Cerebellar degeneration related protein 2

Overview
NameCerebellar degeneration related protein 2
Smed IDSMED30035905
Length (bp)1780
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cerebellar degeneration related protein 2 (SMED30035905) t-SNE clustered cells

Violin plots show distribution of expression levels for Cerebellar degeneration related protein 2 (SMED30035905) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cerebellar degeneration related protein 2 (SMED30035905) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cerebellar degeneration related protein 2 (SMED30035905) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035905

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30035905h1SMcG0022464 SmedASXL_008192SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30035905h1SMcG0022464 dd_Smed_v4_3478_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035905h1SMcG0022464 dd_Smed_v4_3478_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30035905h1SMcG0022464 dd_Smed_v4_3478_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cerebellar degeneration related protein 2 vs. Ensembl Human
Match: CDR2L (cerebellar degeneration related protein 2 like [Source:HGNC Symbol;Acc:HGNC:29999])

HSP 1 Score: 53.1434 bits (126), Expect = 9.483e-7
Identity = 47/106 (44.34%), Postives = 63/106 (59.43%), Query Frame = 2
Query:  293 SLVDEGYWY-----ENDXXXXXXXXXXXXXRNRDLETQLNVQAKNSHNLRLEIDLLKKQLETLRELNRNKMILYEDVDKNSHDLEITNRNLLCDSKKQKEKIFNIT 595
            S  +E  WY     E DL LAAELGKTLLERN++LE  L      +     EI+ L KQL+TLR +N     +YE +D  + DLE+TN  L+ +SK  ++KI  +T
Sbjct:   11 SAEEEESWYDQQDLEQDLHLAAELGKTLLERNKELEGSLQQMYSTNEEQVQEIEYLTKQLDTLRHVNEQHAKVYEQLDLTARDLELTNHRLVLESKAAQQKIHGLT 116          
BLAST of Cerebellar degeneration related protein 2 vs. Ensembl Human
Match: CDR2 (cerebellar degeneration related protein 2 [Source:HGNC Symbol;Acc:HGNC:1799])

HSP 1 Score: 49.2914 bits (116), Expect = 6.540e-6
Identity = 25/66 (37.88%), Postives = 43/66 (65.15%), Query Frame = 2
Query:  431 EIDLLKKQLETLRELNRNKMILYEDVDKNSHDLEITNRNLLCDSKKQKEKIFNITKKNSYLEQSLD 628
            EI+ L KQ+E LR++N     +YE +D  + +LE TN+ L+ DSK  ++KI ++T+    L+ ++D
Sbjct:   11 EIEYLTKQVELLRQMNEQHAKVYEQLDVTARELEETNQKLVADSKASQQKILSLTETIECLQTNID 76          
BLAST of Cerebellar degeneration related protein 2 vs. Ensembl Human
Match: CDR2 (cerebellar degeneration related protein 2 [Source:HGNC Symbol;Acc:HGNC:1799])

HSP 1 Score: 50.447 bits (119), Expect = 7.015e-6
Identity = 29/87 (33.33%), Postives = 50/87 (57.47%), Query Frame = 2
Query:  368 RNRDLETQLNVQAKNSHNLRLEIDLLKKQLETLRELNRNKMILYEDVDKNSHDLEITNRNLLCDSKKQKEKIFNITKKNSYLEQSLD 628
            RN +LE  +      +     EI+ L KQ+E LR++N     +YE +D  + +LE TN+ L+ DSK  ++KI ++T+    L+ ++D
Sbjct:   41 RNTELEDSVQQMYTTNQEQLQEIEYLTKQVELLRQMNEQHAKVYEQLDVTARELEETNQKLVADSKASQQKILSLTETIECLQTNID 127          
BLAST of Cerebellar degeneration related protein 2 vs. Ensembl Zebrafish
Match: cdr2l (cerebellar degeneration-related protein 2-like [Source:NCBI gene;Acc:336227])

