDKNSYTPVLSQFPQELNVGKVSAEVMWHLFAQDMKYALE-EHEKDRLCKSADYMNLHFKVKWLHNEYVRDLPALQGQVPEYPAWFEQFVLQWLDENEDVSLEFLRGALERDKKDGFQQTSEHALFSCSVVDVFTQLNQSFEIIRKLECPDPNILAHYMRRFAKTIGKVLMQYADILSKNFPAYCTKERLPCILMNNMQQLRVQLEKMFEAMGGKELDSEAADSLKELQVKLNTVLDELSMVFGNSFQVRIDECVRQMADIL-GQVRGTGNASPNARASVAQDADSVLRPLMDFLDGNLTLFATVCEKTVLKRVLKELWRVVMNTMERVIVLPP------------LTDQTGTQLILTAAKELSQLSK-------LKDHMVREETRNLTPKQCAVLDLALDTIKQYFHAGGNGLKKTFLEKSPDLQSLRYALSLYTQTTDTLIKTFVRSQTAQVHDGKGIRFTANEDIRPEKGAGVDDPVGEVSIQVDLFTHPGTGEHKVTVKVVAANDLKWQTAGMFRPFVEVTMVGPHQSDKKRKFTTKSKSNNWTPKYNETFHFLLGNEEGPEAYELQICVKDYCFAREDRVIGLAVMPLRDVAAKGSCACWCPLGRKIHMDETGMTILRILSQRSNDEVAREFVKLKSESRST 1978          
BLAST of Protein unc-13 homolog B vs. UniProt/SwissProt
Match: sp|O14795|UN13B_HUMAN (Protein unc-13 homolog B OS=Homo sapiens OX=9606 GN=UNC13B PE=1 SV=2)

HSP 1 Score: 1509.2 bits (3906), Expect = 0.000e+0
Identity = 709/1214 (58.40%), Postives = 935/1214 (77.02%), Query Frame = 2
Query: 2888 GGFYKSIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRDQEPGDKIQNSDETGP--KNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNP--KLNLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKD-ISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIRQS 6514
            GG Y  IDS PD++ RKK + LVSDL L     Q R     +A + TR SL DEELK HVYKKTLQA+IYPIS  TPH+F+V  AT PT+CYECEGLLWG+ARQG+RC ECGVKCHEKC++LLNADCLQRAAEKS KHGAE +TQ II +M D M+ R +N PEIF++I+DVF+VN+ AH   +K+++QS+LDGTSKWSAKI ITV CAQGL  KDKTG+SDPYVTVQV K KKRTKT+   LNP W+EKF+FECHNSS+RIKVRVWDED+D+KS+++Q+L RESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYH+QYTCLHEN+FH+L +   S G    +       ++ W++YFD  +++I++EFAMRYGIESIYQAMTHF+CL++K+MCPGVPAV+STLLANINAYYAHTT++TN SAS+RFAA+NFGKE+F+KLLDQLHNS++I+L  YRN F A  PERL DLKSTVDLLTSITFFRMKVQEL SPPRA QVV++CV+AC+ +TY+++F + ++LYSR  +   ++   +E GP  +NL+FW KLI L+VS+IE+DK  Y P LNQFPQE+N+ ++S   MW   ++ ++ AL  E+ +    K++DY+NL F++KW +N YV DLP  Q  +P YP WFE +V+QWL EN++VS  +L+ A ERDKKDGFQ++SEHAL+S SVVD+FTQLNQ F++I+KLECP+P+I +H+M+RF+ T+ KVL+ YA ++ KD+  Y  K+++ CILMNN+QQ+RV LEK+FEAMGG+ L+ +  D + +LQ +L+ V+D L+  F + F+  I+  ++++  +L  Q++ T   +P  + +  Q++  VLRPLMD+ + NL+L A+VCE+ VLKR+LKELWR+ +  +ER I+LPP            ++ Q   +++  +   LSH+S        LKD + ++   +L+P QC V+D+ LD IK YFHAGGNGLK ++LE+S +LQSLR+AL LY+QTTD LIK F+ SQ +Q +  ++D VGEVS++V+LF HP TGEHK+T  ++A   L WQT  +FRPFVE+ ++GP+  +KKRK+ TKSKSN W+P+YNE+F FL+ + E PE+YE+QICVKDYCF R D+++G  V+ L  +  +GS   W  LGRK+H D  G TILRILSQR+ D++A+EFV+LKS+ R +
Sbjct:  408 GGLY-GIDSMPDLR-RKKPLPLVSDLSL----VQSRKAGITSA-MATRTSLKDEELKSHVYKKTLQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCSECGVKCHEKCQDLLNADCLQRAAEKSCKHGAEDRTQNIIMAMKDRMKIRERNKPEIFEVIRDVFTVNKAAHVQQMKTVKQSVLDGTSKWSAKITITVVCAQGLQAKDKTGSSDPYVTVQVSKTKKRTKTIFGNLNPVWEEKFHFECHNSSDRIKVRVWDEDDDIKSRVKQRLKRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHVQYTCLHENLFHYLTDIQGSGG----VRIPEARGDDAWKVYFDETAQEIVDEFAMRYGIESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSTYRNNFPAGSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHDLYSRQYQLKQELP-PEEQGPSIRNLDFWPKLITLIVSIIEEDKNSYTPVLNQFPQELNVGKVSAEVMWHLFAQDMKYALE-EHEKDHLCKSADYMNLHFKVKWLHNEYVRDLPVLQGQVPEYPAWFEQFVLQWLDENEDVSLEFLRGALERDKKDGFQQTSEHALFSCSVVDVFTQLNQSFEIIRKLECPDPSILAHYMRRFAKTIGKVLMQYADILSKDFPAYCTKEKLPCILMNNVQQLRVQLEKMFEAMGGKELDLEAADSLKELQVKLNTVLDELSMVFGNSFQVRIDECVRQMADIL-GQVRGTGNASPDARASAAQDADSVLRPLMDFLDGNLTLFATVCEKTVLKRVLKELWRVVMNTMERMIVLPP------------LTDQTGTQLIFTAAKELSHLSK-------LKDHMVREETRNLTPKQCAVLDLALDTIKQYFHAGGNGLKKTFLEKSPDLQSLRYALSLYTQTTDTLIKTFVRSQTTQGS-GVDDPVGEVSIQVDLFTHPGTGEHKVTVKVVAANDLKWQTAGMFRPFVEVTMVGPHQSDKKRKFTTKSKSNNWAPKYNETFHFLLGNEEGPESYELQICVKDYCFAREDRVLGLAVMPLRDVTAKGSCACWCPLGRKIHMDETGLTILRILSQRSNDEVAREFVKLKSESRST 1587          
BLAST of Protein unc-13 homolog B vs. UniProt/SwissProt
Match: sp|Q9Z1N9|UN13B_MOUSE (Protein unc-13 homolog B OS=Mus musculus OX=10090 GN=Unc13b PE=1 SV=2)

HSP 1 Score: 1503.8 bits (3892), Expect = 0.000e+0
Identity = 708/1214 (58.32%), Postives = 936/1214 (77.10%), Query Frame = 2
Query: 2888 GGFYKSIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRDQEPGDKIQNSDETGP--KNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNP--KLNLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKD-ISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIRQS 6514
            GG Y  IDS PD++ RKK + LVSDL L     Q R     +A + TR SL DEELK HVYKKTLQA+IYPIS  TPH+F+V +AT PT+CYECEGLLWG+ARQG+RC ECGVKCHEKC++LLNADCLQRAAEKSSKHGAE +TQ II +M D M+ R +N PEIF++I+DVF+V++ AH   +K+++QS+LDGTSKWSAKI ITV CAQGL  KDKTG+SDPYVTVQVGK KKRTKT+   LNP W+EKF+FECHNSS+RIKVRVWDED+D+KS+++Q+L RESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYH+QYTCLHEN+FH+L +   S G    ++      ++ W++YFD  +++I++EFAMRYGIESIYQAMTHF+CL++K+MCPGVPAV+STLLANINAYYAHTT++TN SAS+RFAA+NFGKE+F+KLLDQLHNS++I+L  YRN F A  PERL DLKSTVDLLTSITFFRMKVQEL SPPRA QVV++CV+AC+ +TY+++F + ++LYS   +  +  Q  +E GP  +NL+FW KLI L+VS+IE+DK  Y P L+QFPQE+N+ ++S   MW   ++ ++ AL  E+ + +  K++DY+NL F++KW +N YV DLP  Q  +P YP WFE +V+QWL EN++VS  +L+ A ERDKKDGFQ++SEHAL+S SVVD+FTQLNQ F++I+KLECP+P I +H+M+RF+ T+ KVL+ YA ++ K++  Y  K+ + CILMNN+QQ+RV LEK+FEAMGG+ L+++  D + +LQ +L+ V+D L+  F + F+  I+  ++++  +L  Q++ T   +P  + ++ Q++  VLRPLMD+ + NL+L A+VCE+ VLKR+LKELWR+ +  +ER I+LPP            ++ Q   +++  +   LS +S        LKD + ++   +L+P QC V+D+ LD IK YFHAGGNGLK ++LE+S +LQSLR+AL LY+QTTD LIK F+ SQ +Q    ++D VGEVS++V+LF HP TGEHK+T  ++A   L WQT  +FRPFVE+ ++GP+  +KKRK+ TKSKSN W+P+YNE+F FL+ + E PE YE+QICVKDYCF R D++IG  V+ L  +  +GS   W  LGRK+H D  G TILRILSQR+ D++A+EFV+LKS+ R +
Sbjct:  420 GGLY-GIDSMPDLR-RKKPLPLVSDLSL----VQSRKAGITSA-MATRTSLKDEELKSHVYKKTLQALIYPISCTTPHNFEVWSATTPTYCYECEGLLWGLARQGMRCSECGVKCHEKCQDLLNADCLQRAAEKSSKHGAEDRTQNIIMAMKDRMKIRERNKPEIFEVIRDVFTVSKVAHVQQMKTVKQSVLDGTSKWSAKITITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIFGNLNPVWEEKFHFECHNSSDRIKVRVWDEDDDIKSRVKQRLKRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHVQYTCLHENLFHYLTDIQGSGG----VWIPEARGDDAWKVYFDETAQEIVDEFAMRYGIESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSTYRNNFPAGSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHDLYSHQYQLQE--QPLEEPGPSIRNLDFWPKLITLIVSIIEEDKNSYTPVLSQFPQELNVGKVSAEVMWHLFAQDMKYALE-EHEKDRLCKSADYMNLHFKVKWLHNEYVRDLPALQGQVPEYPAWFEQFVLQWLDENEDVSLEFLRGALERDKKDGFQQTSEHALFSCSVVDVFTQLNQSFEIIRKLECPDPNILAHYMRRFAKTIGKVLMQYADILSKNFPAYCTKERLPCILMNNMQQLRVQLEKMFEAMGGKELDSEAADSLKELQVKLNTVLDELSMVFGNSFQVRIDECVRQMADIL-GQVRGTGNASPNARASVAQDADSVLRPLMDFLDGNLTLFATVCEKTVLKRVLKELWRVVMNTMERVIVLPP------------LTDQTGTQLILTAAKELSQLSK-------LKDHMVREETRNLTPKQCAVLDLALDTIKQYFHAGGNGLKKTFLEKSPDLQSLRYALSLYTQTTDTLIKTFVRSQTAQGA-GVDDPVGEVSIQVDLFTHPGTGEHKVTVKVVAANDLKWQTAGMFRPFVEVTMVGPHQSDKKRKFTTKSKSNNWTPKYNETFHFLLGNEEGPEAYELQICVKDYCFAREDRVIGLAVMPLRDVAAKGSCACWCPLGRKIHMDETGMTILRILSQRSNDEVAREFVKLKSESRST 1598          
BLAST of Protein unc-13 homolog B vs. UniProt/SwissProt
Match: sp|Q62769|UN13B_RAT (Protein unc-13 homolog B OS=Rattus norvegicus OX=10116 GN=Unc13b PE=1 SV=2)

HSP 1 Score: 1494.17 bits (3867), Expect = 0.000e+0
Identity = 701/1230 (56.99%), Postives = 939/1230 (76.34%), Query Frame = 2
Query: 2888 GGFYKSIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRDQEPGDKIQNSDETGP--KNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNP--KLNLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKD-ISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQ------------------DTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIR 6508
            GG Y  IDS PD++ RKK + LVSDL +  + ++K  + +A   + TR SL DE+LK HVYKKTLQA+IYPIS  TPH+F+V +AT PT+CYECEGLLWG+ARQG+RC ECGVKCHEKC++LLNADCLQRAAEKSSKHGAE +TQ II +M D M+ R +N PEIF++I+DVF+V++ AH   +K+++QS+LDGTSKWSAKI ITV CAQGL  KDKTG+SDPYVTVQVGK KKRTKT+   LNP W+EKF+FECHNSS+RIKVRVWDED+D+KS+++Q+L RESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQI+VEIKGEEKVAPYH+QYTCLHEN+FH+L +   S G    ++  +   ++ W++YFD  +++I++EFAMRYGIESIYQAMTHF+CL++K+MCPGVPAV+STLLANINAYYAHTT++TN SAS+RFAA+NFGKE+F+KLLDQLHNS++I+L  YRN F A  PERL DLKSTVDLLTSITFFRMKVQEL SPPRA QVV++CV+AC+ +TY+++F + ++LYS   +  +  Q  +E GP  +NL+FW KLI L+VS+IE+DK  Y P LNQFPQE+N+ ++S   MW   ++ ++ AL  E+ + +  K++DY+NL F++KW +N YV +LP  Q  +P YP WFE +V+QWL EN++VS  +L+   ERDK+DGFQ++SEHAL+S SVVD+FTQLNQ F++I+KLECP+P+I +H+M+RF+ T+ KVL+ YA ++ K++  Y  K+ + CILMNN+QQ+RV LEK+FEAMGG+ L+++  D + +LQ +L+ V+D L+  F + F+  I+  ++++  +L  Q++ T   +P  + ++ Q++  VLRPLMD+ + NL+L A+VCE+ VLKR+LKELWR+ +  +ER I+LPP            +  Q   +++  +   LS +S        LKD + ++   +L+P QC V+D+ LD +K YFHAGGNGLK ++LE+S +LQSLR+AL LY+QTTD LIK F+ SQ +Q                      ++D VGEVS++V+LF HP TGEHK+T  ++A   L WQT  +FRPFVE+ ++GP+  +KKRK+ TKSKSN+W+P+YNE+F FL+ + E PE YE+QICVKDYCF R D++IG  V+ L  +  +GS   W  LGRK+H D  G TILRILSQR+ D++A+EFV+LKS+ R
Sbjct:  419 GGLY-GIDSMPDLR-RKKPLPLVSDLAMSLVQSRKAGITSA---MATRTSLKDEDLKSHVYKKTLQALIYPISCTTPHNFEVWSATTPTYCYECEGLLWGLARQGMRCSECGVKCHEKCQDLLNADCLQRAAEKSSKHGAEDRTQNIIMAMKDRMKIRERNKPEIFEVIRDVFTVSKVAHVQQMKTVKQSVLDGTSKWSAKITITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIFGNLNPVWEEKFHFECHNSSDRIKVRVWDEDDDIKSRVKQRLKRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQINVEIKGEEKVAPYHVQYTCLHENLFHYLTDIQGSGG----VWIPDARGDDAWKVYFDETAQEIVDEFAMRYGIESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSTYRNNFPAGSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHDLYSHQYQLQE--QPLEEPGPSIRNLDFWPKLITLIVSIIEEDKNSYTPVLNQFPQELNVGKVSAEVMWHLFAQDMKYALE-EHEKDRLCKSADYMNLHFKVKWLHNEYVRELPALQGQVPEYPAWFEQFVLQWLDENEDVSLEFLRGGLERDKRDGFQQTSEHALFSCSVVDVFTQLNQSFEIIRKLECPDPSILAHYMRRFAKTIGKVLIQYADILSKNFPAYCTKERLPCILMNNMQQLRVQLEKMFEAMGGKELDSEAADSLKELQVKLNTVLDELSMVFGNSFQVRIDECVRQMADIL-GQVRGTGNASPNARASVAQDADSVLRPLMDFLDGNLTLFATVCEKTVLKRVLKELWRVVMNTMERVIVLPP------------LIDQTGTQLILTAAKELSQLSK-------LKDHMVREETRNLTPKQCAVLDLALDTVKQYFHAGGNGLKKTFLEKSPDLQSLRYALSLYTQTTDTLIKTFVRSQTAQVHDGKGIRFTANEDIRPEKGAGVDDPVGEVSIQVDLFTHPGTGEHKVTVKVVAANDLKWQTAGMFRPFVEVTMVGPHQSDKKRKFTTKSKSNSWTPKYNETFHFLLGNEEGPEAYELQICVKDYCFAREDRVIGLAVMPLRDVAAKGSCACWCPLGRKIHMDETGMTILRILSQRSNDEVAREFVKLKSESR 1616          
BLAST of Protein unc-13 homolog B vs. UniProt/SwissProt
Match: sp|Q9UPW8|UN13A_HUMAN (Protein unc-13 homolog A OS=Homo sapiens OX=9606 GN=UNC13A PE=2 SV=4)

HSP 1 Score: 1484.93 bits (3843), Expect = 0.000e+0
Identity = 703/1221 (57.58%), Postives = 938/1221 (76.82%), Query Frame = 2
Query: 2909 DSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRD--QEPGDKIQN-SDETGP--KNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYL--QKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKL--NLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQ---VPNSKILKDISKDTDH-------SLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIRQS 6514
            DS PDI+ ++K I LVSDL +  + ++K  + +A AS     +LN+EELK HVYKKTLQA+IYPIS  TPH+F+V  AT PT+CYECEGLLWG+ARQG+RC ECGVKCHEKC++LLNADCLQRAAEKSSKHGAE +TQ II  + D M+ R +N PEIF++I+++F+V + AH   +K+++QS+LDGTSKWSAKI+ITV CAQGL  KDKTG+SDPYVTVQVGK KKRTKT+   LNP W+E F+FECHNSS+RIKVRVWDED+D+KS+++Q+  RESDDFLGQTIIEVRTLSGEMDVWYNL+KRTDKSAVSGAIRL ISVEIKGEEKVAPYH+QYTCLHEN+FHF+ +   +     ++   +   ++ W++Y+D  +++I++EFAMRYG+ESIYQAMTHF+CL++K+MCPGVPAV+STLLANINAYYAHTT++TN SAS+RFAA+NFGKE+F+KLLDQLHNS++I+L +YRN F AS PERL DLKSTVDLLTSITFFRMKVQEL SPPRA QVV++CV+AC+ +TY+++F + +ELYSR+   +P  K +   +E GP  KNL+FW KLI L+VS+IE+DK  Y P LNQFPQE+N+ +IS   MW   ++ ++ A+  E+ + +  K++DY+NL F++KW YN YV +LP  +D +P YP WFEP+VIQWL EN+EVS ++L  A ERDKKDGFQ++SEHAL+S SVVD+F+QLNQ F++IKKLECP+P I  H+M+RF+ T++ VLL YA +I KD+  Y   +K++V CILMNN QQ+RV LEK+FEAMGG+ L+ +  D + +LQ +L++V+D L++ FA  F+  IE  +K++  +L +Q++ T         ++ Q++  VL+P+MD  ++NL+L A +CE+ VLKR+LKELW++ +  +E+ I+LPP +   Q  +   +    +    G  + L SH          +K L  +SK  DH       SL+P QC V+++ LD IK YFHAGG GLK ++LE+S +LQSLR+AL LY+Q TDLLIK F+ +Q +Q    +ED VGEVSV VELF HP TGEHK+T  ++A   L WQT+ +FRPF+E+ ++GP + +KKRK+ATKSK+N+W+P+YNESF F +S+   PE YE+Q+CVKDYCF R D+ +G  V+QL  L ++GS   WL LGR++H D+ G T+LRILSQR+ D++AKEFV+LKS  R +
Sbjct:  489 DSMPDIR-KRKPIPLVSDLAMSLVQSRKAGITSALAS----STLNNEELKNHVYKKTLQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKCHEKCQDLLNADCLQRAAEKSSKHGAEDRTQNIIMVLKDRMKIRERNKPEIFELIQEIFAVTKTAHTQQMKAVKQSVLDGTSKWSAKISITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIYGNLNPVWEENFHFECHNSSDRIKVRVWDEDDDIKSRVKQRFKRESDDFLGQTIIEVRTLSGEMDVWYNLDKRTDKSAVSGAIRLHISVEIKGEEKVAPYHVQYTCLHENLFHFVTDVQNNG----VVKIPDAKGDDAWKVYYDETAQEIVDEFAMRYGVESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSMYRNNFPASSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHELYSREYQTDPAKKGEVLPEEQGPSIKNLDFWSKLITLIVSIIEEDKNSYTPCLNQFPQELNVGKISAEVMWNLFAQDMKYAME-EHDKHRLCKSADYMNLHFKVKWLYNEYVTELPAFKDRVPEYPAWFEPFVIQWLDENEEVSRDFLHGALERDKKDGFQQTSEHALFSCSVVDVFSQLNQSFEIIKKLECPDPQIVGHYMRRFAKTISNVLLQYADIISKDFASYCSKEKEKVPCILMNNTQQLRVQLEKMFEAMGGKELDAEASDILKELQVKLNNVLDELSRVFATSFQPHIEECVKQMGDIL-SQVKGTGNVPASACSSVAQDADNVLQPIMDLLDSNLTLFAKICEKTVLKRVLKELWKLVMNTMEKTIVLPPLTD--QTMIGNLLRKHGKGLEKGRVK-LPSHSDGTQMIFNAAKELGQLSKLKDHMVREEAKSLTPKQCAVVELALDTIKQYFHAGGVGLKKTFLEKSPDLQSLRYALSLYTQATDLLIKTFVQTQSAQGL-GVEDPVGEVSVHVELFTHPGTGEHKVTVKVVAANDLKWQTSGIFRPFIEVNIIGPQLSDKKRKFATKSKNNSWAPKYNESFQFTLSADAGPECYELQVCVKDYCFAREDRTVGLAVLQLRELAQRGSAACWLPLGRRIHMDDTGLTVLRILSQRSNDEVAKEFVKLKSDTRSA 1694          
BLAST of Protein unc-13 homolog B vs. UniProt/SwissProt
Match: sp|Q4KUS2|UN13A_MOUSE (Protein unc-13 homolog A OS=Mus musculus OX=10090 GN=Unc13a PE=1 SV=3)