HSP 1 Score: 59.3066 bits (142), Expect = 7.626e-9
Identity = 100/356 (28.09%), Postives = 157/356 (44.10%), Query Frame = 2
Query:  314 WY-----ENDXXXXXXXXXXXXXRNRDLETQLNVQAKNSHNLRLEIDLLKKQLETLRELNRNKMILYEDVDKNSHDLEITNRNLLCDSKKQKEKIFNITKKNSYLEQSLDXXXXXXXXXXX------------XXXXXXXFHC------------SHVLSDESN----HLAPIVSDEDHIDIRKTCPPICRKCKAKEERITVLEIEMDFKNQENEELRLQIF---ELQKKLRHIEVELEDLKCFPKQNIKVESQTNTLVEDLY-----------SVMEYDIDRVD-EKPVEVG----SLNTGGQVFTSSNSLKSIGAEATKRTEKPSSLLNELDEKYNHLVKQYETLLQSSRNREE 1225
            WY     E DL LAAELGKTLLERN++LE  L     N+     EI+ L KQ+E LRE+N     +YE +D  + +LEITN  L+ +SK  ++KI  +T     L+  +D LT +++                  + +  F C            S ++SD  +       P  +DE++  +R     +     A+  R    E E     QE E L  ++      Q+++  +E EL++++   K  + + S    L + L            +VM  + D  D   PV       +L+    V  S     S    A    ++  S+L E+DE+Y+ L+++YE LL   R  EE
Sbjct:   18 WYDQRDLEQDLHLAAELGKTLLERNKELEDSLQQMYINNEEQVQEIEYLTKQMEMLREMNEQHAKVYEQLDVTARELEITNEKLVLESKGSQQKIDRLTGTMEMLQGQVDTLTARVEELRTLEELRVRREKKERRKTVHSFPCLKELCTAPRYEDSFMVSDPGSGDLEECQP--ADEENEHLRVMVSSLRAAVAAERGRREAAERECAAVLQEFERLEQRLLGAESCQRRVHELEAELQEMQQLRKSRVCLLSGEEGLEQTLLNCAPETDTPDEAVMAQNGDANDGAAPVRKSCSDTALDAISAVDASGRRKGSYALHANGVRKRGMSILREVDEQYHALLEKYEELLGKCRRHEE 371          
BLAST of Cerebellar degeneration related protein 2 vs. Ensembl Zebrafish
Match: cdr2l (cerebellar degeneration-related protein 2-like [Source:NCBI gene;Acc:336227])

HSP 1 Score: 59.3066 bits (142), Expect = 7.626e-9
Identity = 100/356 (28.09%), Postives = 157/356 (44.10%), Query Frame = 2
Query:  314 WY-----ENDXXXXXXXXXXXXXRNRDLETQLNVQAKNSHNLRLEIDLLKKQLETLRELNRNKMILYEDVDKNSHDLEITNRNLLCDSKKQKEKIFNITKKNSYLEQSLDXXXXXXXXXXX------------XXXXXXXFHC------------SHVLSDESN----HLAPIVSDEDHIDIRKTCPPICRKCKAKEERITVLEIEMDFKNQENEELRLQIF---ELQKKLRHIEVELEDLKCFPKQNIKVESQTNTLVEDLY-----------SVMEYDIDRVD-EKPVEVG----SLNTGGQVFTSSNSLKSIGAEATKRTEKPSSLLNELDEKYNHLVKQYETLLQSSRNREE 1225
            WY     E DL LAAELGKTLLERN++LE  L     N+     EI+ L KQ+E LRE+N     +YE +D  + +LEITN  L+ +SK  ++KI  +T     L+  +D LT +++                  + +  F C            S ++SD  +       P  +DE++  +R     +     A+  R    E E     QE E L  ++      Q+++  +E EL++++   K  + + S    L + L            +VM  + D  D   PV       +L+    V  S     S    A    ++  S+L E+DE+Y+ L+++YE LL   R  EE
Sbjct:   18 WYDQRDLEQDLHLAAELGKTLLERNKELEDSLQQMYINNEEQVQEIEYLTKQMEMLREMNEQHAKVYEQLDVTARELEITNEKLVLESKGSQQKIDRLTGTMEMLQGQVDTLTARVEELRTLEELRVRREKKERRKTVHSFPCLKELCTAPRYEDSFMVSDPGSGDLEECQP--ADEENEHLRVMVSSLRAAVAAERGRREAAERECAAVLQEFERLEQRLLGAESCQRRVHELEAELQEMQQLRKSRVCLLSGEEGLEQTLLNCAPETDTPDEAVMAQNGDANDGAAPVRKSCSDTALDAISAVDASGRRKGSYALHANGVRKRGMSILREVDEQYHALLEKYEELLGKCRRHEE 371          
BLAST of Cerebellar degeneration related protein 2 vs. Ensembl Zebrafish
Match: cdr2l (cerebellar degeneration-related protein 2-like [Source:NCBI gene;Acc:336227])