HSP 1 Score: 1478.38 bits (3826), Expect = 0.000e+0
Identity = 698/1221 (57.17%), Postives = 935/1221 (76.58%), Query Frame = 2
Query: 2909 DSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRD--QEPGDKIQ-NSDETGP--KNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYL--QKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKL--NLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQ---VPNSKILKDISKDTDH-------SLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIRQS 6514
            DS PDI+ ++K I LVSDL +  + ++K  + +A AS     +LN+EELK HVYKKTLQA+IYPIS  TPH+F+V  AT PT+CYECEGLLWG+ARQG+RC ECGVKCHEKC++LLNADCLQRAAEKSSKHGAE +TQ II  + D M+ R +N PEIF++I+++F+V + AH   +K+++QS+LDGTSKWSAKI+ITV CAQGL  KDKTG+SDPYVTVQVGK KKRTKT+   LNP W+E F+FECHNSS+RIKVRVWDED+D+KS+++Q+  RESDDFLGQTIIEVRTLSGEMDVWYNL+KRTDKSAVSGAIRL ISVEIKGEEKVAPYH+QYTCLHEN+FHF+ +   +     ++   +   ++ W++Y+D  +++I++EFAMRYG+ESIYQAMTHF+CL++K+MCPGVPAV+STLLANINAYYAHTT++TN SAS+RFAA+NFGKE+F+KLLDQLHNS++I+L +YRN F AS PERL DLKSTVDLLTSITFFRMKVQEL SPPRA QVV++CV+AC+ +TY+++F + +ELY R+   +P  K +   +E GP  KNL+FW KLI L+VS+IE+DK  Y P LNQFPQE+N+ +IS   MW   ++ ++ A+  E+ + +  K++DY+NL F++KW YN YV +LP  +D +P YP WFEP+VIQWL EN+EVS ++L  A ERDKKDGFQ++SEHAL+S SVVD+F+QLNQ F++IKKLECP+P I  H+M+RF+ T++ VLL YA ++ KD+  Y   +K++V CILMNN QQ+RV LEK+FEAMGG+ L+ +    + +LQ +L++V+D L+  FA  F+  IE  ++++  +L +Q++ T         ++ Q++  VL+P+MD  ++NL+L A +CE+ VLKR+LKELW++ +  +E+ I+LPP +   Q  +   +    +    G  + L SH          +K L  +SK  DH       SL+P QC V+++ LD IK YFHAGG GLK ++LE+S +LQSLR+AL LY+Q TDLLIK F+ +Q +Q +  +ED VGEVSV VELF HP TGE K+T  ++A   L WQT+ +FRPF+E+ ++GP + +KKRK+ATKSK+N+W+P+YNESF F +S+   PE YE+Q+CVKDYCF R D+ +G  V+QL  L ++GS   WL LGR++H D+ G T+LRILSQR+ D++AKEFV+LKS  R +
Sbjct:  498 DSMPDIR-KRKPIPLVSDLAMSLVQSRKAGITSALAS----STLNNEELKNHVYKKTLQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKCHEKCQDLLNADCLQRAAEKSSKHGAEDRTQNIIMVLKDRMKIRERNKPEIFELIQEIFAVTKSAHTQQMKAVKQSVLDGTSKWSAKISITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIYGNLNPVWEENFHFECHNSSDRIKVRVWDEDDDIKSRVKQRFKRESDDFLGQTIIEVRTLSGEMDVWYNLDKRTDKSAVSGAIRLHISVEIKGEEKVAPYHVQYTCLHENLFHFVTDVQNNG----VVKIPDAKGDDAWKVYYDETAQEIVDEFAMRYGVESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSMYRNNFPASSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHELYGREYQTDPAKKGEVPPEEQGPSIKNLDFWSKLITLIVSIIEEDKNSYTPCLNQFPQELNVGKISAEVMWSLFAQDMKYAME-EHDKHRLCKSADYMNLHFKVKWLYNEYVAELPTFKDRVPEYPAWFEPFVIQWLDENEEVSRDFLHGALERDKKDGFQQTSEHALFSCSVVDVFSQLNQSFEIIKKLECPDPQIVGHYMRRFAKTISNVLLQYADIVSKDFASYCSKEKEKVPCILMNNTQQLRVQLEKMFEAMGGKELDAEASGTLKELQVKLNNVLDELSHVFATSFQPHIEECVRQMGDIL-SQVKGTGNVPASACSSVAQDADNVLQPIMDLLDSNLTLFAKICEKTVLKRVLKELWKLVMNTMEKTIVLPPLTD--QTMIGTLLRKHGKGLEKGRVK-LPSHSDGTQMIFNAAKELGQLSKLKDHMVREEAKSLTPKQCAVVELALDTIKQYFHAGGVGLKKTFLEKSPDLQSLRYALSLYTQATDLLIKTFVQTQSAQGS-GVEDPVGEVSVHVELFTHPGTGEQKVTVKVVAANDLKWQTSGIFRPFIEVNIVGPQLSDKKRKFATKSKNNSWAPKYNESFQFSLSADAGPECYELQVCVKDYCFAREDRTVGLAVLQLRELAQRGSAACWLPLGRRIHMDDTGLTVLRILSQRSNDEVAKEFVKLKSDTRSA 1703          
BLAST of Protein unc-13 homolog B vs. TrEMBL
Match: H2KSB2 (Protein unc-13 homolog B (Fragment) OS=Clonorchis sinensis OX=79923 GN=CLF_108735 PE=4 SV=1)

HSP 1 Score: 1681 bits (4352), Expect = 0.000e+0
Identity = 793/1231 (64.42%), Postives = 992/1231 (80.58%), Query Frame = 2
Query: 2885 YGGFYKSIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRD-QEPGDKIQNSDETGP--KNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQS-SKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKLNLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKDISKD---TDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLG------------LGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIRQSPN 6520
            +  FY SIDS PDI+ +KK I+LVSDL   TM  QKRN+  A+A+L+TRQS+NDEELK HVYKKTLQA++YPISSNTPH FQV +AT PT+CYECEGLLWG+ARQGLRC ECGVKCH+KC+ELLNADCLQRAAEKS+K GA+ K Q II++M  LM+ R+   P++F ++ +VF V+++ HE +L   +QSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGK KKRTKTV QELNP W+EKF FECHN+S+RIK+RVWDED DLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRL ISVEIKGEEKVAPYH+QYTCLHENIFH+LCE N S+G+ E+    +   +E+W++YFD P+++I+ EFA+RYGIESIY+AMTHFSCLTTK+MC GVPA +S+LLANINA+YAHT++++N++ASERF+A+NFGKEKF+KLLDQLHNS++I+L +YRN+F ASQP++L DLKSTVDLLTSITFFRMKVQELSSPPRA QVVREC +ACM++TYQF++E+VNE+Y+R  QEP      +DE  P  K+LEFW +LI L+VSVI++DK  YA  +NQFPQEVN+  +S   MW+ LSE L  AL V     Q   K+SDY+NLCF++KWFYN +V   P+ +D +P YP+WFEP+V+QWL ENDEVS ++L+ AYERDK+DGFQ+SSEHAL+SNSVVD+FTQLNQCFDVIKKLECP+  +   F+ RFS TV+KVLL+YA ++K D+  ++ +QEVACI+MNNIQQ+RV LEKVFEAMGG +L  DT   M+DLQ  L  VID LA  +A   + EI   IKEL +LLH         N K ++E E+ ++L PLMD++EA LS LA +CE+ VLKRLLKEL+++++  LE+Q++LP  S  R +FLN+SI S AQ KI  +SQSLL++VS+Q+P S+IL+DISKD   T+ +L+P  CQ++D+ LDAIKSYFHAGG+GLK++YL++S ELQSLR+AL LY+QTTD LIKNF+++Q SQD  A+E+ VGEVS++V+L+RHPS GEHK+  T+IA   L W  T  FRPFVE+ L+GP +  KK ++ATKSK NTWSP++NE+F+FL+ +   PE+YE+ +C KDYCFGRAD+LIG TV+QL  L          G            LGR+LH D+ GWTILRILSQR  D+IA+EFV+LKS++R SPN
Sbjct:  823 HSSFYTSIDSMPDIRLKKKPIALVSDL---TMAVQKRNMGTASANLITRQSINDEELKQHVYKKTLQALLYPISSNTPHKFQVWSATSPTYCYECEGLLWGIARQGLRCTECGVKCHDKCRELLNADCLQRAAEKSTKQGADDKAQTIIQAMTALMRQRINECPDLFDLVGEVFKVDKKTHERNLAQAQQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKVKKRTKTVPQELNPVWNEKFCFECHNASDRIKIRVWDEDYDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLFISVEIKGEEKVAPYHVQYTCLHENIFHYLCETNKSKGEVEVKIP-DATGDESWKVYFDQPAQEIVTEFAIRYGIESIYEAMTHFSCLTTKYMCTGVPATMSSLLANINAFYAHTSASSNQTASERFSASNFGKEKFVKLLDQLHNSLRISLSMYRNSFPASQPDKLQDLKSTVDLLTSITFFRMKVQELSSPPRASQVVRECTRACMQSTYQFIYENVNEVYARQFQEP----VTADEGAPSLKSLEFWHRLITLLVSVIDEDKTTYATVINQFPQEVNMGHLSAICMWERLSEDLRIALEVHARAEQRYCKSSDYMNLCFKVKWFYNKHVAIAPEMKDKVPEYPRWFEPFVMQWLNENDEVSMDFLRNAYERDKRDGFQRSSEHALFSNSVVDVFTQLNQCFDVIKKLECPDTDVQERFLNRFSRTVSKVLLTYAEIVKADFKSWVGQQEVACIIMNNIQQMRVQLEKVFEAMGGNNLPEDTLTAMSDLQQMLHLVIDDLAAQYAQQLQGEIATKIKELSKLLH-----QCSPNSKASVESEADLILHPLMDHYEATLSALADLCEKTVLKRLLKELFKVSMHTLEKQVVLPTVSDPRALFLNLSIPSTAQAKISSVSQSLLTNVSSQLPASRILQDISKDTGVTERNLTPRHCQILDIALDAIKSYFHAGGSGLKSTYLDKSPELQSLRYALSLYTQTTDALIKNFVATQTSQDKPAIEETVGEVSIQVDLYRHPSHGEHKVMVTVIAANNLKWSGTGGFRPFVEVVLVGPLLAEKKHRFATKSKPNTWSPKFNETFTFLLGAGSDPESYELHLCAKDYCFGRADRLIGLTVLQLRDLSTPTRGGTGGGTPGSGACACICRLGRRLHMDDTGWTILRILSQRPQDEIAREFVRLKSEVR-SPN 2039          
BLAST of Protein unc-13 homolog B vs. TrEMBL
Match: A0A4S2M114 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003614 PE=4 SV=1)

HSP 1 Score: 1678.3 bits (4345), Expect = 0.000e+0
Identity = 793/1231 (64.42%), Postives = 993/1231 (80.67%), Query Frame = 2
Query: 2885 YGGFYKSIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRD-QEPGDKIQNSDETGP--KNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQS-SKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKLNLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKDISKD---TDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRL------------IEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIRQSPN 6520
            +  FY SIDS PDI+ +KK I+LVSDL   TM  QKRN+  A+A+L+TRQS+NDEELK HVYKKTLQA++YPISSNTPH FQV +AT PT+CYECEGLLWG+ARQGLRC ECGVKCH+KC+ELLNADCLQRAAEKS+K GA+ K Q II++M  LM+ R+   P++F ++ +VF V+++ HE +L   +QSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGK KKRTKTV QELNP W+EKF FECHN+S+RIK+RVWDED DLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRL ISVEIKGEEKVAPYH+QYTCLHENIFH+LCE N S+G+ E+    +   +E+W++YFD P+++I+ EFA+RYGIESIY+AMTHFSCLTTK+MC GVPA +S+LLANINA+YAHT++++N++ASERF+A+NFGKEKF+KLLDQLHNS++I+L +YRN+F ASQP++L DLKSTVDLLTSITFFRMKVQELSSPPRA QVVREC +ACM++TYQF++E+VNE+Y+R  QEP      +DE  P  K+LEFW +LI L+VSVI++DK  YA  +NQFPQEVN+  +S   MW+ LSE L  AL V     Q   K+SDY+NLCF++KWFYN +V   P+ +D +P YP+WFEP+V+QWL ENDEVS ++L+ AYERDK+DGFQ+SSEHAL+SNSVVD+FTQLNQCFDVIKKLECP+  +   F+ RFS TV+KVLL+YA ++K D+  ++ +QEVACI+MNNIQQ+RV LEKVFEAMGG +L  DT   M+DLQ  L  VID LA  +A   + EI   IKEL +LLH         N K ++E E+ ++L PLMD++EA LS LA +CE+ VLKRLLKEL+++++  LE+Q++LP  S  R +FLN+SI S AQ KI  +SQSLL++VS+Q+P S+IL+DISKD   T+ +L+P  CQ++D+ LDAIKSYFHAGG+GLK++YL++S ELQSLR+AL LY+QTTD LIKNF+++Q SQD  A+E+ VGEVS++V+L+RHPS GEHK+  T+IA   L W  T  FRPFVE+ L+GP +  KK ++ATKSK NTWSP++NE+F+FL+ +   PE+YE+ +C KDYCFGRAD+LIG TV+QL  L               G+      LGR+LH D+ GWTILRILSQR  D+IA+EFV+LKS++R SPN
Sbjct: 1521 HSSFYTSIDSMPDIRLKKKPIALVSDL---TMAVQKRNMGTASANLITRQSINDEELKQHVYKKTLQALLYPISSNTPHKFQVWSATSPTYCYECEGLLWGIARQGLRCTECGVKCHDKCRELLNADCLQRAAEKSTKQGADDKAQTIIQAMTALMRQRINECPDLFDLVGEVFKVDKKTHERNLSQAQQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKVKKRTKTVPQELNPVWNEKFCFECHNASDRIKIRVWDEDYDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLFISVEIKGEEKVAPYHVQYTCLHENIFHYLCETNKSKGEVEVKIP-DATGDESWKVYFDQPAQEIVTEFAIRYGIESIYEAMTHFSCLTTKYMCTGVPATMSSLLANINAFYAHTSASSNQTASERFSASNFGKEKFVKLLDQLHNSLRISLSMYRNSFPASQPDKLQDLKSTVDLLTSITFFRMKVQELSSPPRASQVVRECTRACMQSTYQFIYENVNEVYARQFQEP----VTADEGAPSLKSLEFWHRLITLLVSVIDEDKTTYATVINQFPQEVNMGHLSAICMWERLSEDLRIALEVHARAEQRYCKSSDYMNLCFKVKWFYNKHVAIAPEMKDKVPEYPRWFEPFVMQWLNENDEVSMDFLRNAYERDKRDGFQRSSEHALFSNSVVDVFTQLNQCFDVIKKLECPDTDVQERFLNRFSRTVSKVLLTYAEIVKADFKSWVGQQEVACIIMNNIQQMRVQLEKVFEAMGGNNLPEDTLTAMSDLQQMLHLVIDDLAAQYAQQLQGEITTKIKELSKLLH-----QCSPNSKASVESEADLILHPLMDHYEATLSALADLCEKTVLKRLLKELFKVSMHTLEKQVVLPTVSDPRALFLNLSIPSTAQAKISSVSQSLLTNVSSQLPASRILQDISKDTGVTERNLTPRHCQILDIALDAIKSYFHAGGSGLKSTYLDKSPELQSLRYALSLYTQTTDALIKNFVATQTSQDKPAIEETVGEVSIQVDLYRHPSHGEHKVMVTVIAANNLKWSGTGGFRPFVEVILVGPLLAEKKHRFATKSKPNTWSPKFNETFTFLLGAGSDPESYELHLCAKDYCFGRADRLIGLTVLQLRDLSTPTRGGSGGGTPGSGACACICRLGRRLHMDDTGWTILRILSQRPQDEIAREFVRLKSEVR-SPN 2737          
BLAST of Protein unc-13 homolog B vs. TrEMBL
Match: A0A419Q3K1 (Protein unc-13-like protein B OS=Clonorchis sinensis OX=79923 GN=Unc13b PE=4 SV=1)

HSP 1 Score: 1677.92 bits (4344), Expect = 0.000e+0
Identity = 793/1231 (64.42%), Postives = 992/1231 (80.58%), Query Frame = 2
Query: 2885 YGGFYKSIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRD-QEPGDKIQNSDETGP--KNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQS-SKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKLNLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKDISKD---TDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLG------------LGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIRQSPN 6520
            +  FY SIDS PDI+ +KK I+LVSDL   TM  QKRN+  A+A+L+TRQS+NDEELK HVYKKTLQA++YPISSNTPH FQV +AT PT+CYECEGLLWG+ARQGLRC ECGVKCH+KC+ELLNADCLQRAAEKS+K GA+ K Q II++M  LM+ R+   P++F ++ +VF V+++ HE +L   +QSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGK KKRTKTV QELNP W+EKF FECHN+S+RIK+RVWDED DLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRL ISVEIKGEEKVAPYH+QYTCLHENIFH+LCE N S+G+ E+    +   +E+W++YFD P+++I+ EFA+RYGIESIY+AMTHFSCLTTK+MC GVPA +S+LLANINA+YAHT++++N++ASERF+A+NFGKEKF+KLLDQLHNS++I+L +YRN+F ASQP++L DLKSTVDLLTSITFFRMKVQELSSPPRA QVVREC +ACM++TYQF++E+VNE+Y+R  QEP      +DE  P  K+LEFW +LI L+VSVI++DK  YA  +NQFPQEVN+  +S   MW+ LSE L  AL V     Q   K+SDY+NLCF++KWFYN +V   P+ +D +P YP+WFEP+V+QWL ENDEVS ++L+ AYERDK+DGFQ+SSEHAL+SNSVVD+FTQLNQCFDVIKKLECP+  +   F+ RFS TV+KVLL+YA ++K D+  ++ +QEVACI+MNNIQQ+RV LEKVFEAMGG +L  DT   M+DLQ  L  VID LA  +A   + EI   IKEL +LLH         N K ++E E+ ++L PLMD++EA LS LA +CE+ VLKRLLKEL+++++  LE+Q++LP  S  R +FLN+SI S AQ KI  +SQSLL++VS+Q+P S+IL+DISKD   T+ +L+P  CQ++D+ LDAIKSYFHAGG+GLK++YL++S ELQSLR+AL LY+QTTD LIKNF+++Q SQD  A+E+ VGEVS++V+L+RHPS GEHK+  T+IA   L W  T  FRPFVE+ L+GP +  KK ++ATKSK NTWSP++NE+F+FL+ +   PE+YE+ +C KDYCFGRAD+LIG TV+QL  L          G            LGR+LH D+ GWTILRILSQR  D+IA+EFV+LKS++R SPN
Sbjct: 1558 HSSFYTSIDSMPDIRLKKKPIALVSDL---TMAVQKRNMGTASANLITRQSINDEELKQHVYKKTLQALLYPISSNTPHKFQVWSATSPTYCYECEGLLWGIARQGLRCTECGVKCHDKCRELLNADCLQRAAEKSTKQGADDKAQTIIQAMTALMRQRINECPDLFDLVGEVFKVDKKTHERNLAQAQQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKVKKRTKTVPQELNPVWNEKFCFECHNASDRIKIRVWDEDYDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLFISVEIKGEEKVAPYHVQYTCLHENIFHYLCETNKSKGEVEVKIP-DATGDESWKVYFDQPAQEIVTEFAIRYGIESIYEAMTHFSCLTTKYMCTGVPATMSSLLANINAFYAHTSASSNQTASERFSASNFGKEKFVKLLDQLHNSLRISLSMYRNSFPASQPDKLQDLKSTVDLLTSITFFRMKVQELSSPPRASQVVRECTRACMQSTYQFIYENVNEVYARQFQEP----VTADEGAPSLKSLEFWHRLITLLVSVIDEDKTTYATVINQFPQEVNMGHLSAICMWERLSEDLRIALEVHARAEQRYCKSSDYMNLCFKVKWFYNKHVAIAPEMKDKVPEYPRWFEPFVMQWLNENDEVSMDFLRNAYERDKRDGFQRSSEHALFSNSVVDVFTQLNQCFDVIKKLECPDTDVQERFLNRFSRTVSKVLLTYAEIVKADFKSWVGQQEVACIIMNNIQQMRVQLEKVFEAMGGNNLPEDTLTAMSDLQQMLHLVIDDLAAQYAQQLQGEIATKIKELSKLLH-----QCSPNSKASVESEADLILHPLMDHYEATLSALADLCEKTVLKRLLKELFKVSMHTLEKQVVLPTVSDPRALFLNLSIPSTAQAKISSVSQSLLTNVSSQLPASRILQDISKDTGVTERNLTPRHCQILDIALDAIKSYFHAGGSGLKSTYLDKSPELQSLRYALSLYTQTTDALIKNFVATQTSQDKPAIEETVGEVSIQVDLYRHPSHGEHKVMVTVIAANNLKWSGTGGFRPFVEVVLVGPLLAEKKHRFATKSKPNTWSPKFNETFTFLLGAGSDPESYELHLCAKDYCFGRADRLIGLTVLQLRDLSTPTRGGTGGGTPGSGACACICRLGRRLHMDDTGWTILRILSQRPQDEIAREFVRLKSEVR-SPN 2774          
BLAST of Protein unc-13 homolog B vs. TrEMBL
Match: A0A0X3PEQ8 (Uncharacterized protein (Fragment) OS=Schistocephalus solidus OX=70667 GN=TR160163 PE=4 SV=1)

HSP 1 Score: 1647.1 bits (4264), Expect = 0.000e+0
Identity = 773/1230 (62.85%), Postives = 988/1230 (80.33%), Query Frame = 2
Query: 2849 GTRRHEDGLDHDYGGFYKSIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRDQEPGDKIQNSDETGP--KNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVE-NIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKLNLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKDISKDTDHS----LSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRL--------IEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQL 6493
            G+      L  ++  FY +IDS PD K +KK ISLVSDLV+QTM  QKRN+  A+A+L+TRQS+NDEELK HVYKKTLQA++YPISS+TPH FQV +AT PT+CYECEG+LWG+ARQGLRC ECGVKCHEKC+ELLNADCLQRAAEKS+KHGAE KTQ+I ++M+ LM+ R+   PE+F ++  VF +  E H+ +L   +QSILDGTS+WSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGK KKRTKTV QELNP W+EKFYFECHN+++RIK+RVWDEDNDL+SK+R KLT ESDDFLGQTII+VRTLSGEMDVWYNLEKRTDKSAVSGAIRL ISVEIKGEEKVAPYH+QYTCLHENIF++LCE N + G+PE+     +  +++W++YFD PS++I+ EFA+RYGIE++YQAMTHFSCLTTKFMC GVPA +S LLANINA+YAHT++++N++ASERF+A+NFGKEKF+KLLDQ HNS++I+L +YRN F ASQP++L DLKSTVDLLTSITFFRMKVQEL+SPPRA QVV+EC QACM+TTYQFL+++ N+LY+R  +  +KI  +DE GP  K+L+FW +LI L+VSVIE+DK  YA  +NQFPQE N+  I  S MW  LSE L  AL     ++ +  KTSDY+NLCF++KWFY  ++ ++PD Q+  P+YP WFEP+V+QWL ENDE+S ++L+ AY+RDKKDGF +SSE AL+SNSVVD+FTQLNQCFD++KK+ECP+P +++ F+ RFS TV KVLL+YA ++K DY  + + QE ACILMNNIQQ RV LE+V+EAMGG+SL+ DTK  M DLQ  L+DVID +A+ ++   E +I   IKE+++LLH Q   +A      N+E E+  +LRPLMD+FE+ LS+ A +CE+ VLKR+LKELW+IT++  E+Q+ILP  S    +FL++SI S AQ K+  +SQ+LLS+VSNQ+P SK+ ++ISK+T  +    L+P  CQ+++M L+AIK+YFHAGG+GLKN+YLERS ELQSL++AL LY+QTTD LIK F+S+Q +QD  A+ED VGE+S++V+LFRHPS GEH++T TIIA   L W T   FRPFVE+ L+GP +  KKRK+ATK+KSN WSP +NES +F + +   PE+YE+ +C KDYCFGR+D L+G TV+QL  L        I  G+   W  LGR+L+ D+ GWTILRILSQR  D++A+EFV+L
Sbjct: 1791 GSLSRSPNLGDNHYSFY-NIDSMPDFKCKKKPISLVSDLVIQTMAVQKRNMGTASANLITRQSINDEELKQHVYKKTLQALLYPISSDTPHKFQVWSATSPTYCYECEGMLWGLARQGLRCTECGVKCHEKCRELLNADCLQRAAEKSAKHGAEDKTQSIKQAMSALMRQRINAMPELFDLVGKVFKMATERHKQNLIQAQQSILDGTSQWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKVKKRTKTVPQELNPVWNEKFYFECHNATDRIKIRVWDEDNDLRSKLRSKLTSESDDFLGQTIIDVRTLSGEMDVWYNLEKRTDKSAVSGAIRLHISVEIKGEEKVAPYHVQYTCLHENIFYYLCETNKNNGQPEVKVTDIKG-DDSWKVYFDSPSQEIVTEFAIRYGIETMYQAMTHFSCLTTKFMCTGVPAKMSCLLANINAFYAHTSASSNQTASERFSASNFGKEKFVKLLDQFHNSLRISLSMYRNCFPASQPDKLQDLKSTVDLLTSITFFRMKVQELTSPPRASQVVKECAQACMQTTYQFLYDNANDLYARQFQ--EKI-TTDEAGPSLKSLDFWHRLIALLVSVIEEDKTTYATVINQFPQEANIGHICASCMWTRLSEDLSVALEQHAQVKERCCKTSDYMNLCFKVKWFYKTHIAEVPDMQNQTPSYPLWFEPFVMQWLNENDEISMDFLRNAYQRDKKDGFHRSSEQALFSNSVVDVFTQLNQCFDIMKKMECPDPEVNARFINRFSHTVGKVLLTYAEVVKADYDHWRETQETACILMNNIQQCRVQLERVYEAMGGDSLQEDTKVVMQDLQQMLNDVIDDMAQKYSVALEPQILRQIKEVNKLLH-QCSSSANA----NVEAEADNILRPLMDHFESTLSVYADICEKTVLKRILKELWKITLRTFEKQVILPSVSDPSAMFLSLSIPSNAQAKLSSVSQTLLSNVSNQLPASKLFQEISKETGAASLKNLTPWHCQILNMALEAIKNYFHAGGSGLKNTYLERSPELQSLQYALSLYTQTTDSLIKIFVSTQTAQDKPAVEDGVGELSIQVDLFRHPSHGEHRVTVTIIAANNLKWVTNGTFRPFVEVNLIGPLLAQKKRKFATKTKSNVWSPMFNESCTFHLGAGSDPESYELHMCAKDYCFGRSDHLVGLTVLQLRDLTASADTLGIGSGACACWCALGRRLNLDDTGWTILRILSQRPQDEVAREFVRL 3010          
BLAST of Protein unc-13 homolog B vs. TrEMBL
Match: A0A5K3F8G1 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 1636.7 bits (4237), Expect = 0.000e+0
Identity = 775/1251 (61.95%), Postives = 1004/1251 (80.26%), Query Frame = 2
Query: 2882 DYGGFYKSIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRDQEPGDKIQNSDETGP--KNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRS-QSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGG-ESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKLNLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKDISKD----TDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQL---------IRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIRQSPNSQG*RIAQSS*SLASNLHQIK 6583
            +Y  FY +IDS PD K +KK ISLVSDLV  TM  QKRN+  A+A+L+TRQS+NDEELK HVYKKTLQA++YPISS+TPH FQV +AT PT+CYECEG+LWG+ARQGLRC ECGVKCHEKC+ELLNADCLQRAAEKS KHGAE +TQ+I ++M+ LM  RV++ PE+F ++  VF V + AH+ +L+  ++SILDGTS+WSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGK KKRTKTV QELNP W+EKFYFECHN ++RIK+RVWDEDNDL+SK+R KLT ESDDFLGQTII+VRTLSGEMDVWYNLEKRTDKSAVSGAIRL ISVEIKGEEKVAPYH+QYTCLHENIF++LCE N   G+PE+     +  +++W++YFD P+++II EFA+RYGIE++YQAMTHFSCLTTKFMC  VPA +S LLANINA+YAHT+++ N++ASERF+A+NFGKEKF+KLLDQLHNS++I+L +YRN F ASQP++L DLKSTVDLLTSITFFRMKVQEL+SPPRA QVV+EC QACM TTYQFL+++ N+LY+R  +  +K+ ++DE GP  K+L+FW +LI L+VSVIE+DK  YA  +NQFPQE N+  IS   MW  LSE L  AL      S +  KTSDY+NLCF++KWFYN ++ ++P+ + V+P YP WFEP+V+QWL ENDE+S +YL+ AY+RDKKDGF +SS  AL+SNSVVD+FTQLNQCFD++KKLECP+P ++  F+ RFS TV KVLL+YA ++K D+  +++ QE ACILMNNIQQ RV LEKV+EAMGG ++L+  T++ M+DLQ  L+DVID +A+ ++     +I   +KE+++LLH QI      N K ++E E+ ++LRPLMD+FE++LS+ A +CE+ VLKR+LKELW+IT+   E+Q++LPP S    +FLN+SI S A  K+  +SQ+LLS+VS+Q+PN+K+L+++SK+    T  +L+P  CQ++D+ LDAIKSYFHAGG+GLKNSYLE S E QSL++ L LY+QTTD LIKNF+ +Q SQD  A+E++VGE+S++V+LFRHPS GEHK+T +I++   L WQT+  FRPFVE+Y+LGP + +KKRK+ATKSK+  WSP +NES +FL+ +   P++YE+ +C KDYCFGR+D+LIG TV+QL         + L   GS   W  LG +L+ D+ GWTILRILSQR  D++A+EFV+LKS++R   +S    +A+++ S  S L + K
Sbjct:  116 NYFSFY-NIDSLPDFKLKKKPISLVSDLVRLTMAVQKRNMGTASANLITRQSINDEELKQHVYKKTLQALLYPISSDTPHKFQVWSATGPTYCYECEGMLWGLARQGLRCTECGVKCHEKCRELLNADCLQRAAEKSIKHGAEDRTQSIKQAMSALMHQRVQDKPELFDLVAKVFKVTD-AHKQNLQQAQKSILDGTSQWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKVKKRTKTVPQELNPVWNEKFYFECHNGTDRIKIRVWDEDNDLRSKLRSKLTSESDDFLGQTIIDVRTLSGEMDVWYNLEKRTDKSAVSGAIRLHISVEIKGEEKVAPYHVQYTCLHENIFYYLCETNKKNGEPEVKIPKVKG-DDSWKVYFDSPAQEIITEFAIRYGIETMYQAMTHFSCLTTKFMCTKVPATMSCLLANINAFYAHTSASGNQTASERFSASNFGKEKFVKLLDQLHNSLRISLSMYRNCFPASQPDKLQDLKSTVDLLTSITFFRMKVQELTSPPRASQVVKECAQACMHTTYQFLYDNANDLYARQFQ--EKV-STDEPGPSLKSLDFWHRLIALLVSVIEEDKTTYAAVINQFPQEANMGLISAYCMWTRLSEDLSAALEQHAAASNRYCKTSDYMNLCFKVKWFYNTHIAEVPELKSVVPAYPSWFEPFVMQWLNENDEISMDYLRNAYQRDKKDGFHRSSGQALFSNSVVDVFTQLNQCFDIMKKLECPDPVVNDRFLNRFSQTVGKVLLTYAEVVKADFGHWVEFQETACILMNNIQQCRVQLEKVYEAMGGDQNLKEYTREVMHDLQQMLNDVIDEMAERYSVALRPQILAKVKEVNKLLH-QISS----NSKASIESEADLILRPLMDHFESSLSVYADICEKTVLKRILKELWKITMYTFEKQVVLPPVSDPSALFLNLSIPSNATAKLSSVSQTLLSNVSSQLPNNKLLQEMSKESANLTLRNLTPRHCQILDIALDAIKSYFHAGGSGLKNSYLENSPEFQSLQYILSLYTQTTDALIKNFVFTQKSQDKPAVENSVGELSIQVDLFRHPSNGEHKVTVSILSANNLKWQTSGTFRPFVEVYILGPLLADKKRKFATKSKTGVWSPTFNESCTFLLGAGSDPDSYELHLCAKDYCFGRSDRLIGLTVLQLRDLTASTDTLGLGTSGSCACWCALGSRLNLDDTGWTILRILSQRPSDEVAREFVRLKSEVRGQDDS----VAKTTGSAPSTLRRGK 1351          
BLAST of Protein unc-13 homolog B vs. Ensembl Cavefish
Match: ENSAMXT00000049675.1 (pep primary_assembly:Astyanax_mexicanus-2.0:20:15823549:15937399:1 gene:ENSAMXG00000017447.2 transcript:ENSAMXT00000049675.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1443.71 bits (3736), Expect = 0.000e+0
Identity = 686/1216 (56.41%), Postives = 913/1216 (75.08%), Query Frame = 2
Query: 2888 GGFYKSIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRDQEPGDKIQNSDETGP--KNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKLNLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSG-----FRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKDISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIRQS 6514
            G     IDS PD++ ++K I LVSD+ L     Q R    A+A + +R S+ DEELK HVYKKTLQA+IYPIS  TPH+F+V  AT PT+CYECEGLLWG+ARQG+RC ECGVKCHEKC+ELLNADCLQRAAEKSSKHGAE +TQ II +M D M+ R +N PEIF++I+DVF V +  H   +K+I+QS+LDGTSKWSAKI ITV CAQGL  KDKTG+SDPYVTVQVGK KKRTKT+   LNP WDEK++FECHNSS+RIKVRVWDED+D+KS+++Q+L RESDDFLGQ+IIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYH+QYTCLHEN+FH    +   QG   +  A     ++ W++YFD  +++I++EFAMRYGIESIYQAMTHF+CL++K+MCPGVPAV+STLLANINA+YAHTT++TN SAS+RF+A+NFGKE+F+KLLDQLHNS++I+L +YRN F AS  +RL DLKSTVDLLTSITFFRMKVQEL SPPRA QVVR+CV+AC+ +TY ++F +  ELYSR  +P  +    +E GP  KNL+FW KLI L+VS+IE+D+  Y P LNQFPQE+N+ ++    MW   S+ ++ A+  E+ + +  K++DY+NL F++KW YN YV DLP  + VIP YP WF  +V+QWL EN++VS  ++  A ERDKKDGFQ++SEHAL+S SVVDIFTQLNQ F++IKKL+CP+P + +H+ +RF+ T+ KVLL Y++++KK +  Y  K+++ C+LMNN+QQ+RV LEK+FE+MG + ++++  D +N+LQ +L++V+D L+ +FA+ F+  I+  ++++  LL+ QI+     N +  +E ++  VLRPLMD+ + NL+L ASVCE+ VLKR+LKELWRI +  LE+ I+LP  +      F   F    +S +A+                                 SL+P QC VMD+ LD IK YFHAGGNGLK ++LE+S EL SLRHAL LY+QTTD LIK F+++Q +Q +  ++  VGEV+VKV                 +A   L WQT+ +FRPFVE+ ++GP++ +KKRK+ TKSK+N+W+P++NE+F F++ + + PE YE+Q+CVKDYCFGRAD+++G  +IQL  + ++ S   W  LG ++H D+ G T++RILSQR+GD++AKEFV+LKS+ R +
Sbjct:  390 GSGLFGIDSMPDLR-KRKPIPLVSDVSL----VQARKAGIASA-MASRSSIKDEELKSHVYKKTLQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKCHEKCQELLNADCLQRAAEKSSKHGAEDRTQNIIMAMKDRMKIRERNKPEIFEVIRDVFMVTKALHGQQMKTIKQSVLDGTSKWSAKITITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIYGNLNPIWDEKYHFECHNSSDRIKVRVWDEDDDIKSRVKQRLKRESDDFLGQSIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHVQYTCLHENLFHHT-TDVLGQGAVRIPDARG---DDAWKVYFDDVAQEIVDEFAMRYGIESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAFYAHTTASTNVSASDRFSASNFGKERFVKLLDQLHNSLRIDLSMYRNNFPASSKDRLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVRDCVKACLNSTYDYIFNNCQELYSRQYQPNKEECPPEEQGPSIKNLDFWPKLITLIVSIIEEDRNSYTPVLNQFPQELNVGKVCAEVMWIQFSQDMKYAME-EHEKHRLCKSADYMNLHFKVKWLYNEYVKDLPAFKGVIPEYPTWFLQFVLQWLDENEDVSMEFMHGALERDKKDGFQQTSEHALFSCSVVDIFTQLNQSFEIIKKLDCPDPKVMAHYSRRFAKTIAKVLLQYSAILKKSFPSYCDKEKIPCVLMNNVQQLRVQLEKMFESMGAKQMDSEASDVLNELQVKLNNVLDELSSTFANTFQTRIDECMRQMASLLY-QIKGPVNANSRNQVEGDADNVLRPLMDFLDGNLTLFASVCEKTVLKRVLKELWRIVMNSLEKTIVLPQGNDTFVRPFSVFFFQDHMSGEAK---------------------------------SLTPKQCAVMDVALDTIKQYFHAGGNGLKKAFLEKSPELTSLRHALSLYTQTTDTLIKTFVTTQHTQGS-GVDKPVGEVTVKV-----------------VAANDLKWQTSGMFRPFVEVTMIGPHLSDKKRKFTTKSKNNSWAPKFNETFHFILGNEDGPECYELQVCVKDYCFGRADRVVGIAMIQLRDVAQRASCACWCPLGTQVHMDDTGLTVMRILSQRSGDEVAKEFVKLKSETRSA 1542          
BLAST of Protein unc-13 homolog B vs. Ensembl Cavefish
Match: unc13a (protein unc-13 homolog A-like [Source:NCBI gene;Acc:103031140])

HSP 1 Score: 1425.61 bits (3689), Expect = 0.000e+0
Identity = 679/1237 (54.89%), Postives = 913/1237 (73.81%), Query Frame = 2
Query: 2888 GGFYKSIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTT-STTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRD-QEPGDKIQNSDETGP--KNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKLNLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKDISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHA-------------------MEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIRQSPNSQG 6529
            GG   SIDS PD++ ++K+I LV DL L    ++K  + +A A      +LN+EELK HVYKKTLQA+IYPIS  TPH+F+V  AT PT+CYECEGLLWG+ARQG+RC ECGVKCHEKC++LLNADCLQRAAEKSSKHGAE +TQ II  + D M+ R +N PEIF++I++VF+V +  H   +K I+QS+LDGTSKWSAKI+ITV CAQGL  KDKTG+SDPYVTVQVGK KKRTKT+   LNP W+E F+FECHNSS+RIKVRVWDED+D+KS+++QK  RESDDFLGQTIIEVRTLSGEMDVWYNL+KRTDKSAVSGAIR+ ISVEIKGEE VAPYHIQYTCLHE++FH+  EE  S     ++       ++ W++YF+  +++I++EFAMRYG+ESIYQAMTHF+CL++K+MCPGVPAV+STLLANINAYYAHTT S+ N SAS+RFAA+NFGKE+F+KLLDQLHNS++I+L +YRN F AS PERL DLKSTVDLLTSITFFRMKVQEL SPPRA QVV++CV+AC+ +TY+++F + +ELY R+ Q    K    +E GP  KNL+FW KLI L+VS+IE+DK  Y P LNQFPQE+N+ +IS   MW   ++ +  A+  E+ +++  K++DY+NL F++KW YN Y  +LP S+D +P YP WFEP+VI WL EN+EVS ++L  A  RD KDGFQ++SEHAL+S SVVD+F+QLNQ F++I+KLECP+P I   +MKRF+ T+  VLLSYA +I KD+  +  K++V CI++NNIQQ+RV LEK+FEAMGG+ L  +  D + DLQ +L+ V+D L++ FA  F+  IE +I+++  +L          N   +L Q++  VL+P+MD+ ++NL+L A +CE+ VLKR+LKELW++ +  +E+ I+LP             ++ Q   +++  +   L  +      SK+ + + ++   +L+P QC V+++ LD IK YFHAGG GLK ++LE+S +L+SL +AL LY+Q TD LI+ FI SQ +Q  H                    ++D VGEV++ +E+   P+ G HKI   +++   L WQT  +FRPFVE+Y++GP++ +KKRK+ATKSK+N+WSP++ ES  F + S   PE YE+ +CVKDYCF R D+ +G  ++QL  ++ +GS   WL LG+++H D  G T+LRILSQR  D++AKEFV+LKS  R +   +G
Sbjct:  684 GGALYSIDSMPDLR-KRKAIPLVRDLSL-VQNSRKAGITSAMAC----STLNNEELKSHVYKKTLQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCSECGVKCHEKCQDLLNADCLQRAAEKSSKHGAEDRTQNIIMVLKDRMKIRERNKPEIFELIQEVFAVAKATHGTQMKQIKQSVLDGTSKWSAKISITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIYGNLNPVWEENFHFECHNSSDRIKVRVWDEDDDIKSRVKQKFKRESDDFLGQTIIEVRTLSGEMDVWYNLDKRTDKSAVSGAIRMHISVEIKGEETVAPYHIQYTCLHEHLFHYTTEEQNSG----VVKIPEAKGDDAWKVYFEETAQEIVDEFAMRYGVESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTQSSNNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSMYRNNFPASSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHELYGREYQTDPSKSVPPEEQGPSIKNLDFWSKLITLIVSIIEEDKNSYTPCLNQFPQELNVGKISAEVMWNMFAQDMRYAME-EHEKNRLCKSADYMNLHFKVKWLYNEYCKELPCSKDRVPEYPAWFEPFVILWLDENEEVSKDFLHGALARDAKDGFQQTSEHALFSCSVVDVFSQLNQSFEIIRKLECPDPQIVGSYMKRFAKTIGTVLLSYADIIAKDFPNHCNKEKVPCIIINNIQQLRVQLEKMFEAMGGKDLNVEASDFLKDLQVKLNTVMDDLSRIFAVSFQPHIEVSIRQMGDILSQVKGANVPANGNGSLAQDADNVLQPIMDFLDSNLTLFAKICEKTVLKRVLKELWKLVMNTMEKTIVLP------------QLTDQTGTQLIFNAAKELGQL------SKLKEHMVREEAKALTPKQCAVIELALDTIKQYFHAGGVGLKKTFLEKSPDLKSLHYALSLYTQATDKLIRKFIQSQHTQ-VHGGKGVRFTPSEDVLPEKAANVDDPVGEVTMTIEVLNDPNGGGHKINVKVVSANDLRWQTQGIFRPFVEVYIIGPHLSDKKRKFATKSKNNSWSPKFVESVQFSLGSELGPEGYELHVCVKDYCFAREDRTVGMALVQLKDVVARGSGAYWLPLGKRVHMDETGLTVLRILSQRNNDEVAKEFVKLKSDQRSAEEGRG 1890          
BLAST of Protein unc-13 homolog B vs. Ensembl Cavefish
Match: unc13a (protein unc-13 homolog A-like [Source:NCBI gene;Acc:103031140])

HSP 1 Score: 1398.65 bits (3619), Expect = 0.000e+0
Identity = 653/1167 (55.96%), Postives = 883/1167 (75.66%), Query Frame = 2
Query: 3038 LNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTT-STTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRDQEPGDKIQNSDETGP--KNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKLNLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKDISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIRQSPNSQG 6529
            L++++   HVYKKTLQA+IYPIS  TPH+F+V  AT PT+CYECEGLLWG+ARQG+RC ECGVKCHEKC++LLNADCLQRAAEKSSKHGAE +TQ II  + D M+ R +N PEIF++I++VF+V +  H   +K I+QS+LDGTSKWSAKI+ITV CAQGL  KDKTG+SDPYVTVQVGK KKRTKT+   LNP W+E F+FECHNSS+RIKVRVWDED+D+KS+++QK  RESDDFLGQTIIEVRTLSGEMDVWYNL+KRTDKSAVSGAIR+ ISVEIKGEE VAPYHIQYTCLHE++FH+  EE  S     ++       ++ W++YF+  +++I++EFAMRYG+ESIYQAMTHF+CL++K+MCPGVPAV+STLLANINAYYAHTT S+ N SAS+RFAA+NFGKE+F+KLLDQLHNS++I+L +YRN F AS PERL DLKSTVDLLTSITFFRMKVQEL SPPRA QVV++CV+AC+ +TY+++F + +ELY R+ +    +   +E GP  KNL+FW KLI L+VS+IE+DK  Y P LNQFPQE+N+ +IS   MW   ++ +  A+  E+ +++  K++DY+NL F++KW YN Y  +LP S+D +P YP WFEP+VI WL EN+EVS ++L  A  RD KDGFQ++SEHAL+S SVVD+F+QLNQ F++I+KLECP+P I   +MKRF+ T+  VLLSYA +I KD+  +  K++V CI++NNIQQ+RV LEK+FEAMGG+ L  +  D + DLQ +L+ V+D L++ FA  F+  IE +I+++  +L          N   +L Q++  VL+P+MD+ ++NL+L A +CE+ VLKR+LKELW++ +  +E+ I+LP             ++ Q   +++  +   L  +      SK+ + + ++   +L+P QC V+++ LD IK YFHAGG GLK ++LE+S +L+SL +AL LY+Q TD LI+ FI SQ +Q  + ++D VGEV++ +E+   P+ G HKI   +++   L WQT  +FRPFVE+Y++GP++ +KKRK+ATKSK+N+WSP++ ES  F + S   PE YE+ +CVKDYCF R D+ +G  ++QL  ++ +GS   WL LG+++H D  G T+LRILSQR  D++AKEFV+LKS  R +   +G
Sbjct:  340 LSEDQEPPHVYKKTLQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCSECGVKCHEKCQDLLNADCLQRAAEKSSKHGAEDRTQNIIMVLKDRMKIRERNKPEIFELIQEVFAVAKATHGTQMKQIKQSVLDGTSKWSAKISITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIYGNLNPVWEENFHFECHNSSDRIKVRVWDEDDDIKSRVKQKFKRESDDFLGQTIIEVRTLSGEMDVWYNLDKRTDKSAVSGAIRMHISVEIKGEETVAPYHIQYTCLHEHLFHYTTEEQNSG----VVKIPEAKGDDAWKVYFEETAQEIVDEFAMRYGVESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTQSSNNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSMYRNNFPASSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHELYGREYQTDPSVP-PEEQGPSIKNLDFWSKLITLIVSIIEEDKNSYTPCLNQFPQELNVGKISAEVMWNMFAQDMRYAME-EHEKNRLCKSADYMNLHFKVKWLYNEYCKELPCSKDRVPEYPAWFEPFVILWLDENEEVSKDFLHGALARDAKDGFQQTSEHALFSCSVVDVFSQLNQSFEIIRKLECPDPQIVGSYMKRFAKTIGTVLLSYADIIAKDFPNHCNKEKVPCIIINNIQQLRVQLEKMFEAMGGKDLNVEASDFLKDLQVKLNTVMDDLSRIFAVSFQPHIEVSIRQMGDILSQVKGANVPANGNGSLAQDADNVLQPIMDFLDSNLTLFAKICEKTVLKRVLKELWKLVMNTMEKTIVLP------------QLTDQTGTQLIFNAAKELGQL------SKLKEHMVREEAKALTPKQCAVIELALDTIKQYFHAGGVGLKKTFLEKSPDLKSLHYALSLYTQATDKLIRKFIQSQHTQAAN-VDDPVGEVTMTIEVLNDPNGGGHKINVKVVSANDLRWQTQGIFRPFVEVYIIGPHLSDKKRKFATKSKNNSWSPKFVESVQFSLGSELGPEGYELHVCVKDYCFAREDRTVGMALVQLKDVVARGSGAYWLPLGKRVHMDETGLTVLRILSQRNNDEVAKEFVKLKSDQRSAEEGRG 1481          
BLAST of Protein unc-13 homolog B vs. Ensembl Cavefish
Match: unc13ba (unc-13 homolog Ba (C. elegans) [Source:ZFIN;Acc:ZDB-GENE-100921-10])