HSP 1 Score: 59.3066 bits (142), Expect = 7.626e-9
Identity = 100/356 (28.09%), Postives = 157/356 (44.10%), Query Frame = 2
Query:  314 WY-----ENDXXXXXXXXXXXXXRNRDLETQLNVQAKNSHNLRLEIDLLKKQLETLRELNRNKMILYEDVDKNSHDLEITNRNLLCDSKKQKEKIFNITKKNSYLEQSLDXXXXXXXXXXX------------XXXXXXXFHC------------SHVLSDESN----HLAPIVSDEDHIDIRKTCPPICRKCKAKEERITVLEIEMDFKNQENEELRLQIF---ELQKKLRHIEVELEDLKCFPKQNIKVESQTNTLVEDLY-----------SVMEYDIDRVD-EKPVEVG----SLNTGGQVFTSSNSLKSIGAEATKRTEKPSSLLNELDEKYNHLVKQYETLLQSSRNREE 1225
            WY     E DL LAAELGKTLLERN++LE  L     N+     EI+ L KQ+E LRE+N     +YE +D  + +LEITN  L+ +SK  ++KI  +T     L+  +D LT +++                  + +  F C            S ++SD  +       P  +DE++  +R     +     A+  R    E E     QE E L  ++      Q+++  +E EL++++   K  + + S    L + L            +VM  + D  D   PV       +L+    V  S     S    A    ++  S+L E+DE+Y+ L+++YE LL   R  EE
Sbjct:   18 WYDQRDLEQDLHLAAELGKTLLERNKELEDSLQQMYINNEEQVQEIEYLTKQMEMLREMNEQHAKVYEQLDVTARELEITNEKLVLESKGSQQKIDRLTGTMEMLQGQVDTLTARVEELRTLEELRVRREKKERRKTVHSFPCLKELCTAPRYEDSFMVSDPGSGDLEECQP--ADEENEHLRVMVSSLRAAVAAERGRREAAERECAAVLQEFERLEQRLLGAESCQRRVHELEAELQEMQQLRKSRVCLLSGEEGLEQTLLNCAPETDTPDEAVMAQNGDANDGAAPVRKSCSDTALDAISAVDASGRRKGSYALHANGVRKRGMSILREVDEQYHALLEKYEELLGKCRRHEE 371          
BLAST of Cerebellar degeneration related protein 2 vs. Ensembl Xenopus
Match: tuba4b (tubulin alpha 4b [Source:Xenbase;Acc:XB-GENE-489927])

HSP 1 Score: 66.6254 bits (161), Expect = 4.489e-11
Identity = 113/432 (26.16%), Postives = 197/432 (45.60%), Query Frame = 2
Query:  314 WY-----ENDXXXXXXXXXXXXXRNRDLETQLNVQAKNSHNLRLEIDLLKKQLETLRELNRNKMILYEDVDKNSHDLEITNRNLLCDSKKQKEKIFNITKKNSYLEQSLDXXXXXXXXXXXXXXXXX------------XFHCSHVLSDESNHLAPIVSDEDHIDIRKTCPPICR------------KCKAKEERITVLEIEMDFKN--QENEELRLQIFELQK---KLRHIEVELEDLKCFPKQNIKVESQTNTLVEDLYSVMEYDIDRVDEKPVEVGSLNTG-GQVFTSSNSLKS---------IGAEATKRTE------------KPSSLLNELDEKYNHLVKQYETLLQSSRNREEMACD---KCSSIAYNDEDFRRKLDNIFSEETRRQRKLLTTQ---------NYRPKYKELFRDAFDILKDMKQ 1405
            WY     E DL LAAELGKTLLERN++LE  L     ++     EI+ L KQL+ LR++N     +YE +D  + DLE+TN+ L+ ++K  + KI ++T     L++ ++ L ++++      +                F C   L   S H   +      +D+ +   P+ R            + +  EER      E +++   QE  +L  ++ E++    ++R +E EL +L+   +    +  + ++L + L   +    +  D +P E G ++   GQV  +S   KS         +G +A  R E            +  S+L E+DE+Y+ L+++YE LL   R  E+  C    + S     D   R    ++ +EE   +R +LT Q           +P+YK LF++ F+ ++  KQ
Sbjct:   18 WYDQHDLEQDLHLAAELGKTLLERNKELEVSLQQMYLSNEEQVQEIEYLSKQLDMLRQVNEQHAKVYEQLDTMARDLEMTNQRLVQENKAAQHKITSLTDTIDGLQRQVESLQKQVEDLRSVEQVRIRREKRERRRTIHTFPCIRELCANSRHEETLYMHASCLDLSQK--PLQRENERLQSAVNSLRAQVAEERQRKERAEREYQAVVQEYSDLEQRVCEMENCKLRVRELEAELVELQQMKQVKRYLLGRGDSLSQALLEPLNKTPETDDPEPPEEGQVDVSRGQVTPNSVVRKSCSDTALSDIVGRDAVSRHEGNYTLHANNTRRRGMSILREVDEQYHALLERYEELLAKCRRHEDNLCHAGVQTSRPVSRDSSSR----DLPAEEVEPER-VLTLQLEAADRRLEQSQPEYKALFKEIFNRIQRTKQ 442          
BLAST of Cerebellar degeneration related protein 2 vs. Ensembl Xenopus
Match: tuba4b (tubulin alpha 4b [Source:Xenbase;Acc:XB-GENE-489927])