HSP 1 Score: 1312.75 bits (3396), Expect = 0.000e+0
Identity = 634/1195 (53.05%), Postives = 867/1195 (72.55%), Query Frame = 2
Query: 3017 SLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRDQEPGDKIQNSDETGPK--NLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKLNLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKDISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHAM------------------EDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLI----SSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIRQSPNSQG 6529
            +L +R SL DEELK HVYKKTLQA+IYPIS  TPH F+V  AT PT+CYECEGLLWG+ARQG+RC ECGVKCHEKC+ELLNADCLQRAAEKSSK GAE +TQ II +M D M+ R +N PEIF++I+ +F++ +  H   +K+I+Q++LDGTSKWSAKI+ITV  AQGL  KD+TG+SDPYVTVQVGK KKRTKT+   LNP W+E F FECHNSS+RIKVRVWDED+D+KS+++Q+L RESDDFLGQ+IIEVRTLSGEMDVWYNLEKRTDKSAVSGA+RLQISVEIKGEEKVAPYH+QYTCLHEN+FH+L + +   G  +L  A     ++ W++YFD   ++I++EFAMRYGIESIYQAMTHF+CL++           +TLLANINA++AH TS T+ SAS+RFAA+NFG+E+FI+LLDQLHNS++I+L  YRN F AS   RL+DLKSTVDLLTSI FFRMKVQEL +PPRA  VVR+CV+AC+ +TY+++F +  ELYSR   P ++    +E GP   NL+FW KLI L+VS+IE+DK  Y P +NQF QE+N+ ++S   MW   ++ ++ A+  E+ + +  K++DY+NL F++KW YN YV DLP   D +P YP WF  +V+QWL EN+EVS  ++  A ERDK++GFQ +SEHAL+S+SVVDIFTQLNQ F++IKKL+CP+PA+ + + +RF+ T++KVLL Y +M+ K +  Y +K+++ C+LMNN+QQ+RV+LEK+FE MG + L+++  + +NDLQ +L+ V+D+L+  FA  F+  I   ++++  LL+ QI+    +N + + E ++   LRPLM++ +ANLS+ A +CE+ VLKR+LK+LWR  + C+E+ I+LP                Q  + I+  + +  SH+    P              +LS  QC +MD+ LD IK +FHAGG+GLK +YLE+S EL SLR+AL LY+QTTD LIK FI++Q +Q  + M                  E  +GE  ++V++    +  E K+T  +IA+  + WQT+ +FRPFV++ L+GP + +KKRK+ TKSK+N W+ +YNE+F  ++     +    E YE+Q+ VKDYCFGRAD+++G TV++L  ++++ S   W  LG K+  D  G   L IL+QR  D+IAK+FV+LK++ R  P  +G
Sbjct:    8 ALQSRSSLKDEELKGHVYKKTLQALIYPISCTTPHHFEVWTATTPTYCYECEGLLWGIARQGMRCSECGVKCHEKCQELLNADCLQRAAEKSSKTGAEDRTQHIISAMKDRMKIRERNKPEIFELIRSIFNITKLHHAQQMKTIKQTVLDGTSKWSAKISITVLSAQGLQAKDRTGSSDPYVTVQVGKTKKRTKTIYGNLNPVWEETFNFECHNSSDRIKVRVWDEDDDIKSRVKQRLKRESDDFLGQSIIEVRTLSGEMDVWYNLEKRTDKSAVSGALRLQISVEIKGEEKVAPYHVQYTCLHENVFHYLIDVD---GMVKLPVARG---DDAWKVYFDEAEQEIVDEFAMRYGIESIYQAMTHFACLSS-----------NTLLANINAFFAHPTSATSVSASDRFAASNFGRERFIRLLDQLHNSLRIDLSTYRNNFPASSKPRLSDLKSTVDLLTSIAFFRMKVQELQAPPRAAHVVRDCVKACLNSTYEYIFNNCQELYSRQFTPEEESAPPEEAGPSINNLDFWPKLITLIVSIIEEDKLAYTPIINQFSQELNVGKVSAEVMWTLFAQDMKYAME-EHEKHRLCKSADYMNLHFKVKWLYNEYVKDLPTFSDTVPEYPAWFLQFVLQWLAENEEVSMEFMHGALERDKREGFQPTSEHALFSSSVVDIFTQLNQSFEIIKKLDCPDPAVVAQYNRRFARTISKVLLQYCTMLSKSFPSYCEKEKIPCVLMNNVQQMRVMLEKMFEFMGAKQLDSEAAEILNDLQVKLNTVLDNLSAMFAKSFQPRINVCMRQVGDLLY-QIKGPLNQNARNSAEADAVTALRPLMEFLDANLSIFADLCEKTVLKRVLKDLWRNVLICMEKTIVLP----------------QGSDSIVRHTHT-HSHLHGSEPK-------------TLSQRQCAIMDVALDTIKQFFHAGGDGLKRTYLEKSPELSSLRYALSLYTQTTDALIKTFITTQHTQVHNGMGIRITPKETIRPDRGSGVEHPIGEAVIQVDMAPPAANTEQKLTVKVIAVNDMKWQTSGLFRPFVDVNLVGPVLTDKKRKFTTKSKNNCWTAKYNEAFHAVMLLGNDTGVSVECYELQLTVKDYCFGRADRVVGLTVLKLRDVMDKRSCVCWCPLGPKIITDQTGQITLSILAQRPADEIAKDFVRLKTESR--PAEEG 1151          
BLAST of Protein unc-13 homolog B vs. Ensembl Cavefish
Match: ENSAMXT00000036882.1 (pep primary_assembly:Astyanax_mexicanus-2.0:20:15877557:15935246:1 gene:ENSAMXG00000017447.2 transcript:ENSAMXT00000036882.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1296.95 bits (3355), Expect = 0.000e+0
Identity = 623/1062 (58.66%), Postives = 812/1062 (76.46%), Query Frame = 2
Query: 2888 GGFYKSIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRDQEP-GDKIQNS---DETGP--KNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKLNLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILP-PNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKDISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHAMEDNVGEVSVKVELFRHP 6052
            G     IDS PD++ ++K I LVSD+ L     Q R    A+A + +R S+ DEELK HVYKKTLQA+IYPIS  TPH+F+V  AT PT+CYECEGLLWG+ARQG+RC ECGVKCHEKC+ELLNADCLQRAAEKSSKHGAE +TQ II +M D M+ R +N PEIF++I+DVF V +  H   +K+I+QS+LDGTSKWSAKI ITV CAQGL  KDKTG+SDPYVTVQVGK KKRTKT+   LNP WDEK++FECHNSS+RIKVRVWDED+D+KS+++Q+L RESDDFLGQ+IIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYH+QYTCLHEN+FH    +   QG   +  A     ++ W++YFD  +++I++EFAMRYGIESIYQAMTHF+CL++K+MCPGVPAV+STLLANINA+YAHTT++TN SAS+RF+A+NFGKE+F+KLLDQLHNS++I+L +YRN F AS  +RL DLKSTVDLLTSITFFRMKVQEL SPPRA QVVR+CV+AC+ +TY ++F +  ELYSR  +P GD  +     +E GP  KNL+FW KLI L+VS+IE+D+  Y P LNQFPQE+N+ ++    MW   S+ ++ A+  E+ + +  K++DY+NL F++KW YN YV DLP  + VIP YP WF  +V+QWL EN++VS  ++  A ERDKKDGFQ++SEHAL+S SVVDIFTQLNQ F++IKKL+CP+P + +H+ +RF+ T+ KVLL Y++++KK +  Y  K+++ C+LMNN+QQ+RV LEK+FE+MG + ++++  D +N+LQ +L++V+D L+ +FA+ F+  I+  ++++  LL+ QI+     N +  +E ++  VLRPLMD+ + NL+L ASVCE+ VLKR+LKELWRI +  LE+ I+LP  N  F  IF        +  K LG    L  H+S +                SL+P QC VMD+ LD IK YFHAGGNGLK ++LE+S EL SLRHAL LY+QTTD LIK F+++Q +Q +  ++  VGEVS++++LF HP
Sbjct:  870 GSGLFGIDSMPDLR-KRKPIPLVSDVSL----VQARKAGIASA-MASRSSIKDEELKSHVYKKTLQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKCHEKCQELLNADCLQRAAEKSSKHGAEDRTQNIIMAMKDRMKIRERNKPEIFEVIRDVFMVTKALHGQQMKTIKQSVLDGTSKWSAKITITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIYGNLNPIWDEKYHFECHNSSDRIKVRVWDEDDDIKSRVKQRLKRESDDFLGQSIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHVQYTCLHENLFHHT-TDVLGQGAVRIPDARG---DDAWKVYFDDVAQEIVDEFAMRYGIESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAFYAHTTASTNVSASDRFSASNFGKERFVKLLDQLHNSLRIDLSMYRNNFPASSKDRLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVRDCVKACLNSTYDYIFNNCQELYSRQYQPVGDLNKEECPPEEQGPSIKNLDFWPKLITLIVSIIEEDRNSYTPVLNQFPQELNVGKVCAEVMWIQFSQDMKYAME-EHEKHRLCKSADYMNLHFKVKWLYNEYVKDLPAFKGVIPEYPTWFLQFVLQWLDENEDVSMEFMHGALERDKKDGFQQTSEHALFSCSVVDIFTQLNQSFEIIKKLDCPDPKVMAHYSRRFAKTIAKVLLQYSAILKKSFPSYCDKEKIPCVLMNNVQQLRVQLEKMFESMGAKQMDSEASDVLNELQVKLNNVLDELSSTFANTFQTRIDECMRQMASLLY-QIKGPVNANSRNQVEGDADNVLRPLMDFLDGNLTLFASVCEKTVLKRVLKELWRIVMNSLEKTIVLPQGNDTFGTIF--------SAAKDLGQLSKLKDHMSGEA--------------KSLTPKQCAVMDVALDTIKQYFHAGGNGLKKAFLEKSPELTSLRHALSLYTQTTDTLIKTFVTTQHTQGS-GVDKPVGEVSIQIDLFTHP 1896          
BLAST of Protein unc-13 homolog B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006160.1 (pep scaffold:Pmarinus_7.0:GL476688:98794:160173:1 gene:ENSPMAG00000005536.1 transcript:ENSPMAT00000006160.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1169.45 bits (3024), Expect = 0.000e+0
Identity = 554/888 (62.39%), Postives = 709/888 (79.84%), Query Frame = 2
Query: 2888 GGFYKSIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCE-ENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRDQEPGD--KIQN--SDETGP--KNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVA--CILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAK--KNPKLNLEQESFIVLRPLMDYFE 5518
            GG Y  IDS PD++ +KK I LVSDL   ++ A +R    A+A L  R SLNDE+LK HVYKK LQA+IYPIS  TPH+F+V  AT PT+CYECEGLLWG+ARQG++C ECGVKCHEKC++LLNADCLQRAAEKSSKHGAE +TQ II +M D M+ R +N PEIF++I++VFSV ++AH  H KS++QS+LDGTSKWSAK+ ITV  AQGL  KDKTG+SDPYVTVQVGK KKRTKT+   LNP WDEKF+FECHNSS+RIKVRVWDED+D+KS+++Q+L RESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRL+ISVEIKGEEKVAPYH+QYTCLHEN+FH+L + +N       ++   +   +E W++YFD  +++I++EFAMRYGIESIYQAMTHFSCL++K+MCPGVPAV+STLLANINAYYAHTT++TN SAS+RFAA+NFGKE+F++LLDQLHNS++I+L +YRN F AS PERL DLKSTVDLLTSITFFRMKVQEL SPPRA  VV++CV+AC+ +TY+++F + +ELYSR+ +P D  K Q+  +DE GP  KNL+FW KLI L+VS+IE+DK  Y P LNQFPQE+N+ +IS   MW   ++ ++ AL  E+ ++   K++DY+NL F++KW YN YV DLP  +  +P YP WFEP+V+QWL EN++VS  +L  A ERDKKDGFQ++SEHAL+S SVVD+FTQLNQ F++IKKLECP+P I  H+M+RF+ T+ KVLL YA +I KD+  Y  K++V   CILMNNIQQ+RV LEK+FEAMGG+ L+++  D + +LQ +L++V+D L++ F   F   IE ++K + +LL +Q++       + +    Q++ I+LRPLMD  +
Sbjct:  985 GGLY-GIDSMPDLR-KKKPIPLVSDL---SIAAMQRKAGLASA-LAYRASLNDEDLKAHVYKKALQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMKCKECGVKCHEKCQDLLNADCLQRAAEKSSKHGAEDRTQNIIMAMKDRMKIRERNKPEIFELIREVFSVAKQAHAQHTKSVKQSVLDGTSKWSAKLTITVVSAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIYGNLNPVWDEKFHFECHNSSDRIKVRVWDEDDDIKSRVKQRLKRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLRISVEIKGEEKVAPYHVQYTCLHENLFHYLTDIQNNG-----VVRIPDAKGDEAWKVYFDETAQEIVDEFAMRYGIESIYQAMTHFSCLSSKYMCPGVPAVMSTLLANINAYYAHTTASTNVSASDRFAASNFGKERFVRLLDQLHNSLRIDLSMYRNNFPASNPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASMVVKDCVKACLNSTYEYIFANCHELYSREYQPADPSKKQDIPADEQGPSIKNLDFWPKLITLIVSIIEEDKNSYTPVLNQFPQELNVGKISAEVMWIAFAQDMKYALE-EHSKNGQCKSADYMNLHFKVKWLYNEYVRDLPAIKGEVPEYPVWFEPFVLQWLNENEDVSLEFLHGALERDKKDGFQQTSEHALFSCSVVDVFTQLNQSFEIIKKLECPDPKIVGHYMRRFARTIGKVLLQYADIISKDFQSYCSKEKVVQPCILMNNIQQLRVQLEKMFEAMGGKELDSEASDNLKELQVKLNNVLDELSRVFGISFMPHIEVSVKAMGELL-SQVKGPGNMLSSARNTAAQDADIMLRPLMDLLD 1859          
BLAST of Protein unc-13 homolog B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004337.1 (pep scaffold:Pmarinus_7.0:GL478852:175856:252872:1 gene:ENSPMAG00000003926.1 transcript:ENSPMAT00000004337.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1045.8 bits (2703), Expect = 0.000e+0
Identity = 494/778 (63.50%), Postives = 622/778 (79.95%), Query Frame = 2
Query: 2891 GFYKSIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHT-TSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRDQEPGDKIQNS---DETGP--KNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSV-ENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQE 5203
            G Y  IDS P+++ R+K+I LVSD+ L  M  +   L    +S+ TR SLNDEELKMHVYKKTLQA+IYPIS   PH F+V  AT PT+CYECEGLLWG+ARQG+RC ECGVKCHEKC++LLNADCLQRAAEKSSKHGAE KTQ II +M D M+ R +N PEIF +I+DVF+V       H+KS++Q +L+GTSKWSAKI I V  AQGL  KDKTG SDPYVTVQVGK KKRTKT+   LNP W+EKF+FECHNSS+RIKVRVWDED+D+KS+++Q+L RESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKS VSGAIRLQISVEIKGEEKVAPYH+QYT LHENIFHFL +     G   +  A     +E W++YF+  +++I++EFAMRYGIESIYQAMTHFSCL++K+MC GVPAV+S LLANINAYYAHT TST+N SAS+RFAA+NFGK++F+KLLDQLHNS++I+L +YRN F AS  ERL DLKSTVDLLTSITFFRMKVQ+L SPPRA  VV++CV+  + +TY+++F + +ELYS++ +  D+ ++    +E GP  KNL+FW KLI L+VS+IE+DK  Y P LNQFPQE+N+ ++S   MW   S  +  A+ V E+ + +  K++DY+NL F++KW YN YV DLP S++ +P Y  WFEP+V+QWL EN+EVS  +L+ A +RDKKDGFQ++SEHAL+S SVVD+FTQLNQ F++IKKLECP+P I +HFM+RF+ T++KVL++YA +I + + EY  +++
Sbjct:    3 GLY-GIDSMPNLR-RRKTIPLVSDVSLAAMQRKGGLL----SSMATRASLNDEELKMHVYKKTLQALIYPISCTIPHRFEVWTATAPTYCYECEGLLWGIARQGMRCTECGVKCHEKCQDLLNADCLQRAAEKSSKHGAEDKTQTIITAMKDRMKVRERNKPEIFDLIRDVFAVTPSDQNSHMKSVKQMVLEGTSKWSAKITINVHSAQGLQAKDKTGASDPYVTVQVGKTKKRTKTIYNNLNPVWEEKFHFECHNSSDRIKVRVWDEDDDIKSRVKQRLKRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSVVSGAIRLQISVEIKGEEKVAPYHVQYTGLHENIFHFLTDVQNG-GAVRIPEAKG---DEAWKVYFEETAQEIVDEFAMRYGIESIYQAMTHFSCLSSKYMCSGVPAVMSNLLANINAYYAHTNTSTSNVSASDRFAASNFGKDRFVKLLDQLHNSLRIDLSMYRNNFPASNRERLQDLKSTVDLLTSITFFRMKVQDLQSPPRASTVVKDCVKNSLSSTYEYIFANCHELYSQEYQSADQTKDEAAPEEHGPSIKNLDFWPKLITLIVSIIEEDKNSYTPVLNQFPQELNVGKVSAEVMWNLFSLDMRAAMQVKEHEKHRQCKSADYMNLHFKVKWLYNEYVKDLPASKEKVPEYSAWFEPFVLQWLDENEEVSLEFLRGALDRDKKDGFQQTSEHALFSCSVVDVFTQLNQSFEIIKKLECPDPEIVAHFMRRFAKTISKVLMNYAEIISQYFKEYCSQEK 770          
BLAST of Protein unc-13 homolog B vs. Ensembl Sea Lamprey
Match: PRKCE (protein kinase C epsilon [Source:HGNC Symbol;Acc:HGNC:9401])

HSP 1 Score: 65.0846 bits (157), Expect = 6.858e-11
Identity = 26/58 (44.83%), Postives = 34/58 (58.62%), Query Frame = 2
Query: 3095 YPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADC 3268
            YP S N PH F + N   PTFC  C  LLWG+ RQGL+C  C +  H +C++ +   C
Sbjct:   26 YPSSVNVPHKFSIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCEQNVAPSC 83          
BLAST of Protein unc-13 homolog B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002458.1 (pep scaffold:Pmarinus_7.0:GL479588:3:23579:-1 gene:ENSPMAG00000002237.1 transcript:ENSPMAT00000002458.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.4622 bits (145), Expect = 7.283e-10
Identity = 25/46 (54.35%), Postives = 31/46 (67.39%), Query Frame = 2
Query: 3110 NTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCK 3247
            + PH F+V +   PTFC  C  LLWG+ARQGL+C EC +  H KCK
Sbjct:  187 DVPHRFRVNSYMSPTFCDHCGTLLWGLARQGLKCDECAMNIHHKCK 232          
BLAST of Protein unc-13 homolog B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002460.1 (pep scaffold:Pmarinus_7.0:GL479588:3:23579:-1 gene:ENSPMAG00000002237.1 transcript:ENSPMAT00000002460.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.4622 bits (145), Expect = 8.106e-10
Identity = 25/46 (54.35%), Postives = 31/46 (67.39%), Query Frame = 2
Query: 3110 NTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCK 3247
            + PH F+V +   PTFC  C  LLWG+ARQGL+C EC +  H KCK
Sbjct:  186 DVPHRFRVNSYMSPTFCDHCGTLLWGLARQGLKCDECAMNIHHKCK 231          
BLAST of Protein unc-13 homolog B vs. Ensembl Yeast
Match: TCB2 (ER protein involved in ER-plasma membrane tethering; one of 6 proteins (Ist2p, Scs2p, Scs22p, Tcb1p, Tcb2p, Tcb3p) that connect ER to plasma membrane (PM) and regulate PM phosphatidylinositol-4-phosphate (PI4P) levels by controlling access of Sac1p phosphatase to its substrate PI4P in the PM; contains 3 calcium and lipid binding domains; mRNA is targeted to bud; TCB2 has a paralog, TCB1, that arose from the whole genome duplication [Source:SGD;Acc:S000005031])

HSP 1 Score: 50.447 bits (119), Expect = 4.172e-6
Identity = 39/135 (28.89%), Postives = 62/135 (45.93%), Query Frame = 2
Query: 3482 SAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRT--KTVLQE--LNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVE 3874
            S  + IT K A+ LIG +K G SDPYV   + +       KT +Q+  LNP+W+E    E  N       RV D    L   ++   +  S+  +G+ ++ + T+  E D  +N+     K    G + L+   E
Sbjct:  982 SGDLKITAKSAENLIGVNKNGYSDPYVEFFLNEKSTSPFFKTAVQKKTLNPTWNESKTIEVSN-------RVNDY---LTINVKDYESTNSNRSIGKAVVPLSTIDPESDTTFNIPLVGPKGEDGGVLHLEFEFE 1106          
BLAST of Protein unc-13 homolog B vs. Ensembl Nematostella
Match: EDO32050 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW72])

HSP 1 Score: 840.106 bits (2169), Expect = 0.000e+0
Identity = 391/660 (59.24%), Postives = 511/660 (77.42%), Query Frame = 2
Query: 3008 ANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRDQEPGDKIQNSDE-TGPKNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDG 4984
            A  ++  R +LNDEELK HVYKKTLQA+IYPIS  TPH+F+  +   P +CYECEGLLWG+A QGL+C +CGVKCHE+CK+LLNADCLQRAAEKS +HG+  KTQ+II +M   M+ R +  PEIF++I++VF V+ + H  +L +++  I  GTSKWSAKI+ITV  AQGLI KDKTGTSDPYVTVQVGK KKRT T+  ELNP W+E F FECHNSS+RIKVRVWDED+D+KS++RQKL RE DDFLGQTIIEVRTLSGEMDVWYNLEKRTD+SAVSGAIRL+IS+EIKGEEKV PYH QYTCLHENIFHFLC++N  Q        ++   +E W+++F  P+ +I+ EFAMRYGIESIYQAMTHFSCLT+ +  PG+PA++S+L ANINA+++HTT+ +  SA+ RFAA NFG +KF+K++D LHN+++I++  YR  F +S P++LNDLKS+VD+LTSITFFRMKV +   P R  +VV ECV+ CM+ TY FLF +  +LY R+       ++ D+ +GPKNL+FW K+I L+VSVIE+D+ +Y+  LNQFPQE+N+ ++S    W   +  L++ L   +   + + ++DY+NL F++KWF+N Y  + P ++++IP Y  WFEP+V QWL ENDEVS  ++ AA ERD+KDG
Sbjct:    8 AQLNMDQRANLNDEELKTHVYKKTLQALIYPISDTTPHNFESFSTQVPAYCYECEGLLWGLAWQGLKCRDCGVKCHERCKDLLNADCLQRAAEKSVRHGSNDKTQSIIVAMKSRMEERERLKPEIFQLIREVFRVDPKTHAGYLNNVKTQIWMGTSKWSAKISITVVSAQGLIAKDKTGTSDPYVTVQVGKTKKRTSTIPHELNPEWNETFLFECHNSSDRIKVRVWDEDDDIKSRVRQKLIREPDDFLGQTIIEVRTLSGEMDVWYNLEKRTDRSAVSGAIRLRISIEIKGEEKVVPYHTQYTCLHENIFHFLCQKNGGQ----FPVPTSTGRDEPWKVFFSEPALEIVNEFAMRYGIESIYQAMTHFSCLTSCYTHPGIPALISSLFANINAFFSHTTTNSATSATHRFAATNFGSDKFVKIIDHLHNTLRIDMANYRTNFPSSSPDKLNDLKSSVDILTSITFFRMKVLD-QRPTRTAEVVAECVKNCMRATYAFLFANCVDLYDREIANERSAEDPDQPSGPKNLDFWPKIISLIVSVIEEDRGIYSQVLNQFPQELNVGEVSAETFWNLFASDLQEMLQDHSTTPEWT-SADYMNLHFKVKWFFNEYAMNTPGNKNMIPRYTGWFEPFVSQWLTENDEVSMEFMIAALERDRKDG 661          
BLAST of Protein unc-13 homolog B vs. Ensembl Nematostella
Match: EDO30233 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1D8])

HSP 1 Score: 388.652 bits (997), Expect = 9.468e-120
Identity = 208/513 (40.55%), Postives = 310/513 (60.43%), Query Frame = 2
Query: 4994 SSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQE-VACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIEN-NIKELHQLLHTQIQETAKKN-----PKLNLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLK-ELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKDISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIR 6508
            S++H++YSNS+VDIF  LNQ +++IKKL+CP+PAI++ ++ +F++TV KVLL YA  I  ++  +  ++E + C  +   +  RV L         +++  D  +   +LQ +L+  +D L   F       +       L + +  +I+     N      +  +EQES ++L+PLMD  E  LSLL   CE++VLKRLLK +LW+  +   ER ++LPP                  N + G +   ++++ N+   S     I      +LS  QC V++  L  IK YF+  G+GL+ ++LE+   +Q+LRHAL LY+QTTD LIK F+ +Q SQ+   ++D VGEVSV+V+LF HP TGEHK+T  ++A + L WQ+  +FRPFVE+ ++GP++ NK RK ATKSK NTWSP YNESF F++ +     NYE+ I VKDYCF R D ++G TV+ L  + + GS      LGR LH D  GWTIL+ILSQR+ D++A++FV LKS  R
Sbjct:    4 SAQHSVYSNSIVDIFCSLNQNYEIIKKLDCPDPAINTRYIIKFTVTVQKVLLQYAENITNEFKRFCHQEETLVCSRIGCFRFFRVFLH----PRKKKTISPDCSEVFKELQVQLNHTLDELCVIFVRSMHLPLPALGCLFLTRSILCRIKSVGHFNITVPSCRAAVEQESAMILQPLMDILEGTLSLLNRACEKSVLKRLLKVQLWKSLLANFERIVVLPP-----------------PNDVKGPAYFYMNYMVNRPVFSPQDAGIIGQESRNLSVRQCAVLEAALCRIKDYFYGDGSGLRKTFLEKCQNMQALRHALSLYTQTTDSLIKEFVRTQTSQEEPGIDDPVGEVSVQVDLFTHPGTGEHKVTVKVVAAKDLKWQSPGMFRPFVEVNVVGPHLGNKTRKQATKSKRNTWSPAYNESFFFILGNEVDMINYELHIAVKDYCFARMDAIVGMTVLHLRDIADIGSIACNALLGRALHMDATGWTILKILSQRSADEVARDFVALKSNRR 495          
BLAST of Protein unc-13 homolog B vs. Ensembl Nematostella
Match: EDO44925 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUL8])

HSP 1 Score: 70.0922 bits (170), Expect = 4.027e-12
Identity = 61/242 (25.21%), Postives = 95/242 (39.26%), Query Frame = 2
Query: 3113 TPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQV-----GKGKKRTKTVLQELNPSWDEKFYFECHNSSE--RIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLS-GEMDVWYNL 3814
            +PH+F       P FC  C  LL+GV  QGL+C  C +  H+KC++ +   C    A+ + + G                                          IHLK                I+  ++ A+ L+  D  G SDPYV V++        KK+TK   + L+P ++E F F+  N  +  R+ + VWD D         + TR  +DF+G     V  L    ++ W+ L
Sbjct:    1 SPHNFGPHTYKSPCFCDHCGSLLYGVYHQGLKCTACDMNVHKKCEKAVPKLC---GADHTERRG-----------------------------------------RIHLK----------------ISYELREARNLMPMDPNGLSDPYVKVKLLPDPDNTSKKKTKIFKESLSPVFNETFEFKIQNKDKDRRLSIEVWDWD---------RTTR--NDFMGSLSFGVSELQKNGVEGWFKL 171          
BLAST of Protein unc-13 homolog B vs. Ensembl Nematostella
Match: EDO32931 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STM9])

HSP 1 Score: 62.3882 bits (150), Expect = 1.882e-9
Identity = 48/132 (36.36%), Postives = 66/132 (50.00%), Query Frame = 2
Query: 3491 IAITVKCAQGLIGKD----KTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNS-SERIKVRVWDEDNDLKSKIRQKLTRESDD-FLGQTIIEVRTL--SGEMDVWYNLEKRTDKSAVSGAIRLQ 3862
            + I V  A+ L+ KD    K GTSDPY  V+VG    RT+T  + LNP W+E F     NS  ++IK++++DED            R SDD  LG    ++ T+   G  D+W  LE     +  SG I L 
Sbjct:  318 LRIEVTEAKDLVAKDIAVFKKGTSDPYAMVKVGAQTFRTETKKETLNPKWNEVFEVFVDNSQGQKIKIQLFDED------------RASDDEALGSVEADISTVVQQGSADLWLPLE-----NVASGQINLH 432          
BLAST of Protein unc-13 homolog B vs. Ensembl Nematostella
Match: EDO46071 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR93])

HSP 1 Score: 60.8474 bits (146), Expect = 6.198e-9
Identity = 45/143 (31.47%), Postives = 72/143 (50.35%), Query Frame = 2
Query: 3497 ITVKCAQG--LIGKDKTGTSDPYVTVQVGKGKKR--------TKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGE---------MDVWYNLEKRTDKSAVSGAIRLQIS 3868
            + VK   G  L  KD  G SDPY  +++ +G +         T+T+ + L P W+E+F F  +    R+   V+DE+         +LTR  DDFLG+  +E+ +L            +D  Y L KR+++S V G +RL++S
Sbjct:   33 LRVKVVAGIDLAKKDIFGLSDPYCKIRLFRGDRTAGEIDSITTETIKKTLTPKWNEEFLFRVNPIDNRLLFEVFDEN---------RLTR--DDFLGE--VEIPSLGSYPTERRNVRILDKDYRLRKRSERSRVKGHLRLRLS 162          
BLAST of Protein unc-13 homolog B vs. Ensembl Medaka
Match: UNC13A (protein unc-13 homolog A [Source:NCBI gene;Acc:105356230])

HSP 1 Score: 1431.39 bits (3704), Expect = 0.000e+0
Identity = 678/1216 (55.76%), Postives = 924/1216 (75.99%), Query Frame = 2
Query: 2876 DHDYGGFYKSIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTT-STTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRDQEPGDKIQNSDETGP--KNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKLNLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKDISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIRQS 6514
            D + GG   SIDS PD++ ++K+I LV DL L    ++K  + +A AS     +L +EELK HVYKKTLQA+IYPISS TPH+F+V  AT PT+CYECEGLLWG+ARQG+RC ECGVKCH+KC++LLNADCLQRAAEKSSKHGAE +TQ II  + D M+ R +N PEIF++I++VF++++  H  H+K I+QS+LDGTSKWSAKI+ITV CAQGL  KDKTG+SDPYVTVQVGK KKRTKT+   LNP WDE F+FECHNSS+RIKVRVWDED+D+KS+++Q+  RESDDFLGQTIIEVRTLSGEMDVWYNL+KRTDKSAVSGAIR+QISVEIKGEE VAPYH+QYTCLHE++F +  E+  S     ++   +   ++ W++YF+  +++I++EFAMRYG+ESIYQAMTHF+CL++K+MCPGVPAV+STLLANINAYYAHTT S+ N SAS+RFAA+NFGKE+F+KLLDQLHNS++I+L +YRN F AS PERL DLKSTVDLLTSITFFRMKVQEL SPPRA QVV++CV+AC+ +TY+++F + ++LY+R+ +        DE GP  KNL+FW KLI L+VS+IE+DK  Y P LNQFPQE+N+ +IS   MW   ++ ++ A+  E+ +++  K++DY+NL F++KW YN Y  +L   Q  +P YP WFEP+VI WL EN+EVS ++L  A ERDKKDGFQ +SEHAL+S SVVD+F+QLNQ F++I+KLECP+P I  ++MKRF+ T+  VLLSYA +I KD+  +++K++V CI++NNIQQ+RV LEK+FEAMGG++L  +  D + +LQ++L+ V+D L++ FA  F+ +IE+N++++  +L     +T   N   ++ QE+  VL+P+MD+ ++NLSL A +CE+ VLKR+LKELW++ +  +E+ I+LP            +++ Q   +++  +   L  +      SK+ + + ++   +L+P QC V+++ LD IK YFHAGG GLK ++LE+S +LQSLR+AL LY+Q TD LI+ FI SQ  Q +    D+VGEV + V++   P+ GEHKI   ++A   L W+    FRPFVE+Y++GP++ +KKRK+ATKSK+N+WSP++NES  + + +   PE+YE+Q+CVKDYCF R D+ +G  V+Q+  +  + S   WL LGR++H D  G T+LRILSQR  DD+AKEFV+LKS  R +
Sbjct:  346 DMEMGGALYSIDSMPDLR-KRKAIPLVRDLSL-VQNSRKAGITSAMAS----TTLGNEELKSHVYKKTLQALIYPISSTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCSECGVKCHDKCQDLLNADCLQRAAEKSSKHGAEDRTQNIIMVLKDRMKIRERNKPEIFELIQEVFALDKTTHATHMKQIKQSVLDGTSKWSAKISITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIYGNLNPIWDENFHFECHNSSDRIKVRVWDEDDDIKSRVKQRFKRESDDFLGQTIIEVRTLSGEMDVWYNLDKRTDKSAVSGAIRMQISVEIKGEETVAPYHVQYTCLHEHLFQYTTEDQNSG----VVKIPDAKGDDAWKVYFEETAQEIVDEFAMRYGVESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTQSSNNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSMYRNNFPASSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHDLYNREYQTDPVTVPPDEQGPSIKNLDFWSKLITLIVSIIEEDKNSYTPCLNQFPQELNVGKISAEVMWNMFAQDMKYAME-EHEKNRLCKSADYMNLHFKVKWLYNEYCKELQTFQKHVPEYPAWFEPFVIMWLDENEEVSRDFLHGALERDKKDGFQVTSEHALFSCSVVDVFSQLNQSFEIIRKLECPDPQIVGNYMKRFAKTIGNVLLSYADIIAKDFPNHVKKEKVPCIIINNIQQLRVQLEKMFEAMGGKNLNVEASDFLKELQNKLNSVMDDLSRIFAVSFQPQIEDNVRQMGDILAQVKGQTVPANG--SVVQEADNVLQPIMDFLDSNLSLFAKICEKTVLKRVLKELWKLVMNTMEKTIVLP------------TLTDQTGTQMIFNAAKDLGQL------SKLKEHMGREEAKALTPKQCAVIELALDTIKQYFHAGGVGLKKTFLEKSPDLQSLRYALSLYTQATDKLIRKFILSQHVQASGV--DSVGEVVMNVDILPQPN-GEHKINVKVVAANDLKWKAQG-FRPFVEVYIIGPHLSDKKRKFATKSKNNSWSPKFNESVQYSLGAEAGPESYELQVCVKDYCFAREDRTVGMAVLQVKDIANKASVTCWLPLGRRVHMDETGLTVLRILSQRNNDDVAKEFVKLKSDQRSA 1526          
BLAST of Protein unc-13 homolog B vs. Ensembl Medaka
Match: UNC13A (protein unc-13 homolog A [Source:NCBI gene;Acc:105356230])

HSP 1 Score: 1427.54 bits (3694), Expect = 0.000e+0
Identity = 678/1230 (55.12%), Postives = 923/1230 (75.04%), Query Frame = 2
Query: 2888 GGFYKSIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTT-STTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRD-QEPGDKIQNSDETGP--KNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKLNLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKDISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQ-------------CSQDTHAME----DNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIRQS 6514
            GG   SIDS PD++ ++K+I LV DLV   +   ++   A   S +   +L +EELK HVYKKTLQA+IYPISS TPH+F+V  AT PT+CYECEGLLWG+ARQG+RC ECGVKCH+KC++LLNADCLQRAAEKSSKHGAE +TQ II  + D M+ R +N PEIF++I++VF++++  H  H+K I+QS+LDGTSKWSAKI+ITV CAQGL  KDKTG+SDPYVTVQVGK KKRTKT+   LNP WDE F+FECHNSS+RIKVRVWDED+D+KS+++Q+  RESDDFLGQTIIEVRTLSGEMDVWYNL+KRTDKSAVSGAIR+QISVEIKGEE VAPYH+QYTCLHE++F +  E+  S     ++   +   ++ W++YF+  +++I++EFAMRYG+ESIYQAMTHF+CL++K+MCPGVPAV+STLLANINAYYAHTT S+ N SAS+RFAA+NFGKE+F+KLLDQLHNS++I+L +YRN F AS PERL DLKSTVDLLTSITFFRMKVQEL SPPRA QVV++CV+AC+ +TY+++F + ++LY+R+ Q    K    DE GP  KNL+FW KLI L+VS+IE+DK  Y P LNQFPQE+N+ +IS   MW   ++ ++ A+  E+ +++  K++DY+NL F++KW YN Y  +L   Q  +P YP WFEP+VI WL EN+EVS ++L  A ERDKKDGFQ +SEHAL+S SVVD+F+QLNQ F++I+KLECP+P I  ++MKRF+ T+  VLLSYA +I KD+  +++K++V CI++NNIQQ+RV LEK+FEAMGG++L  +  D + +LQ++L+ V+D L++ FA  F+ +IE+N++++  +L     +T   N   ++ QE+  VL+P+MD+ ++NLSL A +CE+ VLKR+LKELW++ +  +E+ I+LP                   ++ +G +Q + +   +    SK+ + + ++   +L+P QC V+++ LD IK YFHAGG GLK ++LE+S +LQSLR+AL LY+Q TD LI+ FI SQ              ++DT   +    D+VGEV + V++   P+ GEHKI   ++A   L W+    FRPFVE+Y++GP++ +KKRK+ATKSK+N+WSP++NES  + + +   PE+YE+Q+CVKDYCF R D+ +G  V+Q+  +  + S   WL LGR++H D  G T+LRILSQR  DD+AKEFV+LKS  R +
Sbjct:  671 GGALYSIDSMPDLR-KRKAIPLVRDLVRSLVQNSRK---AGITSAMASTTLGNEELKSHVYKKTLQALIYPISSTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCSECGVKCHDKCQDLLNADCLQRAAEKSSKHGAEDRTQNIIMVLKDRMKIRERNKPEIFELIQEVFALDKTTHATHMKQIKQSVLDGTSKWSAKISITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIYGNLNPIWDENFHFECHNSSDRIKVRVWDEDDDIKSRVKQRFKRESDDFLGQTIIEVRTLSGEMDVWYNLDKRTDKSAVSGAIRMQISVEIKGEETVAPYHVQYTCLHEHLFQYTTEDQNSG----VVKIPDAKGDDAWKVYFEETAQEIVDEFAMRYGVESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTQSSNNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSMYRNNFPASSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHDLYNREYQTDPSKAVPPDEQGPSIKNLDFWSKLITLIVSIIEEDKNSYTPCLNQFPQELNVGKISAEVMWNMFAQDMKYAME-EHEKNRLCKSADYMNLHFKVKWLYNEYCKELQTFQKHVPEYPAWFEPFVIMWLDENEEVSRDFLHGALERDKKDGFQVTSEHALFSCSVVDVFSQLNQSFEIIRKLECPDPQIVGNYMKRFAKTIGNVLLSYADIIAKDFPNHVKKEKVPCIIINNIQQLRVQLEKMFEAMGGKNLNVEASDFLKELQNKLNSVMDDLSRIFAVSFQPQIEDNVRQMGDILAQVKGQTVPANG--SVVQEADNVLQPIMDFLDSNLSLFAKICEKTVLKRVLKELWKLVMNTMEKTIVLP----------------TLTDQTVGGTQMIFNAAKDLGQLSKLKEHMGREEAKALTPKQCAVIELALDTIKQYFHAGGVGLKKTFLEKSPDLQSLRYALSLYTQATDKLIRKFILSQHVQVHGGKGIRYTANEDTPPEKASGVDSVGEVVMNVDILPQPN-GEHKINVKVVAANDLKWKAQG-FRPFVEVYIIGPHLSDKKRKFATKSKNNSWSPKFNESVQYSLGAEAGPESYELQVCVKDYCFAREDRTVGMAVLQVKDIANKASVTCWLPLGRRVHMDETGLTVLRILSQRNNDDVAKEFVKLKSDQRSA 1871          
BLAST of Protein unc-13 homolog B vs. Ensembl Medaka
Match: UNC13B (unc-13 homolog B [Source:NCBI gene;Acc:101167071])

HSP 1 Score: 1414.44 bits (3660), Expect = 0.000e+0
Identity = 673/1210 (55.62%), Postives = 912/1210 (75.37%), Query Frame = 2
Query: 2891 GFYKSIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRDQEPGDKIQNSDETGP--KNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKLNLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKDISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIRQS 6514
            G Y  IDS PD++ +KK I LVSD+ L     Q R    A+A +  R S  DEELK HVY+KTLQA+IYPIS  TPH+F+V  AT PT+CYECEGLLWG+ARQG+RC ECGVKCHEKC+ELLNADCLQRAAEKSSKHGAE +TQ II +M D M+ R +N PEIF++I++VF++ +  H   +K I+QS+LDGTSKWSAKI ITV CAQGL  KDKTG+SDPYVTVQVGK KKRTKT+   LNP W+EKF+FECHNSS+RIKVRVWDED+D+KS+++Q+L RESDDFLGQ+IIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQI+VEIKGEEKVAPYH+QYTCLHEN+FH+   +   QG  ++  A     +++W++YFD  +++I++EFAMRYGIESIYQAMTHF+CL+TK+M PGVPA++S+LLANINA+YAHTT++TN SAS+RFAA+NFGKE+F+KLLDQLHNS++I+L  YRN F AS  +RL DLKSTVDLLTSITFFRMKVQEL SPPRA QVVR+CV+AC+ +TY ++F +  ELYSR  +   +    +E GP  KNL+FW KLI L+VS+IE+D+  Y P LNQFPQE+N+ ++S   MW   S+ ++ A+  E+ +    K++DY+NL F++KW YN YV +LP  + ++P+YP WF  +V+QWL EN++VS  ++  A ERDKKDGFQ++SEHAL+S SVVDIFTQLNQ F++IKKLECP+P++ + + +RFS T+ KVLL Y++++ K++  ++ K+ + C+L+NN+QQ+R+ LEK+FE+MG + ++T+  D + DLQ  L++V+D L+++F + F+  I + ++++  LL+ QI+     N K  ++ +S  +LRPLMD+ +  L+L A+VCE+ VLKR+LKELWRI +  LE+ I+LP          N +  +Q    IL  +                 KD+ +                 L  +K YFHAGGNGLK ++LE+S EL SLRHAL LY+QTTD LIK F+++Q +Q +  ++  +GEVS+++ELF HP +GE K+T  +I    L WQT+ +FRPFVE+ ++GP++ +KKRK+ TKSK+N+WSP++NE+F F++ + +  + YEVQ+CVKDYCFGR DQ++G  V+QL  ++E+G+   W  LG++++ D+ G T +RILSQR+ DD+AKEFV+LKS+ R +
Sbjct:  321 GLY-GIDSMPDLR-KKKPIPLVSDVSL----VQARKAGIASA-MAARSSFKDEELKNHVYRKTLQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCSECGVKCHEKCQELLNADCLQRAAEKSSKHGAEDRTQNIIMAMKDRMKIRERNKPEIFELIREVFNITKSFHMQQMKGIKQSVLDGTSKWSAKITITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIYGNLNPVWEEKFHFECHNSSDRIKVRVWDEDDDIKSRVKQRLKRESDDFLGQSIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQINVEIKGEEKVAPYHVQYTCLHENLFHY-STDVLGQGAVKIPEARG---DDSWKVYFDDVAQEIVDEFAMRYGIESIYQAMTHFACLSTKYMRPGVPAMMSSLLANINAFYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSTYRNHFPASSKDRLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVRDCVKACLNSTYDYIFNNCQELYSRQYQSSKEEVPLEEQGPSIKNLDFWPKLIMLIVSIIEEDRNSYTPVLNQFPQELNVGKVSAEVMWTLFSQDMKYAME-EHEKHILCKSTDYMNLHFKVKWLYNEYVRELPSVKGIVPDYPSWFVQFVLQWLDENEDVSMEFMHGALERDKKDGFQQTSEHALFSCSVVDIFTQLNQSFEIIKKLECPDPSVMAQYSRRFSKTIAKVLLQYSAILTKNFPSHIDKENIPCVLLNNVQQLRIQLEKMFESMGAKQMDTEASDLLYDLQVRLNNVLDDLSRTFGNSFQSCINDCMRQMASLLY-QIKGPLNGNTKNQVDADSDNMLRPLMDFLDGKLTLFATVCEKTVLKRVLKELWRIVMTSLEKTIVLPQG--------NDTFGAQ----ILSAA-----------------KDLGQ-----------------LSKLKQYFHAGGNGLKKAFLEKSPELSSLRHALSLYTQTTDSLIKTFVTTQHTQGS-GVDKPIGEVSLQIELFTHPKSGERKVTVKVIGASDLKWQTSGMFRPFVEVTMIGPHLGDKKRKFQTKSKNNSWSPKFNETFHFVLGNQDGFDCYEVQVCVKDYCFGRTDQVVGLVVMQLRDIMEKGNCDCWCPLGQRIYMDDTGLTAMRILSQRSNDDVAKEFVRLKSETRSA 1470          
BLAST of Protein unc-13 homolog B vs. Ensembl Medaka
Match: ENSORLT00000005973.2 (unc-13 homolog A [Source:NCBI gene;Acc:101164968])

HSP 1 Score: 1335.09 bits (3454), Expect = 0.000e+0
Identity = 656/1242 (52.82%), Postives = 887/1242 (71.42%), Query Frame = 2
Query: 2831 DTDMTDGTRRHEDGLDHDY---------GGFYKSIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNR-SASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRD--QEPGDKIQNSDETGP--KNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKLNLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKDISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIRQS 6514
            D  + +G   +EDG +  Y         GG   SIDS PD++ ++K++ LV DLV                S  +  + +    K HVYKKTLQA+IYPIS  TPH+F+V  AT PT+CYECEGLLWG+ARQG+RC ECGVKCHEKC++LLNADCLQRAAEKSSKHGAE +TQ II  + D M+ R +N PEIF++I++VF+V +  H   +K I+QS+LDGTSKWSAKI+ITV CAQGL  KDKTG+SDPYVTVQVGK KKRTKT+   LNP W+E F FECHNSS+RIKVRVWDED+D+KS+++QK  RESDDFLGQTIIEVRTLSGEMDVWYNL+KRTDKSAVSGAIR+ ISVEIKGEE VAPYH+QYTCLHEN+FH++ +   +     ++   +   ++ W++YF+   ++I++EFAMRYG+ESIYQAMTHF+CL++K+MCPGVPAV+STLLANINAYYAHTT  TN  SAS+RFAA+NFGKE+F+KLLDQLHNS++I+L +YRN F AS PERL DLKSTVDLLTSITFFRMKVQEL SPPRA QVV++CV+AC+ +TY+++F + +ELYSR+   +P   +   +E GP  KNL+FW KLI L+VS+IE+DK  Y P LNQFPQE+N+ +IS   MW   ++ ++ A+  E+ +++  K++DY+NL F++KW YN Y  DLP  +  +P YP WFEP+VIQWL EN+EVS ++L  A ERDKKDGFQ +SEHAL+S SVVD+F+QLNQ F++I+KLECP+P I  H+MKRF+ T++ VLLSYA +I K +  Y+  ++V CIL+NNIQQ+RV LEK+FEAMGG+ L  D  D + DLQ +L++V+D L++ FA  F+  IE N+K++  +L  Q++  +      ++ Q++  VL+P+M++ ++NL+L A +CE+ VLKR+LKELW++ +  +E+ I+LPP            ++ Q   +++  +   L  +      SK+ + + ++   +L+P QC V+++ LD IK YFHAGG GLK ++LE+S +L SL +AL LY+Q TD L+K F+ SQ +Q +  ++D VGEVS+ VE+F HP+TGEHK+T      R+                        +K ++  + +               +S+   PE YE+Q+CVKDYCF R D+ +G  V+QL  +  +GS   WL LG++++ D  G T+LRILSQR  DD+AKEFV+LKS  R +
Sbjct:  321 DMYLDEGQYNYEDGEEIPYEEDEHLYPMGGALYSIDSMPDLR-KRKAMPLVRDLV----------------SFCSETTTD----KSHVYKKTLQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKCHEKCQDLLNADCLQRAAEKSSKHGAEDRTQNIIMVLKDRMKIRERNKPEIFELIQEVFTVLKSTHVTQMKQIKQSVLDGTSKWSAKISITVLCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIYGNLNPVWEETFNFECHNSSDRIKVRVWDEDDDIKSRVKQKFKRESDDFLGQTIIEVRTLSGEMDVWYNLDKRTDKSAVSGAIRMHISVEIKGEETVAPYHVQYTCLHENLFHYVTDIQNNG----VVKIPDAKGDDAWKVYFEETPQEIVDEFAMRYGVESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTQATNNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSMYRNNFPASSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHELYSREYQTDPQGAVP-PEEQGPSIKNLDFWSKLITLIVSIIEEDKNSYTPCLNQFPQELNVGKISAEVMWNLFAQDMKYAME-EHEKNRLCKSADYMNLHFKVKWLYNEYCKDLPFFKSRVPEYPAWFEPFVIQWLDENEEVSRDFLHGALERDKKDGFQVTSEHALFSCSVVDVFSQLNQSFEIIRKLECPDPQIVGHYMKRFAKTISNVLLSYADIISKLFANYVTMEKVPCILINNIQQLRVQLEKMFEAMGGKDLCVDASDILKDLQVKLNNVMDDLSRVFAVSFQPHIEENVKQMGDIL-AQVKGGSNVGNASSVAQDADNVLQPIMEFLDSNLTLFAKICEKTVLKRVLKELWKLVMNTMEKTIVLPP------------LTDQTGTQLIFNAAKELGQL------SKLKEHMVREEAKALTPKQCAVIELALDTIKQYFHAGGVGLKKTFLEKSPDLLSLHYALSLYTQATDKLVKTFVQSQNAQGS-GVDDAVGEVSIHVEIFTHPNTGEHKVTVKGDLQRQ-----------------------EEKVRHQVQEQHT-------------LSNEVGPECYELQVCVKDYCFAREDRTVGMAVLQLKDMASKGSVACWLPLGKRINMDETGLTVLRILSQRNNDDVAKEFVKLKSDQRSA 1479          
BLAST of Protein unc-13 homolog B vs. Ensembl Medaka
Match: unc13ba (protein unc-13 homolog B-like [Source:NCBI gene;Acc:101159330])