HSP 1 Score: 65.855 bits (159), Expect = 8.451e-11
Identity = 97/409 (23.72%), Postives = 182/409 (44.50%), Query Frame = 2
Query:  368 RNRDLETQLNVQAKNSHNLRLEIDLLKKQLETLRELNRNKMILYEDVDKNSHDLEITNRNLLCDSKKQKEKIFNITKKNSYLEQSLDXXXXXXX------------XXXXXXXXXXXFHCSHVLSDESNHLAPIVSDEDHIDIRKTCPPICR------------KCKAKEERITVLEIEMDFKN--QENEELRLQIFELQK---KLRHIEVELEDLKCFPKQNIKVESQTNTLVEDLYSVMEYDIDRVDEKPVEVGSLNTG-GQVFTSSNSLKS---------IGAEATKRTE------------KPSSLLNELDEKYNHLVKQYETLLQSSRNREEMACD---KCSSIAYNDEDFRRKLDNIFSEETRRQRKLLTTQ---------NYRPKYKELFRDAFDILKDMKQ 1405
            RN++LE  L     ++     EI+ L KQL+ LR++N     +YE +D  + DLE+TN+ L+ ++K  + KI ++T     L++ ++ L ++++               +    +  F C   L   S H   +      +D+ +   P+ R            + +  EER      E +++   QE  +L  ++ E++    ++R +E EL +L+   +    +  + ++L + L   +    +  D +P E G ++   GQV  +S   KS         +G +A  R E            +  S+L E+DE+Y+ L+++YE LL   R  E+  C    + S     D   R    ++ +EE   +R +LT Q           +P+YK LF++ F+ ++  KQ
Sbjct:   47 RNKELEVSLQQMYLSNEEQVQEIEYLSKQLDMLRQVNEQHAKVYEQLDTMARDLEMTNQRLVQENKAAQHKITSLTDTIDGLQRQVESLQKQVEDLRSVEQVRIRREKRERRRTIHTFPCIRELCANSRHEETLYMHASCLDLSQK--PLQRENERLQSAVNSLRAQVAEERQRKERAEREYQAVVQEYSDLEQRVCEMENCKLRVRELEAELVELQQMKQVKRYLLGRGDSLSQALLEPLNKTPETDDPEPPEEGQVDVSRGQVTPNSVVRKSCSDTALSDIVGRDAVSRHEGNYTLHANNTRRRGMSILREVDEQYHALLERYEELLAKCRRHEDNLCHAGVQTSRPVSRDSSSR----DLPAEEVEPER-VLTLQLEAADRRLEQSQPEYKALFKEIFNRIQRTKQ 448          
BLAST of Cerebellar degeneration related protein 2 vs. Ensembl Mouse
Match: Cdr2l (cerebellar degeneration-related protein 2-like [Source:MGI Symbol;Acc:MGI:2684867])