HSP 1 Score: 1330.08 bits (3441), Expect = 0.000e+0
Identity = 648/1238 (52.34%), Postives = 876/1238 (70.76%), Query Frame = 2
Query: 2987 QKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRDQEPGDK----------IQNSDETGP-----------------------------KNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKLNLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKDISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHAM------------------EDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIRQSPNSQG 6529
            Q R    A  +L TR SL DEELK+HVYKKTL+A+IYPIS  TPH F+V  ATKPT+CYECEGLLWG+ARQG+RC ECGVK HEKC+ELLNADCLQRAAEKSSK GAE +TQ II +M D M+ R +N PEIF+ I+ VF+V++  H  H+K+I+QS+LDGTS WSAKI+ITV  AQGL  KD+TG+SDPYVT+QVGK KKRTKT+   LNP W+EKF FECHNSS+RIK+RVWDED+D+KS+++ +L RESDDFLGQ+IIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEI GEEKVAPYH+QYTCLHENIFHF   +    G   +  A     +E W+I+FD   ++I +EFAMRYG+ES+YQAMTHFSCL++K+M  G+PAV+STLLANINA+YAH T++TN SA  RFAA+NFG+++F+KLLDQLHNS++I+L  YRN F  S   RLNDLKSTVDLLTSI FFRMKV EL SPPRA  VVR+CV+AC+K+TY+++F +  EL++   +P D+           Q+  +TG                              +NLEFW KLI L+VS+IE+DK  Y P +NQFPQE+++ ++S   MW   ++ ++ AL  E+ + +  KT+DY+NL F++KW YN YV DLP   D +P YP WF P+V+ WL EN++VS  ++  A ERDK++GFQ++SEHAL+S+SVVDIFTQLNQ F +I+KLECP+PA+ + + KRF+ T+ KVLL Y +++ K +  Y +K+++ C+LMNNI ++RVLLEK+FE+MG + L+T+  D +NDLQ  LS V+DS +  FA  F+  I   ++++ +LL+ Q++    ++     E ++ ++LRPLM++ + NLS+ A  CE+ VLKR+LK+LW+  +  LE+ I+LP          N S+ +Q      G+S                LK        +L+P QC ++D  L+AIK YFHAGG+GLK +++E+S EL+SLR+AL LYSQTTD LIK F+S+Q SQ    M                  E  +GE  +++++    S  E K++  ++A+  + WQT+ +FRPFVE+ ++GP + +KKR++ TKSK+N+W+ ++NESF F++   E P+ YE+Q+ VKDYCFGR D+++G +V+QL  +  + S   W  LG ++H D  G T+LRILSQR  D++AKEFV+LKS+ R  P  +G
Sbjct:    3 QSRKAGLAQ-TLATRASLKDEELKIHVYKKTLEALIYPISCTTPHHFEVWTATKPTYCYECEGLLWGIARQGMRCAECGVKVHEKCQELLNADCLQRAAEKSSKTGAEDRTQHIITAMKDRMKIRERNRPEIFEEIRKVFNVSKTIHAQHMKNIKQSVLDGTSNWSAKISITVVSAQGLQAKDRTGSSDPYVTIQVGKTKKRTKTIYGNLNPVWEEKFCFECHNSSDRIKLRVWDEDDDIKSRVKMRLKRESDDFLGQSIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIAGEEKVAPYHVQYTCLHENIFHF-STDVEGGGAVRIPVAVG---DEAWKIFFDEVLQEIADEFAMRYGVESMYQAMTHFSCLSSKYMLSGIPAVMSTLLANINAFYAHPTASTNVSAPARFAASNFGRDRFVKLLDQLHNSLRIDLSTYRNNFPVSSKPRLNDLKSTVDLLTSIAFFRMKVLELPSPPRAASVVRDCVKACLKSTYEYIFNNCQELFNHQFQPADQSPPEPKKKKKKQDDGQTGEEDEEQDEELEEGEEEEKECLPPEEQGPSIQNLEFWPKLITLIVSIIEEDKNSYTPVINQFPQELDVGKVSAEVMWSLYAQDMKFALE-EHEQHKLCKTADYMNLHFKVKWLYNEYVKDLPAFADAVPEYPSWFVPFVLAWLAENEDVSLEFMHGALERDKREGFQQTSEHALFSSSVVDIFTQLNQSFGIIQKLECPDPAVVAQYSKRFAKTITKVLLEYCALLAKSFPSYCEKEKIPCVLMNNIWRMRVLLEKMFESMGAKQLDTEAADILNDLQMRLSGVLDSFSTIFAKSFQGRINGCMRQMAELLY-QMRGPPNRD---TAEADADVMLRPLMEFLDGNLSIFADACEKTVLKRILKDLWKTVLCSLEKTIVLPQ--------CNDSLGAQILTAAKGLSN---------------LK--GGGEAKTLTPKQCLILDAGLEAIKQYFHAGGSGLKKTFVEKSPELESLRYALSLYSQTTDALIKTFVSTQHSQVHDGMGIRITANEKVRPDRGSGVERPIGEAVLQIDMM---SGKERKVSVRVMAVNDMKWQTSGMFRPFVELSMVGPFLADKKRRFTTKSKNNSWTAKFNESFQFVL-GKETPDCYELQLTVKDYCFGRTDRVVGLSVVQLRDVASRKSCVCWCPLGPRIHTDETGTTVLRILSQRPADEVAKEFVKLKSESR--PAEEG 1199          
BLAST of Protein unc-13 homolog B vs. Planmine SMEST
Match: SMESG000061526.1 (SMESG000061526.1)

HSP 1 Score: 4124.7 bits (10696), Expect = 0.000e+0
Identity = 2079/2082 (99.86%), Postives = 2079/2082 (99.86%), Query Frame = 2
Query:  284 MGGSSSVPCNVLTSCSNVHVNNSDSTSSILSQRDIIVNDFITSAMNMNKRTNEPTIYASRXXXXXXXXXXXXXXCGIDSYNDSRSVLKSDRLFVGYNDSKDFCRRRASPMEMHPIRFSPNIIHPVQSVVQATLNSGLTQEVVIGNHLDCSCPLVSYGHGYLDSRDLKSRWHPLQECSCPHEDVHRVFEEPFMKVARTVALLPLRETDILDDLVDSTSESSVESAFYPNNSRSINSLRDEHILFEAQRNSRKDNPFYTENKSTSHLGLQTSASNTCHSPSYIKNQLLANTSVPTDYYTHSLDTRKKSAKKNIDPEIVRYCSDDELFSPKASVRVFDHRRDSLMIXXXXXXXXXXXXEDENQPFIHDIDKVFEQAFSQSILPRQTTDSTTPPISTKSYSDSIKTRNDSFEEISSIDIKIPEEQLLRNNALSPKYNDETKENKVYEAEKDNQINYKQLEDNEDERXXXXXXXXXXXXXXXXXXXXKNDQISYYSQDKESLVMKFEASQDIHEYTDEDQESEKYRFQSVAMRDYEDEDQKFLENEDDKREIAIFEVQIKHKRNPNNEINYESEDEYDSLDLPEKDVEKSFSDYENLDRDSVVDETSNPPEYFIDPMYSDSESNPECEIDDLVNEXXXXXXXXXXVTHNDNEDPEAIYAKIIKKPSLLKDNPHXXXXXXXXXXXXXSIENVVQKSLGNLSDKXXXXXXXXXXPSDDVSKISDMSNNVDKSTSSKTVLEVEYLDPYSNNQLSRKFDSDNDDISEKYYRRGRGSIVEFIQERSSITSPVPMDSENMDIIVMSAEEMKRQEEEEIVNSKDTETPKESNKPENKISNEIRKLPGPKFAKIVQKHFIHIDTDMTDGTRRHEDGLDHDYGGFYKSIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRDQEPGDKIQNSDETGPKNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKLNLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKDISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIRQSPNSQG 6529
            MGGSSSVPCNVLTSCSNVHVNNSDSTSSILSQRDIIVNDFITSAMNMNKRTNEPTIYASRNVSVSDDFNNNSSFCGIDSYNDSRSVLKSDRLFVGYNDSKDFCRRRASPMEMHPIRFSPNIIHPVQSVVQATLNSGLTQEVVIGNHLDCSCPLVSYGHGYLDSRDLKSRWHPLQECSCPHEDVHRVFEEPFMKVARTVALLPLRETDILDDLVDSTSESSVESAFYPNNSRSINSLRDEHILFEAQRNSRKDNPFYTENKSTSHLGLQTSASNTCHSPSYIKNQLLANTSVPTDYYTHSLDTRKKSAKKNIDPEIVRYCSDDELFSPKASVRVFDHRRDSLMINGNVGFFNNGDGEDENQPFIHDIDKVFEQAFSQSILPRQTTDSTTPPISTKSYSDSIKTRNDSFEEISSIDIKIPEEQLLRNNALSPKYNDETKENKVYEAEKDNQINYKQLEDNEDERSQSLYEEDEDEYEQENSSYEKNDQISYYSQDKESLVMKFEASQDIHEYTDEDQESEKYRFQSVAMRDYEDEDQKFLENEDDKREIAIFEVQIKHKRNPNNEINYESEDEYDSLDLPEKDVEKSFSDYENLDRDSVVDETSNPPEYFIDPMYSDSESNPECEIDDLVNEIQNQNSSNIIVTHNDNEDPEAIYAKIIKKPSLLKDNPHENYEDDNYEEMNESIENVVQKSLGNLSDKTGGSSGETEGPSDDVSKISDMSNNVDKSTSSKTVLEVEYLDPYSNNQLSRKFDSDNDDISEKYYRRGRGSIVEFIQERSSITSPVPMDSENMDIIVMSAEEMKRQEEEEIVNSKDTETPKESNKPENKISNEIRKLPGPKFAKIVQKHFIHIDTDMTDGTRRHEDGLDHDYGGFYKSIDSQPDIKWRKKSISLVSDL   TMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRDQEPGDKIQNSDETGPKNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKLNLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKDISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIRQSPNSQG
Sbjct:    1 MGGSSSVPCNVLTSCSNVHVNNSDSTSSILSQRDIIVNDFITSAMNMNKRTNEPTIYASRNVSVSDDFNNNSSFCGIDSYNDSRSVLKSDRLFVGYNDSKDFCRRRASPMEMHPIRFSPNIIHPVQSVVQATLNSGLTQEVVIGNHLDCSCPLVSYGHGYLDSRDLKSRWHPLQECSCPHEDVHRVFEEPFMKVARTVALLPLRETDILDDLVDSTSESSVESAFYPNNSRSINSLRDEHILFEAQRNSRKDNPFYTENKSTSHLGLQTSASNTCHSPSYIKNQLLANTSVPTDYYTHSLDTRKKSAKKNIDPEIVRYCSDDELFSPKASVRVFDHRRDSLMINGNVGFFNNGDGEDENQPFIHDIDKVFEQAFSQSILPRQTTDSTTPPISTKSYSDSIKTRNDSFEEISSIDIKIPEEQLLRNNALSPKYNDETKENKVYEAEKDNQINYKQLEDNEDERSQSLYEEDEDEYEQENSSYEKNDQISYYSQDKESLVMKFEASQDIHEYTDEDQESEKYRFQSVAMRDYEDEDQKFLENEDDKREIAIFEVQIKHKRNPNNEINYESEDEYDSLDLPEKDVEKSFSDYENLDRDSVVDETSNPPEYFIDPMYSDSESNPECEIDDLVNEIQNQNSSNIIVTHNDNEDPEAIYAKIIKKPSLLKDNPHENYEDDNYEEMNESIENVVQKSLGNLSDKTGGSSGETEGPSDDVSKISDMSNNVDKSTSSKTVLEVEYLDPYSNNQLSRKFDSDNDDISEKYYRRGRGSIVEFIQERSSITSPVPMDSENMDIIVMSAEEMKRQEEEEIVNSKDTETPKESNKPENKISNEIRKLPGPKFAKIVQKHFIHIDTDMTDGTRRHEDGLDHDYGGFYKSIDSQPDIKWRKKSISLVSDL---TMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRDQEPGDKIQNSDETGPKNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKLNLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKDISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIRQSPNSQG 2079          
BLAST of Protein unc-13 homolog B vs. Planmine SMEST
Match: SMESG000061526.1 (SMESG000061526.1)

HSP 1 Score: 4110.84 bits (10660), Expect = 0.000e+0
Identity = 2079/2096 (99.19%), Postives = 2079/2096 (99.19%), Query Frame = 2
Query:  284 MGGSSSVPCNVLTSCSNVHVNNSDSTSSILSQRDIIVNDFITSAMNMNKRTNEPTIYASRXXXXXXXXXXXXXXCGIDSYNDSRSVLKSDRLFVGYNDSKDFCRRRASPMEMHPIRFSPNIIHPVQSVVQATLNSGLTQEVVIGNHLDCSCPLVSYGHGYLDSRDLKSRWHPLQECSCPHEDVHRVFEEPFMKVARTVALLPLRETDILDDLVDSTSESSVESAFYPNNSRSINSLRDEHILFEAQRNSRKDNPFYTENKSTSHLGLQTSASNTCHSPSYIKNQLLANTSVPTDYYTHSLDTRKKSAKKNIDPEIVRYCSDDELFSPKASVRVFDHRRDSLMIXXXXXXXXXXXXEDENQPFIHDIDKVFEQAFSQSILPRQTTDSTTPPISTKSYSDSIKTRNDSFEEISSIDIKIPEEQLLRNNALSPKYNDETKENKVYEAEKDNQINYKQLEDNEDERXXXXXXXXXXXXXXXXXXXXKNDQISYYSQDKESLVMKFEASQDIHEYTDEDQESEKYRFQSVAMRDYEDEDQKFLENEDDKREIAIFEVQIKHKRNPNNEINYESEDEYDSLDLPEKDVEKSFSDYENLDRDSVVDETSNPPEYFIDPMYSDSESNPECEIDDLVNEXXXXXXXXXXVTHNDNEDPEAIYAKIIKKPSLLKDNPHXXXXXXXXXXXXXSIENVVQKSLGNLSDKXXXXXXXXXXPSDDVSKISDMSNNVDKSTSSKTVLEVEYLDPYSNNQLSRKFDSDNDDISEKYYRRGRGSIVEFIQERSSITSPVPMDSENMDIIVMSAEEMKRQEEEEIVNSKDTETPKESNKPENKISNEIRKLPGPKFAKIVQKHFIHIDTDMTDGTRRHEDGLDHDYGGFYKSIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRDQEPGDKIQNSDETGPKNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKLNLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILK--------------DISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIRQSPNSQG 6529
            MGGSSSVPCNVLTSCSNVHVNNSDSTSSILSQRDIIVNDFITSAMNMNKRTNEPTIYASRNVSVSDDFNNNSSFCGIDSYNDSRSVLKSDRLFVGYNDSKDFCRRRASPMEMHPIRFSPNIIHPVQSVVQATLNSGLTQEVVIGNHLDCSCPLVSYGHGYLDSRDLKSRWHPLQECSCPHEDVHRVFEEPFMKVARTVALLPLRETDILDDLVDSTSESSVESAFYPNNSRSINSLRDEHILFEAQRNSRKDNPFYTENKSTSHLGLQTSASNTCHSPSYIKNQLLANTSVPTDYYTHSLDTRKKSAKKNIDPEIVRYCSDDELFSPKASVRVFDHRRDSLMINGNVGFFNNGDGEDENQPFIHDIDKVFEQAFSQSILPRQTTDSTTPPISTKSYSDSIKTRNDSFEEISSIDIKIPEEQLLRNNALSPKYNDETKENKVYEAEKDNQINYKQLEDNEDERSQSLYEEDEDEYEQENSSYEKNDQISYYSQDKESLVMKFEASQDIHEYTDEDQESEKYRFQSVAMRDYEDEDQKFLENEDDKREIAIFEVQIKHKRNPNNEINYESEDEYDSLDLPEKDVEKSFSDYENLDRDSVVDETSNPPEYFIDPMYSDSESNPECEIDDLVNEIQNQNSSNIIVTHNDNEDPEAIYAKIIKKPSLLKDNPHENYEDDNYEEMNESIENVVQKSLGNLSDKTGGSSGETEGPSDDVSKISDMSNNVDKSTSSKTVLEVEYLDPYSNNQLSRKFDSDNDDISEKYYRRGRGSIVEFIQERSSITSPVPMDSENMDIIVMSAEEMKRQEEEEIVNSKDTETPKESNKPENKISNEIRKLPGPKFAKIVQKHFIHIDTDMTDGTRRHEDGLDHDYGGFYKSIDSQPDIKWRKKSISLVSDL   TMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRDQEPGDKIQNSDETGPKNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKLNLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILK              DISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIRQSPNSQG
Sbjct:    1 MGGSSSVPCNVLTSCSNVHVNNSDSTSSILSQRDIIVNDFITSAMNMNKRTNEPTIYASRNVSVSDDFNNNSSFCGIDSYNDSRSVLKSDRLFVGYNDSKDFCRRRASPMEMHPIRFSPNIIHPVQSVVQATLNSGLTQEVVIGNHLDCSCPLVSYGHGYLDSRDLKSRWHPLQECSCPHEDVHRVFEEPFMKVARTVALLPLRETDILDDLVDSTSESSVESAFYPNNSRSINSLRDEHILFEAQRNSRKDNPFYTENKSTSHLGLQTSASNTCHSPSYIKNQLLANTSVPTDYYTHSLDTRKKSAKKNIDPEIVRYCSDDELFSPKASVRVFDHRRDSLMINGNVGFFNNGDGEDENQPFIHDIDKVFEQAFSQSILPRQTTDSTTPPISTKSYSDSIKTRNDSFEEISSIDIKIPEEQLLRNNALSPKYNDETKENKVYEAEKDNQINYKQLEDNEDERSQSLYEEDEDEYEQENSSYEKNDQISYYSQDKESLVMKFEASQDIHEYTDEDQESEKYRFQSVAMRDYEDEDQKFLENEDDKREIAIFEVQIKHKRNPNNEINYESEDEYDSLDLPEKDVEKSFSDYENLDRDSVVDETSNPPEYFIDPMYSDSESNPECEIDDLVNEIQNQNSSNIIVTHNDNEDPEAIYAKIIKKPSLLKDNPHENYEDDNYEEMNESIENVVQKSLGNLSDKTGGSSGETEGPSDDVSKISDMSNNVDKSTSSKTVLEVEYLDPYSNNQLSRKFDSDNDDISEKYYRRGRGSIVEFIQERSSITSPVPMDSENMDIIVMSAEEMKRQEEEEIVNSKDTETPKESNKPENKISNEIRKLPGPKFAKIVQKHFIHIDTDMTDGTRRHEDGLDHDYGGFYKSIDSQPDIKWRKKSISLVSDL---TMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRDQEPGDKIQNSDETGPKNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKLNLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKFIQLLRFGKRTYGSDISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIRQSPNSQG 2093          
BLAST of Protein unc-13 homolog B vs. Planmine SMEST
Match: SMESG000042667.1 (SMESG000042667.1)