HSP 1 Score: 51.9878 bits (123), Expect = 1.437e-6
Identity = 47/106 (44.34%), Postives = 64/106 (60.38%), Query Frame = 2
Query:  293 SLVDEGYWY-----ENDXXXXXXXXXXXXXRNRDLETQLNVQAKNSHNLRLEIDLLKKQLETLRELNRNKMILYEDVDKNSHDLEITNRNLLCDSKKQKEKIFNIT 595
            S  +E  WY     E DL LAAELGKTLLERN++LE  L      +     EI+ L KQL+TLR +N     +YE +D  + DLE+TN+ L+ +SK  ++KI  +T
Sbjct:   11 SAEEEESWYDHQDLEQDLHLAAELGKTLLERNKELEESLQQMYSTNEEQVHEIEYLTKQLDTLRLVNEQHAKVYEQLDLTARDLELTNQRLVMESKAAQQKIHGLT 116          
BLAST of Cerebellar degeneration related protein 2 vs. Ensembl Mouse
Match: Cdr2 (cerebellar degeneration-related 2 [Source:MGI Symbol;Acc:MGI:1100885])

HSP 1 Score: 49.6766 bits (117), Expect = 9.101e-6
Identity = 29/87 (33.33%), Postives = 50/87 (57.47%), Query Frame = 2
Query:  368 RNRDLETQLNVQAKNSHNLRLEIDLLKKQLETLRELNRNKMILYEDVDKNSHDLEITNRNLLCDSKKQKEKIFNITKKNSYLEQSLD 628
            RN +LE  L      +     EI+ L KQ+E LR++N     +YE +D  + +LE TN+ L+ +SK  ++KI ++T+    L+ ++D
Sbjct:   40 RNTELEDSLQQMYTTNQEQLQEIEYLTKQVELLRQMNEQHAKVYEQLDVTARELEETNQKLVAESKASQQKILSLTETIECLQTNID 126          
BLAST of Cerebellar degeneration related protein 2 vs. UniProt/SwissProt
Match: sp|Q6NZT2|CDR2L_DANRE (Cerebellar degeneration-related protein 2-like OS=Danio rerio OX=7955 GN=cdr2l PE=2 SV=2)

HSP 1 Score: 59.3066 bits (142), Expect = 5.756e-8
Identity = 100/356 (28.09%), Postives = 157/356 (44.10%), Query Frame = 2
Query:  314 WY-----ENDXXXXXXXXXXXXXRNRDLETQLNVQAKNSHNLRLEIDLLKKQLETLRELNRNKMILYEDVDKNSHDLEITNRNLLCDSKKQKEKIFNITKKNSYLEQSLDXXXXXXXXXXX------------XXXXXXXFHC------------SHVLSDESN----HLAPIVSDEDHIDIRKTCPPICRKCKAKEERITVLEIEMDFKNQENEELRLQIF---ELQKKLRHIEVELEDLKCFPKQNIKVESQTNTLVEDLY-----------SVMEYDIDRVD-EKPVEVG----SLNTGGQVFTSSNSLKSIGAEATKRTEKPSSLLNELDEKYNHLVKQYETLLQSSRNREE 1225
            WY     E DL LAAELGKTLLERN++LE  L     N+     EI+ L KQ+E LRE+N     +YE +D  + +LEITN  L+ +SK  ++KI  +T     L+  +D LT +++                  + +  F C            S ++SD  +       P  +DE++  +R     +     A+  R    E E     QE E L  ++      Q+++  +E EL++++   K  + + S    L + L            +VM  + D  D   PV       +L+    V  S     S    A    ++  S+L E+DE+Y+ L+++YE LL   R  EE
Sbjct:   18 WYDQRDLEQDLHLAAELGKTLLERNKELEDSLQQMYINNEEQVQEIEYLTKQMEMLREMNEQHAKVYEQLDVTARELEITNEKLVLESKGSQQKIDRLTGTMEMLQGQVDTLTARVEELRTLEELRVRREKKERRKTVHSFPCLKELCTAPRYEDSFMVSDPGSGDLEECQP--ADEENEHLRVMVSSLRAAVAAERGRREAAERECAAVLQEFERLEQRLLGAESCQRRVHELEAELQEMQQLRKSRVCLLSGEEGLEQTLLNCAPETDTPDEAVMAQNGDANDGAAPVRKSCSDTALDAISAVDASGRRKGSYALHANGVRKRGMSILREVDEQYHALLEKYEELLGKCRRHEE 371          
BLAST of Cerebellar degeneration related protein 2 vs. UniProt/SwissProt
Match: sp|Q86X02|CDR2L_HUMAN (Cerebellar degeneration-related protein 2-like OS=Homo sapiens OX=9606 GN=CDR2L PE=1 SV=2)

HSP 1 Score: 53.1434 bits (126), Expect = 4.554e-6
Identity = 47/106 (44.34%), Postives = 63/106 (59.43%), Query Frame = 2
Query:  293 SLVDEGYWY-----ENDXXXXXXXXXXXXXRNRDLETQLNVQAKNSHNLRLEIDLLKKQLETLRELNRNKMILYEDVDKNSHDLEITNRNLLCDSKKQKEKIFNIT 595
            S  +E  WY     E DL LAAELGKTLLERN++LE  L      +     EI+ L KQL+TLR +N     +YE +D  + DLE+TN  L+ +SK  ++KI  +T
Sbjct:   11 SAEEEESWYDQQDLEQDLHLAAELGKTLLERNKELEGSLQQMYSTNEEQVQEIEYLTKQLDTLRHVNEQHAKVYEQLDLTARDLELTNHRLVLESKAAQQKIHGLT 116          
BLAST of Cerebellar degeneration related protein 2 vs. TrEMBL
Match: A0A267F9F2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009449g1 PE=4 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 4.182e-19
Identity = 63/157 (40.13%), Postives = 91/157 (57.96%), Query Frame = 2
Query:  983 EDLYSVMEYDIDRVDEKPVEVGSLNTGGQVFTSSNSLKSIGAEATKRTEKPS----SLLNELDEKYNHLVKQYETLLQSSRNREEMACDKCSSIA-------YNDED------FRRKLDNIFSEETRRQRKLLTTQNYRPKYKELFRDAFDILKDMK 1402
            +DL S +E D+ ++     + G L +GG VF+S  +L  +GA  TK+    +    SLL EL+++YN LV +YE LL   + R  MA  +  +++        NDE       F ++L  IF+EETR +RK L  Q+YRPKYK+LFRDA   L+DMK
Sbjct:  367 DDLASPIESDVQQI-RGDADCGQLQSGGTVFSSRENLSRLGA--TKKLAGTALAEISLLTELNDQYNRLVVEYEQLLAGKQARVSMAQAQSQTLSDDALLAMGNDEGELSRATFEQRLSGIFAEETRSERKRLVNQDYRPKYKDLFRDAMSKLRDMK 520          

HSP 2 Score: 65.0846 bits (157), Expect = 2.716e-7
Identity = 53/111 (47.75%), Postives = 71/111 (63.96%), Query Frame = 2
Query:  284 DKCSLVDEGYWYENDXXXXXXXXXXXXXRNRDLETQLNVQAKNSHNLRLEIDLLKKQLETLRELNRNKMILYEDVDKNSHDLEITNRNLLCDSKKQKEKIFNITKKNSYLE 616
            + CSLVD   W+ENDL+LAAELGK LLERNRDLE QL+       +   EI+LL +Q++TLR LN  K  + E+VD+   +LE  NR LL +    +E+   + K+ S LE
Sbjct:   87 EACSLVDSTAWHENDLILAAELGKALLERNRDLELQLSGLKGLCEHQTQEIELLTRQVQTLRGLNDGKARMVEEVDRQYAELEARNRELLAERATARERAAALGKQCSNLE 197          
BLAST of Cerebellar degeneration related protein 2 vs. TrEMBL
Match: A0A267FMI1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig024030g2 PE=4 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 1.304e-18
Identity = 63/157 (40.13%), Postives = 91/157 (57.96%), Query Frame = 2
Query:  983 EDLYSVMEYDIDRVDEKPVEVGSLNTGGQVFTSSNSLKSIGAEATKRTEKPS----SLLNELDEKYNHLVKQYETLLQSSRNREEMACDKCSSIA-------YNDED------FRRKLDNIFSEETRRQRKLLTTQNYRPKYKELFRDAFDILKDMK 1402
            +DL S +E D+ ++     + G L +GG VF+S  +L  +GA  TK+    +    SLL EL+++YN LV +YE LL   + R  MA  +  +++        NDE       F ++L  IF+EETR +RK L  Q+YRPKYK+LFRDA   L+DMK
Sbjct:  375 DDLASPIESDVQQI-RGDADCGQLLSGGTVFSSRENLSRLGA--TKKLAGTALAEISLLTELNDQYNRLVVEYEQLLAGKQARVSMAQAQSQTLSDDALLAMGNDEGELSRATFEQRLSGIFAEETRSERKRLVNQDYRPKYKDLFRDAMSKLRDMK 528          