HSP 1 Score: 1703.34 bits (4410), Expect = 0.000e+0
Identity = 813/1333 (60.99%), Postives = 1055/1333 (79.14%), Query Frame = 2
Query: 2516 LSRKFDSDNDDISEKYYRRGRGSIVEFIQERSSITSPVPMDSENMDIIVMSAEEMKRQEEEEIVNSKDTETPKESNKPENKISNEIRKLPGPKFAKIVQKHFIHIDTDMTDGTRRHEDGLDH-DYGGFYKSIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRD-QEPGDKIQNSDETGPKNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKLNLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKDISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIR 6508
            + R    D++++     R  R SI E  +E   + SP  +  +   I           E ++ VN+ D       N+  N  S    +L           +   + T+  D  +  E  L++ D   FY +I+S PD+K +KK   LVSDL   TM AQKRNL AA A+LVTR+SLNDEELK HVYKKTLQA++YPIS NTPH+FQV +AT PT+CYECEGLLWG+ARQG++C ECGVKCHEKCKELLNADCL RAAEKS++HGAE K   II++M DLMQ R+   PEIF++I  VF+V+   H+ H+K+++Q ILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGK KKRTKTV QELNP W+EKFYFECHN+S+RIK+RVWDEDNDL+SK+R KLT ESDDFLGQT+IEVRTLSGEMDVWYNLEKRTDKSAVSGA+RL ISVEIKGEEKVAPYHIQYTCLHENIFH+LCE+N ++ K E+   + +  +++W++YFD P+++I++EFA+RYGIESIYQAMTHFSCLTTK+MC GVPAV+STLLANINA+YAHT++++N+SASERF+A+NFGKEKF+KLLDQLHNS++I+L VYRN+F ASQ E+L DLKSTVDLLTSITFFRMKVQELSSPPRA QVV+EC QACM+TTYQFL+++VNELYSR  QE  D   + +    K+LEFW +LI LVVS+IE+DKK Y P LNQFPQEVN+  IS + MWQ   E L+ +L  ++++++  K+SDY+NL F++KWFYN Y+ D+P  + V+P+YPKWFEP+++QWL END+VS +YL+ AYERD+ DGF+ SS+ + +S SVVD+FTQL+QC +V++KLECP+  I ++FM+RFS TV+KVLL+YA ++K D+ +Y+ +QE ACIL+NNIQQ+RV LE+++EAMGG+SLE +TK  +++LQ  L+ VI+ LAK FAD  + +I  NI EL +LL  Q  + ++ N K ++EQES I+LRPLM+YF+A+LS L S+CE+ V KRLLKELW+IT+  LE+Q++LPP S  RQ+FL+++I + AQ KI+GMSQS+++HVSNQ+P+S  L+DISK+ + +LSP QCQV+D+ LD IK+YFHA G GLK SYL++S ELQSLR+AL LY+QTTD LIKNF+S+Q SQD  A+E+ VGEVS++V++ +HPS+GE+K+T  ++A  +L W TT++FRPFVE+ L+GP++ +KKRK+ATK+KSN WSP++NE+F+FLIS++E PE YE+ IC KDYCFGRAD LIG TV+QL  ++ Q S   W  LG+KLH D+ G TILRILSQRT D++A+EFV+LKS+ R
Sbjct:  787 IDRSMSKDSNEMVTNTRRSSRFSIYEDNKENWQVQSPGKLGRQQKSIT----------ESKDTVNNSDGNLSSAKNRWHNAFSRVCAQL-----------NENDVYTNRFDLKKSREPSLENQDKNNFYNNINSMPDVKLKKKIFPLVSDL---TMAAQKRNLGAATANLVTRKSLNDEELKNHVYKKTLQALLYPISCNTPHNFQVWSATSPTYCYECEGLLWGLARQGVKCQECGVKCHEKCKELLNADCLHRAAEKSARHGAEDKAMTIIQAMKDLMQRRIMTRPEIFEVISKVFNVDLRGHQGHMKTVQQGILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKVKKRTKTVPQELNPVWNEKFYFECHNASDRIKIRVWDEDNDLRSKLRSKLTSESDDFLGQTVIEVRTLSGEMDVWYNLEKRTDKSAVSGAVRLHISVEIKGEEKVAPYHIQYTCLHENIFHYLCEKNAAESKNEVKIPAAKG-DDSWKVYFDPPAQEIVDEFAIRYGIESIYQAMTHFSCLTTKYMCLGVPAVMSTLLANINAFYAHTSASSNQSASERFSASNFGKEKFVKLLDQLHNSLRISLSVYRNSFPASQNEKLQDLKSTVDLLTSITFFRMKVQELSSPPRASQVVKECAQACMQTTYQFLYDNVNELYSRQYQENIDTAADDNSNSLKSLEFWHRLITLVVSIIEEDKKSYGPVLNQFPQEVNIGHISAACMWQRFGEDLKASLE-QHVQAKPCKSSDYMNLLFKVKWFYNKYIADVPTFKSVVPDYPKWFEPFIMQWLNENDDVSMDYLRNAYERDRTDGFELSSDQSRFSTSVVDVFTQLSQCLEVLRKLECPDTQIQANFMQRFSATVSKVLLTYAEIVKGDFKQYVLRQEKACILINNIQQMRVQLERLWEAMGGQSLEAETKASLDELQQMLNSVINDLAKIFADSLQPQIVANISELAKLL--QNLKGSQNNQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLLKELWKITMHNLEKQVVLPPLSDPRQLFLSLNIPTNAQAKIVGMSQSIINHVSNQMPSSNFLQDISKEVEKNLSPRQCQVIDIALDTIKTYFHASGIGLKKSYLDKSPELQSLRYALSLYTQTTDALIKNFVSTQTSQDKPAVEEQVGEVSIQVDILKHPSSGEYKVTVKVVAANELKWNTTNMFRPFVEVVLIGPSLKDKKRKFATKTKSNNWSPKFNETFTFLISANEDPEFYELHICTKDYCFGRADSLIGLTVLQLRDVLSQSSCSCWCSLGKKLHMDDTGCTILRILSQRTNDEVAREFVRLKSEFR 2091          
BLAST of Protein unc-13 homolog B vs. Planmine SMEST
Match: SMESG000042667.1 (SMESG000042667.1)

HSP 1 Score: 1702.95 bits (4409), Expect = 0.000e+0
Identity = 813/1333 (60.99%), Postives = 1055/1333 (79.14%), Query Frame = 2
Query: 2516 LSRKFDSDNDDISEKYYRRGRGSIVEFIQERSSITSPVPMDSENMDIIVMSAEEMKRQEEEEIVNSKDTETPKESNKPENKISNEIRKLPGPKFAKIVQKHFIHIDTDMTDGTRRHEDGLDH-DYGGFYKSIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRD-QEPGDKIQNSDETGPKNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKLNLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKDISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIR 6508
            + R    D++++     R  R SI E  +E   + SP  +  +   I           E ++ VN+ D       N+  N  S    +L           +   + T+  D  +  E  L++ D   FY +I+S PD+K +KK   LVSDL   TM AQKRNL AA A+LVTR+SLNDEELK HVYKKTLQA++YPIS NTPH+FQV +AT PT+CYECEGLLWG+ARQG++C ECGVKCHEKCKELLNADCL RAAEKS++HGAE K   II++M DLMQ R+   PEIF++I  VF+V+   H+ H+K+++Q ILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGK KKRTKTV QELNP W+EKFYFECHN+S+RIK+RVWDEDNDL+SK+R KLT ESDDFLGQT+IEVRTLSGEMDVWYNLEKRTDKSAVSGA+RL ISVEIKGEEKVAPYHIQYTCLHENIFH+LCE+N ++ K E+   + +  +++W++YFD P+++I++EFA+RYGIESIYQAMTHFSCLTTK+MC GVPAV+STLLANINA+YAHT++++N+SASERF+A+NFGKEKF+KLLDQLHNS++I+L VYRN+F ASQ E+L DLKSTVDLLTSITFFRMKVQELSSPPRA QVV+EC QACM+TTYQFL+++VNELYSR  QE  D   + +    K+LEFW +LI LVVS+IE+DKK Y P LNQFPQEVN+  IS + MWQ   E L+ +L  ++++++  K+SDY+NL F++KWFYN Y+ D+P  + V+P+YPKWFEP+++QWL END+VS +YL+ AYERD+ DGF+ SS+ + +S SVVD+FTQL+QC +V++KLECP+  I ++FM+RFS TV+KVLL+YA ++K D+ +Y+ +QE ACIL+NNIQQ+RV LE+++EAMGG+SLE +TK  +++LQ  L+ VI+ LAK FAD  + +I  NI EL +LL  Q  + ++ N K ++EQES I+LRPLM+YF+A+LS L S+CE+ V KRLLKELW+IT+  LE+Q++LPP S  RQ+FL+++I + AQ KI+GMSQS+++HVSNQ+P+S  L+DISK+ + +LSP QCQV+D+ LD IK+YFHA G GLK SYL++S ELQSLR+AL LY+QTTD LIKNF+S+Q SQD  A+E+ VGEVS++V++ +HPS+GE+K+T  ++A  +L W TT++FRPFVE+ L+GP++ +KKRK+ATK+KSN WSP++NE+F+FLIS++E PE YE+ IC KDYCFGRAD LIG TV+QL  ++ Q S   W  LG+KLH D+ G TILRILSQRT D++A+EFV+LKS+ R
Sbjct:  793 IDRSMSKDSNEMVTNTRRSSRFSIYEDNKENWQVQSPGKLGRQQKSIT----------ESKDTVNNSDGNLSSAKNRWHNAFSRVCAQL-----------NENDVYTNRFDLKKSREPSLENQDKNNFYNNINSMPDVKLKKKIFPLVSDL---TMAAQKRNLGAATANLVTRKSLNDEELKNHVYKKTLQALLYPISCNTPHNFQVWSATSPTYCYECEGLLWGLARQGVKCQECGVKCHEKCKELLNADCLHRAAEKSARHGAEDKAMTIIQAMKDLMQRRIMTRPEIFEVISKVFNVDLRGHQGHMKTVQQGILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKVKKRTKTVPQELNPVWNEKFYFECHNASDRIKIRVWDEDNDLRSKLRSKLTSESDDFLGQTVIEVRTLSGEMDVWYNLEKRTDKSAVSGAVRLHISVEIKGEEKVAPYHIQYTCLHENIFHYLCEKNAAESKNEVKIPAAKG-DDSWKVYFDPPAQEIVDEFAIRYGIESIYQAMTHFSCLTTKYMCLGVPAVMSTLLANINAFYAHTSASSNQSASERFSASNFGKEKFVKLLDQLHNSLRISLSVYRNSFPASQNEKLQDLKSTVDLLTSITFFRMKVQELSSPPRASQVVKECAQACMQTTYQFLYDNVNELYSRQYQENIDTAADDNSNSLKSLEFWHRLITLVVSIIEEDKKSYGPVLNQFPQEVNIGHISAACMWQRFGEDLKASLE-QHVQAKPCKSSDYMNLLFKVKWFYNKYIADVPTFKSVVPDYPKWFEPFIMQWLNENDDVSMDYLRNAYERDRTDGFELSSDQSRFSTSVVDVFTQLSQCLEVLRKLECPDTQIQANFMQRFSATVSKVLLTYAEIVKGDFKQYVLRQEKACILINNIQQMRVQLERLWEAMGGQSLEAETKASLDELQQMLNSVINDLAKIFADSLQPQIVANISELAKLL--QNLKGSQNNQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLLKELWKITMHNLEKQVVLPPLSDPRQLFLSLNIPTNAQAKIVGMSQSIINHVSNQMPSSNFLQDISKEVEKNLSPRQCQVIDIALDTIKTYFHASGIGLKKSYLDKSPELQSLRYALSLYTQTTDALIKNFVSTQTSQDKPAVEEQVGEVSIQVDILKHPSSGEYKVTVKVVAANELKWNTTNMFRPFVEVVLIGPSLKDKKRKFATKTKSNNWSPKFNETFTFLISANEDPEFYELHICTKDYCFGRADSLIGLTVLQLRDVLSQSSCSCWCSLGKKLHMDDTGCTILRILSQRTNDEVAREFVRLKSEFR 2097          
BLAST of Protein unc-13 homolog B vs. Planmine SMEST
Match: SMESG000042667.1 (SMESG000042667.1)

HSP 1 Score: 1688.32 bits (4371), Expect = 0.000e+0
Identity = 817/1377 (59.33%), Postives = 1057/1377 (76.76%), Query Frame = 2
Query: 2516 LSRKFDSDNDDISEKYYRRGRGSIVEFIQERSSITSPVPMDSENMDIIVMSAEEMKRQEEEEIVNSKDTETPKESNKPENKISNEIRKLPGPKFAKIVQKHFIHIDTDMTDGTRRHEDGLDH-DYGGFYKSIDSQPDIKWRKKSISLVSDLVLQTMTAQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQVLNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAAEKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEIHLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKGKKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLTRESDDFLGQTI--------------------------------------------IEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYFDWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANINAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNAFMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACMKTTYQFLFEHVNELYSRD-QEPGDKIQNSDETGPKNLEFWQKLIPLVVSVIEDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSSKTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDEVSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLECPNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQQVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEEEIENNIKELHQLLHTQIQETAKKNPKLNLEQESFIVLRPLMDYFEANLSLLASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQAQNKILGMSQSLLSHVSNQVPNSKILKDISKDTDHSLSPSQCQVMDMCLDAIKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCSQDTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRPFVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEVQICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWTILRILSQRTGDDIAKEFVQLKSQIR 6508
            + R    D++++     R  R SI E  +E   + SP  +  +   I           E ++ VN+ D       N+  N  S    +L           +   + T+  D  +  E  L++ D   FY +I+S PD+K +KK   LVSDL   TM AQKRNL AA A+LVTR+SLNDEELK HVYKKTLQA++YPIS NTPH+FQV +AT PT+CYECEGLLWG+ARQG++C ECGVKCHEKCKELLNADCL RAAEKS++HGAE K   II++M DLMQ R+   PEIF++I  VF+V+   H+ H+K+++Q ILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGK KKRTKTV QELNP W+EKFYFECHN+S+RIK+RVWDEDNDLKS+IRQKLTRESDDFLGQTI                                            IEVRTLSGEMDVWYNLEKRTDKSAVSGA+RL ISVEIKGEEKVAPYHIQYTCLHENIFH+LCE+N ++ K E+   + +  +++W++YFD P+++I++EFA+RYGIESIYQAMTHFSCLTTK+MC GVPAV+STLLANINA+YAHT++++N+SASERF+A+NFGKEKF+KLLDQLHNS++I+L VYRN+F ASQ E+L DLKSTVDLLTSITFFRMKVQELSSPPRA QVV+EC QACM+TTYQFL+++VNELYSR  QE  D   + +    K+LEFW +LI LVVS+IE+DKK Y P LNQFPQEVN+  IS + MWQ   E L+ +L  ++++++  K+SDY+NL F++KWFYN Y+ D+P  + V+P+YPKWFEP+++QWL END+VS +YL+ AYERD+ DGF+ SS+ + +S SVVD+FTQL+QC +V++KLECP+  I ++FM+RFS TV+KVLL+YA ++K D+ +Y+ +QE ACIL+NNIQQ+RV LE+++EAMGG+SLE +TK  +++LQ  L+ VI+ LAK FAD  + +I  NI EL +LL  Q  + ++ N K ++EQES I+LRPLM+YF+A+LS L S+CE+ V KRLLKELW+IT+  LE+Q++LPP S  RQ+FL+++I + AQ KI+GMSQS+++HVSNQ+P+S  L+DISK+ + +LSP QCQV+D+ LD IK+YFHA G GLK SYL++S ELQSLR+AL LY+QTTD LIKNF+S+Q SQD  A+E+ VGEVS++V++ +HPS+GE+K+T  ++A  +L W TT++FRPFVE+ L+GP++ +KKRK+ATK+KSN WSP++NE+F+FLIS++E PE YE+ IC KDYCFGRAD LIG TV+QL  ++ Q S   W  LG+KLH D+ G TILRILSQRT D++A+EFV+LKS+ R
Sbjct:  787 IDRSMSKDSNEMVTNTRRSSRFSIYEDNKENWQVQSPGKLGRQQKSIT----------ESKDTVNNSDGNLSSAKNRWHNAFSRVCAQL-----------NENDVYTNRFDLKKSREPSLENQDKNNFYNNINSMPDVKLKKKIFPLVSDL---TMAAQKRNLGAATANLVTRKSLNDEELKNHVYKKTLQALLYPISCNTPHNFQVWSATSPTYCYECEGLLWGLARQGVKCQECGVKCHEKCKELLNADCLHRAAEKSARHGAEDKAMTIIQAMKDLMQRRIMTRPEIFEVISKVFNVDLRGHQGHMKTVQQGILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKVKKRTKTVPQELNPVWNEKFYFECHNASDRIKIRVWDEDNDLKSRIRQKLTRESDDFLGQTIVEVRTLSGEMDVWYNLGRDEDNDLRSKLRSKLTSESDDFLGQTVIEVRTLSGEMDVWYNLEKRTDKSAVSGAVRLHISVEIKGEEKVAPYHIQYTCLHENIFHYLCEKNAAESKNEVKIPAAKG-DDSWKVYFDPPAQEIVDEFAIRYGIESIYQAMTHFSCLTTKYMCLGVPAVMSTLLANINAFYAHTSASSNQSASERFSASNFGKEKFVKLLDQLHNSLRISLSVYRNSFPASQNEKLQDLKSTVDLLTSITFFRMKVQELSSPPRASQVVKECAQACMQTTYQFLYDNVNELYSRQYQENIDTAADDNSNSLKSLEFWHRLITLVVSIIEEDKKSYGPVLNQFPQEVNIGHISAACMWQRFGEDLKASLE-QHVQAKPCKSSDYMNLLFKVKWFYNKYIADVPTFKSVVPDYPKWFEPFIMQWLNENDDVSMDYLRNAYERDRTDGFELSSDQSRFSTSVVDVFTQLSQCLEVLRKLECPDTQIQANFMQRFSATVSKVLLTYAEIVKGDFKQYVLRQEKACILINNIQQMRVQLERLWEAMGGQSLEAETKASLDELQQMLNSVINDLAKIFADSLQPQIVANISELAKLL--QNLKGSQNNQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLLKELWKITMHNLEKQVVLPPLSDPRQLFLSLNIPTNAQAKIVGMSQSIINHVSNQMPSSNFLQDISKEVEKNLSPRQCQVIDIALDTIKTYFHASGIGLKKSYLDKSPELQSLRYALSLYTQTTDALIKNFVSTQTSQDKPAVEEQVGEVSIQVDILKHPSSGEYKVTVKVVAANELKWNTTNMFRPFVEVVLIGPSLKDKKRKFATKTKSNNWSPKFNETFTFLISANEDPEFYELHICTKDYCFGRADSLIGLTVLQLRDVLSQSSCSCWCSLGKKLHMDDTGCTILRILSQRTNDEVAREFVRLKSEFR 2135          
The following BLAST results are available for this feature:
BLAST of Protein unc-13 homolog B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
UNC13B0.000e+058.20unc-13 homolog B [Source:HGNC Symbol;Acc:HGNC:1256... [more]
UNC13B0.000e+058.40unc-13 homolog B [Source:HGNC Symbol;Acc:HGNC:1256... [more]
UNC13B0.000e+057.55unc-13 homolog B [Source:HGNC Symbol;Acc:HGNC:1256... [more]
UNC13B0.000e+057.55unc-13 homolog B [Source:HGNC Symbol;Acc:HGNC:1256... [more]
UNC13B0.000e+057.55unc-13 homolog B [Source:HGNC Symbol;Acc:HGNC:1256... [more]
back to top
BLAST of Protein unc-13 homolog B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-130.000e+051.30Phorbol ester/diacylglycerol-binding protein unc-1... [more]
unc-130.000e+053.71Phorbol ester/diacylglycerol-binding protein unc-1... [more]
unc-130.000e+053.71Phorbol ester/diacylglycerol-binding protein unc-1... [more]
unc-130.000e+053.71Phorbol ester/diacylglycerol-binding protein unc-1... [more]
unc-130.000e+053.71Phorbol ester/diacylglycerol-binding protein unc-1... [more]
back to top
BLAST of Protein unc-13 homolog B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-130.000e+060.47gene:FBgn0025726 transcript:FBtr0089246[more]
unc-130.000e+060.47gene:FBgn0025726 transcript:FBtr0308806[more]
unc-130.000e+060.31gene:FBgn0025726 transcript:FBtr0344971[more]
unc-130.000e+060.31gene:FBgn0025726 transcript:FBtr0089247[more]
unc-130.000e+059.41gene:FBgn0025726 transcript:FBtr0308805[more]
back to top
BLAST of Protein unc-13 homolog B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
UNC13B0.000e+058.42unc-13 homolog Bb (C. elegans) [Source:NCBI gene;A... [more]
unc13a0.000e+057.51unc-13 homolog A (C. elegans) [Source:ZFIN;Acc:ZDB... [more]
unc13a0.000e+057.51unc-13 homolog A (C. elegans) [Source:ZFIN;Acc:ZDB... [more]
unc13a0.000e+057.51unc-13 homolog A (C. elegans) [Source:ZFIN;Acc:ZDB... [more]
unc13a0.000e+056.66unc-13 homolog A (C. elegans) [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Protein unc-13 homolog B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ctcf0.000e+053.93CCCTC-binding factor [Source:Xenbase;Acc:XB-GENE-8... [more]
ctcf0.000e+057.19CCCTC-binding factor [Source:Xenbase;Acc:XB-GENE-8... [more]
ctcf0.000e+053.14CCCTC-binding factor [Source:Xenbase;Acc:XB-GENE-8... [more]
ctcf0.000e+056.32CCCTC-binding factor [Source:Xenbase;Acc:XB-GENE-8... [more]
ctcf0.000e+057.04CCCTC-binding factor [Source:Xenbase;Acc:XB-GENE-8... [more]
back to top
BLAST of Protein unc-13 homolog B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Unc13b0.000e+058.12unc-13 homolog B [Source:MGI Symbol;Acc:MGI:134227... [more]
Unc13b0.000e+058.32unc-13 homolog B [Source:MGI Symbol;Acc:MGI:134227... [more]
Unc13b0.000e+058.32unc-13 homolog B [Source:MGI Symbol;Acc:MGI:134227... [more]
Unc13b0.000e+058.32unc-13 homolog B [Source:MGI Symbol;Acc:MGI:134227... [more]
Unc13b0.000e+057.47unc-13 homolog B [Source:MGI Symbol;Acc:MGI:134227... [more]
back to top
BLAST of Protein unc-13 homolog B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O14795|UN13B_HUMAN0.000e+058.40Protein unc-13 homolog B OS=Homo sapiens OX=9606 G... [more]
sp|Q9Z1N9|UN13B_MOUSE0.000e+058.32Protein unc-13 homolog B OS=Mus musculus OX=10090 ... [more]
sp|Q62769|UN13B_RAT0.000e+056.99Protein unc-13 homolog B OS=Rattus norvegicus OX=1... [more]
sp|Q9UPW8|UN13A_HUMAN0.000e+057.58Protein unc-13 homolog A OS=Homo sapiens OX=9606 G... [more]
sp|Q4KUS2|UN13A_MOUSE0.000e+057.17Protein unc-13 homolog A OS=Mus musculus OX=10090 ... [more]
back to top
BLAST of Protein unc-13 homolog B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H2KSB20.000e+064.42Protein unc-13 homolog B (Fragment) OS=Clonorchis ... [more]
A0A4S2M1140.000e+064.42Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A419Q3K10.000e+064.42Protein unc-13-like protein B OS=Clonorchis sinens... [more]
A0A0X3PEQ80.000e+062.85Uncharacterized protein (Fragment) OS=Schistocepha... [more]
A0A5K3F8G10.000e+061.95Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of Protein unc-13 homolog B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000049675.10.000e+056.41pep primary_assembly:Astyanax_mexicanus-2.0:20:158... [more]
unc13a0.000e+054.89protein unc-13 homolog A-like [Source:NCBI gene;Ac... [more]
unc13a0.000e+055.96protein unc-13 homolog A-like [Source:NCBI gene;Ac... [more]
unc13ba0.000e+053.05unc-13 homolog Ba (C. elegans) [Source:ZFIN;Acc:ZD... [more]
ENSAMXT00000036882.10.000e+058.66pep primary_assembly:Astyanax_mexicanus-2.0:20:158... [more]
back to top
BLAST of Protein unc-13 homolog B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006160.10.000e+062.39pep scaffold:Pmarinus_7.0:GL476688:98794:160173:1 ... [more]
ENSPMAT00000004337.10.000e+063.50pep scaffold:Pmarinus_7.0:GL478852:175856:252872:1... [more]
PRKCE6.858e-1144.83protein kinase C epsilon [Source:HGNC Symbol;Acc:H... [more]
ENSPMAT00000002458.17.283e-1054.35pep scaffold:Pmarinus_7.0:GL479588:3:23579:-1 gene... [more]
ENSPMAT00000002460.18.106e-1054.35pep scaffold:Pmarinus_7.0:GL479588:3:23579:-1 gene... [more]
back to top
BLAST of Protein unc-13 homolog B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
TCB24.172e-628.89ER protein involved in ER-plasma membrane tetherin... [more]
back to top
BLAST of Protein unc-13 homolog B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO320500.000e+059.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302339.468e-12040.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO449254.027e-1225.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329311.882e-936.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460716.198e-931.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein unc-13 homolog B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
UNC13A0.000e+055.76protein unc-13 homolog A [Source:NCBI gene;Acc:105... [more]
UNC13A0.000e+055.12protein unc-13 homolog A [Source:NCBI gene;Acc:105... [more]
UNC13B0.000e+055.62unc-13 homolog B [Source:NCBI gene;Acc:101167071][more]
ENSORLT00000005973.20.000e+052.82unc-13 homolog A [Source:NCBI gene;Acc:101164968][more]
unc13ba0.000e+052.34protein unc-13 homolog B-like [Source:NCBI gene;Ac... [more]
back to top
BLAST of Protein unc-13 homolog B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000061526.10.000e+099.86SMESG000061526.1[more]
SMESG000061526.10.000e+099.19SMESG000061526.1[more]
SMESG000042667.10.000e+060.99SMESG000042667.1[more]
SMESG000042667.10.000e+060.99SMESG000042667.1[more]
SMESG000042667.10.000e+059.33SMESG000042667.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035906 ID=SMED30035906|Name=Protein unc-13 homolog B|organism=Schmidtea mediterranea sexual|type=transcript|length=7097bp
AGTAGAGACACACAAACACAAGCACACATGCTGCACACAGAGTGAGCATT
CAGCGATTGGAGTAGAAAAGAAAATGAATTTGTACTCGAAAATTGACTGT
TAGTCAGCAGTTTGTTCTCTATCCAAACAGATGCAGATTTCACTGGGAAA
TTTGTGTGTTACAAAGAAACATTCTCCGATTGTAATAAAATTATCTTGTT
TCACATTAATAAAATATTTTATTGATAACTGAATTACCCATTGTTGTGCC
AAATCAACATCATGAGTTCTGGTCCCTTCTGCCATGGGAGGGAGTAGCAG
TGTTCCATGTAACGTATTAACCAGCTGTTCCAATGTCCATGTCAACAATA
GCGACTCCACTAGTTCAATATTATCCCAGCGTGATATTATTGTTAATGAT
TTCATAACATCTGCTATGAATATGAATAAACGAACCAACGAGCCGACCAT
TTATGCATCTAGAAATGTTTCCGTATCCGATGATTTTAATAACAATTCCA
GTTTCTGTGGAATAGATTCTTACAATGATTCGAGATCCGTGTTGAAGTCT
GATAGATTATTTGTTGGATATAACGACTCGAAGGATTTCTGTCGTCGAAG
AGCTAGTCCAATGGAAATGCACCCGATTCGATTTTCACCGAATATCATTC
ATCCAGTCCAATCTGTCGTTCAAGCCACTCTTAATAGTGGTCTTACTCAA
GAAGTTGTCATTGGAAACCATCTCGATTGTTCTTGTCCACTGGTTTCTTA
TGGCCATGGTTATTTAGATTCCCGAGACCTGAAAAGTAGATGGCATCCTC
TACAAGAATGCTCATGTCCACATGAAGATGTCCATCGGGTCTTTGAAGAG
CCTTTTATGAAAGTAGCACGAACTGTTGCTCTTTTACCATTGAGAGAAAC
TGATATCCTCGATGATCTTGTTGATTCTACAAGCGAAAGCTCTGTTGAGT
CTGCCTTTTATCCGAATAATTCTCGTTCCATCAACAGTTTGCGCGACGAA
CACATTCTTTTCGAAGCTCAAAGAAACTCCAGAAAAGATAACCCATTTTA
TACTGAAAACAAATCTACAAGCCACCTTGGCCTACAGACCTCTGCCTCTA
ACACTTGCCATTCTCCAAGTTATATTAAAAACCAACTTCTAGCAAACACG
AGTGTTCCTACAGATTATTATACGCATAGTTTAGATACTAGAAAAAAGTC
TGCCAAAAAAAATATAGATCCGGAAATTGTAAGGTACTGTTCGGACGATG
AATTATTTTCGCCAAAGGCTAGTGTAAGAGTTTTTGATCATCGACGAGAT
TCGTTGATGATAAATGGAAATGTCGGTTTCTTTAATAACGGAGATGGGGA
GGATGAAAACCAACCATTCATTCATGATATTGATAAAGTGTTTGAACAAG
CATTTTCTCAGTCTATTCTACCGAGACAAACAACAGATTCGACAACCCCA
CCAATTTCAACGAAATCCTACTCCGACAGTATCAAAACTAGAAATGATTC
TTTTGAAGAAATCTCCTCCATTGATATCAAAATACCTGAAGAACAGTTAT
TGAGAAATAATGCATTAAGTCCTAAATACAACGACGAAACTAAGGAAAAT
AAAGTCTATGAAGCGGAGAAAGATAACCAAATAAATTATAAGCAACTTGA
GGACAATGAAGATGAGCGATCACAATCATTGTATGAAGAAGATGAAGATG
AGTATGAACAAGAAAATTCATCTTATGAAAAAAACGATCAAATATCGTAC
TATTCTCAGGACAAAGAATCTTTGGTTATGAAATTTGAAGCCAGTCAAGA
TATACATGAATATACTGACGAAGATCAAGAATCAGAAAAGTACAGATTCC
AATCAGTTGCAATGCGTGATTATGAAGATGAGGATCAGAAATTCTTAGAA
AACGAAGACGATAAACGAGAAATTGCAATATTCGAAGTACAAATTAAACA
TAAAAGAAATCCTAATAACGAAATAAATTACGAGTCCGAGGACGAGTATG
ATTCTTTAGATTTACCAGAAAAGGACGTTGAAAAGAGTTTTTCCGATTAT
GAAAATCTGGATAGAGATTCTGTAGTAGATGAAACCTCAAATCCTCCAGA
ATACTTCATAGATCCTATGTACTCGGATTCCGAGAGCAACCCGGAATGTG
AAATTGATGATTTGGTAAATGAAATACAAAATCAAAATTCTTCAAACATC
ATTGTCACTCACAATGACAATGAAGACCCTGAAGCAATCTACGCGAAAAT
CATAAAAAAACCATCACTTTTGAAAGATAATCCACATGAAAATTATGAAG
ATGACAATTATGAAGAAATGAATGAGTCAATAGAGAATGTAGTACAGAAA
TCGCTTGGAAACTTATCAGACAAAACTGGTGGTAGCAGTGGTGAAACAGA
AGGCCCATCAGATGATGTTTCTAAAATTTCTGACATGTCGAATAATGTCG
ACAAAAGCACTTCATCGAAAACCGTATTGGAAGTAGAATATCTAGATCCG
TATTCGAACAATCAGCTATCCCGAAAATTTGACAGTGACAACGACGACAT
TTCCGAAAAGTATTACCGACGTGGTCGAGGATCTATTGTCGAATTCATTC
AAGAGAGATCTTCAATCACTTCGCCTGTGCCTATGGATTCTGAAAACATG
GATATTATAGTTATGTCTGCCGAGGAAATGAAACGACAGGAGGAAGAAGA
AATTGTAAATTCAAAAGATACTGAAACTCCAAAGGAATCAAATAAACCCG
AAAATAAAATTTCAAATGAAATCCGAAAATTGCCCGGGCCGAAATTTGCT
AAAATAGTACAAAAGCATTTCATACACATCGACACTGATATGACAGACGG
AACCAGACGTCATGAAGACGGATTGGATCATGACTACGGAGGATTCTACA
AGTCCATCGACAGTCAACCAGACATCAAGTGGCGGAAGAAGTCCATTTCG
TTGGTCAGCGATCTGGTTTTGCAGACGATGACGGCTCAGAAAAGAAATCT
CAACGCCGCCAATGCCAGCCTGGTAACAAGACAATCTCTAAATGATGAGG
AGCTGAAAATGCATGTTTATAAGAAAACATTGCAAGCAATGATTTATCCA
ATTTCTTCTAATACGCCTCACAGCTTTCAAGTACTAAATGCAACTAAACC
GACGTTTTGTTACGAATGTGAAGGTCTTTTGTGGGGAGTTGCTCGCCAAG
GCCTACGGTGCATTGAATGTGGTGTAAAATGTCATGAAAAATGCAAAGAA
CTTCTTAATGCAGATTGTTTACAAAGAGCTGCTGAAAAATCATCAAAGCA
CGGCGCTGAAAGCAAAACTCAAGCTATAATTAAGTCAATGAATGATCTTA
TGCAGGCGCGTGTTAAAAACAATCCTGAAATTTTCAAGATAATTAAAGAT
GTATTTTCTGTCAACGAAGAGGCGCATGAAATACATTTGAAGTCCATCAG
ACAGAGCATACTTGACGGGACGAGTAAATGGTCAGCCAAAATAGCAATAA
CAGTAAAATGCGCTCAAGGATTGATTGGAAAAGATAAAACCGGAACAAGT
GATCCATACGTTACTGTTCAAGTAGGTAAAGGGAAGAAACGAACAAAAAC
AGTTTTGCAAGAACTGAACCCATCTTGGGATGAAAAGTTTTATTTTGAAT
GCCACAATTCTTCTGAGCGAATCAAAGTAAGAGTTTGGGATGAAGATAAT
GATTTGAAATCAAAAATTCGGCAAAAACTTACTAGGGAATCTGATGACTT
CCTTGGTCAGACTATTATCGAAGTGAGAACTCTTAGTGGAGAAATGGACG
TCTGGTATAATCTTGAAAAAAGAACCGACAAATCTGCGGTTTCAGGAGCT
ATCAGATTGCAAATTTCAGTAGAAATCAAAGGCGAAGAAAAAGTTGCTCC
TTATCATATACAATACACCTGTCTACACGAGAACATTTTCCATTTTTTGT
GTGAAGAAAATACTTCTCAAGGAAAACCGGAATTGATATTTGCAAGTAAT
CGGAATCTCGAAGAAACATGGAGGATTTATTTCGACTGGCCGTCAGAAGA
CATAATTGAGGAATTTGCTATGAGATATGGAATCGAATCTATCTATCAAG
CAATGACACATTTCTCATGCCTGACAACGAAGTTTATGTGTCCCGGTGTT
CCAGCGGTTTTGTCAACATTATTAGCCAATATAAACGCATATTATGCTCA
TACGACTTCTACGACAAATCGATCTGCCAGTGAAAGATTTGCCGCGAATA
ATTTTGGAAAAGAAAAATTTATCAAATTGTTAGATCAACTGCACAATTCA
ATTAAAATCAATTTATGTGTATATAGAAATGCCTTCATGGCCAGTCAACC
AGAACGACTAAATGATTTGAAGTCTACTGTCGATTTATTGACGAGCATCA
CATTTTTCAGAATGAAAGTTCAAGAATTGTCCAGTCCACCCAGAGCAGGT
CAAGTAGTTCGAGAATGTGTACAGGCCTGTATGAAAACAACGTATCAATT
TTTGTTTGAACACGTCAATGAATTGTATTCGAGAGATCAAGAACCAGGAG
ACAAAATTCAAAATTCTGATGAAACCGGACCGAAGAATTTAGAATTCTGG
CAGAAACTGATTCCCTTGGTAGTCAGTGTGATAGAGGATGATAAGAAAGT
ATATGCACCTTATCTTAACCAATTTCCTCAAGAAGTAAATTTAGTTCAAA
TAAGTTGCTCTGCAATGTGGCAAAACTTGTCAGAAGGCTTGGAACAAGCA
CTATCAGTAGAGAATATAAGAAGTCAATCGTCAAAAACCTCAGATTATAT
CAATTTGTGTTTTAGAATAAAATGGTTTTATAATTTATATGTCAACGACC
TTCCTGATAGTCAAGACGTTATCCCCAATTATCCAAAATGGTTTGAACCA
TACGTCATTCAATGGCTCGGTGAAAATGATGAGGTCTCGACTAATTATCT
CAAAGCTGCTTACGAAAGAGACAAAAAAGATGGTTTCCAGAAGTCAAGTG
AGCACGCTCTCTACTCCAATTCTGTCGTGGATATCTTTACTCAACTCAAT
CAGTGTTTTGATGTAATTAAGAAACTTGAATGTCCCAATCCTGCTATACA
TTCTCATTTTATGAAACGGTTTTCCATGACTGTCAATAAAGTGCTCCTGA
GTTATGCTTCAATGATAAAAAAAGACTATATGGAATATCTGCAGAAACAA
GAGGTTGCATGCATTCTTATGAATAACATTCAGCAAGTTCGAGTTTTATT
AGAAAAGGTCTTTGAAGCAATGGGTGGAGAAAGTCTTGAAACGGATACTA
AAGATGGGATGAACGATCTGCAGTCAGAACTCAGTGATGTAATTGATAGC
CTTGCTAAATCATTTGCCGACTGTTTTGAGGAAGAAATAGAAAATAATAT
TAAAGAATTACATCAACTTTTACATACACAAATTCAAGAAACTGCTAAAA
AAAATCCAAAGTTAAATCTTGAACAAGAATCATTTATTGTTTTGCGGCCT
TTGATGGATTATTTTGAAGCTAATCTTTCACTTTTAGCCTCTGTTTGTGA
AAGAGCTGTTTTGAAACGACTTTTAAAGGAACTCTGGCGAATTACAATTC
AGTGCTTAGAAAGGCAAATTATTCTACCTCCAAACTCAGGATTTCGGCAG
ATCTTCCTCAATATTTCTATTTCTTCTCAAGCTCAAAACAAAATACTTGG
TATGTCACAGTCTCTTCTCAGTCATGTGAGTAATCAAGTACCGAATAGCA
AAATTCTCAAGGATATTTCAAAAGATACCGATCATAGCCTCAGTCCTTCT
CAATGTCAAGTCATGGATATGTGTTTAGATGCCATTAAGAGCTACTTTCA
TGCGGGTGGAAATGGACTAAAGAATAGTTACTTGGAAAGAAGCAGTGAAT
TACAGTCCCTTCGTCATGCTCTTTATCTTTACTCACAAACAACAGATTTA
CTCATCAAAAATTTTATTTCTTCTCAATGTTCTCAAGATACGCACGCAAT
GGAGGATAATGTTGGAGAAGTGTCGGTGAAAGTCGAGTTATTCCGCCACC
CGAGTACCGGAGAACATAAAATTACGACGACAATTATTGCTCTTCGTAAA
CTCAATTGGCAAACGACATCAGTGTTTCGGCCGTTTGTGGAAATATATCT
GCTGGGTCCCAACATAGTGAATAAAAAACGGAAATACGCAACAAAAAGCA
AATCAAATACCTGGAGTCCTGAATACAATGAATCCTTCTCATTTCTAATA
AGCAGCAGTGAACCTCCAGAAAATTATGAAGTTCAGATTTGTGTGAAAGA
TTATTGTTTTGGACGAGCAGATCAACTAATTGGGCACACTGTTATTCAGT
TGATTCGGTTAATAGAACAGGGTTCGTATCAAGCATGGTTAGGTTTAGGA
CGGAAACTGCATTTTGACAATGGAGGATGGACTATTCTTCGAATTCTCAG
CCAAAGAACGGGAGATGATATTGCTAAAGAGTTTGTTCAATTAAAATCTC
AAATTCGACAAAGTCCAAATTCGCAGGGATAAAGAATTGCACAATCGAGT
TGATCATTGGCTTCCAATTTACACCAAATCAAATGTTCACATTCCGAACC
TTTGCCTATTCTCCCAACCACTCCTAATTTCCTTTACCAATGTCACCTTT
ATGCAATTTTATCAATTTCAATCCCAACCATTATATTTGTTATTATGATT
AATTATTATAATTTTTATTATTATTATTATTATTGATTTTCAATTATTTG
ATTTGATGAGGCCTTGCCCGTTTCCAGTACTTGATGATACTCATGACCAA
TAGAAATGCTGATAATATAATATTATGTTGATTATGATAATTAATTAATT
ATATATAATTATCGATTATATTCATATATTGATTACTACTATGTAAATAT
ATCTGTAAAATTGTGCAGCACACTTATAATTATTTTTTATGAGAACAATC
AATATTATTTCTATTTGGCTTGTGTAAATAATATGGGGACCTGTATATCG
ATTATCTGTTACTACTTCCAATCATTGTGATAACAACATTCTGTCATTTT
CATTCTTTATTTTAAAAAAATTCTTATGTCTATTATTGACTTTTGAG
back to top

protein sequence of SMED30035906-orf-1

>SMED30035906-orf-1 ID=SMED30035906-orf-1|Name=SMED30035906-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=117bp
MVGSLVRLFIFIADVMKSLTIISRWDNIELVESLLLTWTLEQLVNTLHGT
LLLPPMAEGTRTHDVDLAQQWVIQLSIKYFINVKQDNFITIGECFFVTHK
FPSEICICLDREQTAD*
back to top

protein sequence of SMED30035906-orf-2

>SMED30035906-orf-2 ID=SMED30035906-orf-2|Name=SMED30035906-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2083bp
MGGSSSVPCNVLTSCSNVHVNNSDSTSSILSQRDIIVNDFITSAMNMNKR
TNEPTIYASRNVSVSDDFNNNSSFCGIDSYNDSRSVLKSDRLFVGYNDSK
DFCRRRASPMEMHPIRFSPNIIHPVQSVVQATLNSGLTQEVVIGNHLDCS
CPLVSYGHGYLDSRDLKSRWHPLQECSCPHEDVHRVFEEPFMKVARTVAL
LPLRETDILDDLVDSTSESSVESAFYPNNSRSINSLRDEHILFEAQRNSR
KDNPFYTENKSTSHLGLQTSASNTCHSPSYIKNQLLANTSVPTDYYTHSL
DTRKKSAKKNIDPEIVRYCSDDELFSPKASVRVFDHRRDSLMINGNVGFF
NNGDGEDENQPFIHDIDKVFEQAFSQSILPRQTTDSTTPPISTKSYSDSI
KTRNDSFEEISSIDIKIPEEQLLRNNALSPKYNDETKENKVYEAEKDNQI
NYKQLEDNEDERSQSLYEEDEDEYEQENSSYEKNDQISYYSQDKESLVMK
FEASQDIHEYTDEDQESEKYRFQSVAMRDYEDEDQKFLENEDDKREIAIF
EVQIKHKRNPNNEINYESEDEYDSLDLPEKDVEKSFSDYENLDRDSVVDE
TSNPPEYFIDPMYSDSESNPECEIDDLVNEIQNQNSSNIIVTHNDNEDPE
AIYAKIIKKPSLLKDNPHENYEDDNYEEMNESIENVVQKSLGNLSDKTGG
SSGETEGPSDDVSKISDMSNNVDKSTSSKTVLEVEYLDPYSNNQLSRKFD
SDNDDISEKYYRRGRGSIVEFIQERSSITSPVPMDSENMDIIVMSAEEMK
RQEEEEIVNSKDTETPKESNKPENKISNEIRKLPGPKFAKIVQKHFIHID
TDMTDGTRRHEDGLDHDYGGFYKSIDSQPDIKWRKKSISLVSDLVLQTMT
AQKRNLNAANASLVTRQSLNDEELKMHVYKKTLQAMIYPISSNTPHSFQV
LNATKPTFCYECEGLLWGVARQGLRCIECGVKCHEKCKELLNADCLQRAA
EKSSKHGAESKTQAIIKSMNDLMQARVKNNPEIFKIIKDVFSVNEEAHEI
HLKSIRQSILDGTSKWSAKIAITVKCAQGLIGKDKTGTSDPYVTVQVGKG
KKRTKTVLQELNPSWDEKFYFECHNSSERIKVRVWDEDNDLKSKIRQKLT
RESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKG
EEKVAPYHIQYTCLHENIFHFLCEENTSQGKPELIFASNRNLEETWRIYF
DWPSEDIIEEFAMRYGIESIYQAMTHFSCLTTKFMCPGVPAVLSTLLANI
NAYYAHTTSTTNRSASERFAANNFGKEKFIKLLDQLHNSIKINLCVYRNA
FMASQPERLNDLKSTVDLLTSITFFRMKVQELSSPPRAGQVVRECVQACM
KTTYQFLFEHVNELYSRDQEPGDKIQNSDETGPKNLEFWQKLIPLVVSVI
EDDKKVYAPYLNQFPQEVNLVQISCSAMWQNLSEGLEQALSVENIRSQSS
KTSDYINLCFRIKWFYNLYVNDLPDSQDVIPNYPKWFEPYVIQWLGENDE
VSTNYLKAAYERDKKDGFQKSSEHALYSNSVVDIFTQLNQCFDVIKKLEC
PNPAIHSHFMKRFSMTVNKVLLSYASMIKKDYMEYLQKQEVACILMNNIQ
QVRVLLEKVFEAMGGESLETDTKDGMNDLQSELSDVIDSLAKSFADCFEE
EIENNIKELHQLLHTQIQETAKKNPKLNLEQESFIVLRPLMDYFEANLSL
LASVCERAVLKRLLKELWRITIQCLERQIILPPNSGFRQIFLNISISSQA
QNKILGMSQSLLSHVSNQVPNSKILKDISKDTDHSLSPSQCQVMDMCLDA
IKSYFHAGGNGLKNSYLERSSELQSLRHALYLYSQTTDLLIKNFISSQCS
QDTHAMEDNVGEVSVKVELFRHPSTGEHKITTTIIALRKLNWQTTSVFRP
FVEIYLLGPNIVNKKRKYATKSKSNTWSPEYNESFSFLISSSEPPENYEV
QICVKDYCFGRADQLIGHTVIQLIRLIEQGSYQAWLGLGRKLHFDNGGWT
ILRILSQRTGDDIAKEFVQLKSQIRQSPNSQG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0005543phospholipid binding
GO:0046872metal ion binding
GO:0005515protein binding
GO:0019992diacylglycerol binding
Vocabulary: cellular component
TermDefinition
GO:0045202synapse
GO:0005622intracellular
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR035892C2_domain_sf
IPR027080Unc-13
IPR027087Unc13C
IPR037302Unc-13_C2B
IPR000008C2_dom
IPR010439CAPS_dom
IPR002219PE/DAG-bd
IPR019558Munc13_subgr_dom-2
IPR014770Munc13_1
IPR014772Munc13_dom-2
Vocabulary: biological process
TermDefinition
GO:0035556intracellular signal transduction
GO:0007268chemical synaptic transmission
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 464..484
NoneNo IPR availableCOILSCoilCoilcoord: 1699..1719
NoneNo IPR availableCOILSCoilCoilcoord: 793..813
NoneNo IPR availableGENE3DG3DSA:3.30.60.20coord: 937..996
e-value: 1.0E-18
score: 68.9
NoneNo IPR availableGENE3DG3DSA:1.10.357.50coord: 1527..1697
e-value: 2.0E-75
score: 254.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 462..478
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 681..729
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 427..486
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 665..729
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 378..400
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 800..829
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 431..461
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 1070..1209
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 1910..2038
NoneNo IPR availableSUPERFAMILYSSF57889Cysteine-rich domaincoord: 937..995
IPR000008C2 domainPRINTSPR00360C2DOMAINcoord: 1085..1097
score: 51.07
coord: 1130..1138
score: 43.8
coord: 1109..1122
score: 45.51
IPR000008C2 domainSMARTSM00239C2_3ccoord: 1069..1176
e-value: 2.6E-19
score: 80.1
coord: 1929..2035
e-value: 7.9E-12
score: 55.3
IPR000008C2 domainPFAMPF00168C2coord: 1929..2036
e-value: 1.4E-11
score: 44.6
coord: 1069..1177
e-value: 1.6E-24
score: 86.1
IPR000008C2 domainPROSITEPS50004C2coord: 1069..1161
score: 15.607
IPR000008C2 domainPROSITEPS50004C2coord: 1929..2020
score: 13.594
IPR010439Calcium-dependent secretion activator domainSMARTSM01145DUF1041_2acoord: 1389..1493
e-value: 5.6E-28
score: 108.9
IPR010439Calcium-dependent secretion activator domainPFAMPF06292DUF1041coord: 1390..1491
e-value: 3.6E-27
score: 94.8
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainSMARTSM00109c1_12coord: 946..995
e-value: 7.2E-17
score: 72.0
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainPFAMPF00130C1_1coord: 946..995
e-value: 1.0E-10
score: 41.3
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainPROSITEPS00479ZF_DAG_PE_1coord: 946..995
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainPROSITEPS50081ZF_DAG_PE_2coord: 945..995
score: 14.276
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainCDDcd00029C1coord: 946..995
e-value: 7.6398E-19
score: 79.8435
IPR019558Mammalian uncoordinated homology 13, subgroup, domain 2PFAMPF10540Membr_traf_MHDcoord: 1736..1893
e-value: 1.0E-40
score: 139.3
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 1897..2043
e-value: 3.6E-16
score: 61.2
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 1053..1199
e-value: 8.5E-48
score: 163.8
IPR027080Protein Unc-13PANTHERPTHR10480PROTEIN UNC-13 HOMOLOGcoord: 874..2077
IPR027087Protein Unc-13 homologue CPANTHERPTHR10480:SF2PROTEIN UNC-13 HOMOLOG Ccoord: 874..2077
IPR014770Munc13 homology 1PROSITEPS51258MHD1coord: 1483..1628
score: 24.23
IPR014772Mammalian uncoordinated homology 13, domain 2PROSITEPS51259MHD2coord: 1734..1894
score: 23.322
IPR037302Protein Unc-13, C2B domainCDDcd04027C2B_Munc13coord: 1068..1194
e-value: 6.09345E-82
score: 262.89