HSP 2 Score: 71.2478 bits (173), Expect = 3.263e-9
Identity = 53/111 (47.75%), Postives = 71/111 (63.96%), Query Frame = 2
Query:  284 DKCSLVDEGYWYENDXXXXXXXXXXXXXRNRDLETQLNVQAKNSHNLRLEIDLLKKQLETLRELNRNKMILYEDVDKNSHDLEITNRNLLCDSKKQKEKIFNITKKNSYLE 616
            + CSLVD   W+ENDL+LAAELGK LLERNRDLE QL+       +   EI+LL +Q++TLR LN  K  + E+VD+   +LE  NR LL +    +E+   + K+ S LE
Sbjct:   95 EACSLVDSTAWHENDLILAAELGKALLERNRDLELQLSGLKGLCEHQTQEIELLTRQVQTLRGLNDGKARMVEEVDRQYAELEARNRELLAEQATARERAAALGKQCSNLE 205          
BLAST of Cerebellar degeneration related protein 2 vs. TrEMBL
Match: A0A267GP36 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig024030g1 PE=4 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 1.327e-18
Identity = 63/157 (40.13%), Postives = 91/157 (57.96%), Query Frame = 2
Query:  983 EDLYSVMEYDIDRVDEKPVEVGSLNTGGQVFTSSNSLKSIGAEATKRTEKPS----SLLNELDEKYNHLVKQYETLLQSSRNREEMACDKCSSIA-------YNDED------FRRKLDNIFSEETRRQRKLLTTQNYRPKYKELFRDAFDILKDMK 1402
            +DL S +E D+ ++     + G L +GG VF+S  +L  +GA  TK+    +    SLL EL+++YN LV +YE LL   + R  MA  +  +++        NDE       F ++L  IF+EETR +RK L  Q+YRPKYK+LFRDA   L+DMK
Sbjct:  373 DDLASPIESDVQQI-RGDADCGQLLSGGTVFSSRENLSRLGA--TKKLAGTALAEISLLTELNDQYNRLVVEYEQLLAGKQARVSMAQAQSQTLSDDALLAMGNDEGELSRATFEQRLSGIFAEETRSERKRLVNQDYRPKYKDLFRDAMSKLRDMK 526          

HSP 2 Score: 65.4698 bits (158), Expect = 2.409e-7
Identity = 53/111 (47.75%), Postives = 72/111 (64.86%), Query Frame = 2
Query:  284 DKCSLVDEGYWYENDXXXXXXXXXXXXXRNRDLETQLNVQAKNSHNLRLEIDLLKKQLETLRELNRNKMILYEDVDKNSHDLEITNRNLLCDSKKQKEKIFNITKKNSYLE 616
            + CSLVD   W+ENDL+LAAELGK LLERNRDLE QL+       +   EI+LL +Q++TLR LN  K+ + E+VD+   +LE  NR LL +    +E+   + K+ S LE
Sbjct:   93 EACSLVDSTAWHENDLILAAELGKALLERNRDLELQLSGLKGLCEHQTQEIELLTRQVQTLRGLNDGKVRMVEEVDRQYAELEARNRELLAERATARERAAALGKQCSNLE 203          
BLAST of Cerebellar degeneration related protein 2 vs. TrEMBL
Match: A0A2T7PZL5 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_01483 PE=4 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 1.412e-10
Identity = 106/393 (26.97%), Postives = 182/393 (46.31%), Query Frame = 2
Query:  368 RNRDLETQLNVQAKNSHNLRLEIDLLKKQLETLRELNRNKMILYEDVDKNSHDLEITNRNLLCDSKKQKEKIFNITKKNSYLEQSLDXXXXXXXXXXXXXXXXXXFHCSHVLSDESNHLAPIVS-DEDHIDIR----------------KTCP--P----------ICRKCKAK----EERITVLEIEMDFKNQENEELRLQIFELQKKLRH---IEVELEDLKCFP-------KQNIKVESQTNTLVEDLYSVMEYDIDRVDEKPVEVGSLNTGGQVFTSSNSLKSIGAEATK--RTEKPSSLLNELDEKYNHLVKQYETLLQSSRNREEMACDKCSSIAYNDEDFRRKLDNIFSEETRRQRKLLTTQNY------RPKYKELFRDAFDILK 1393
            RNRDLE QL    +      +E+  + KQLETLR +  ++  +YE+VD+ S DLE  N+ L  D++  K+KI  +T     LEQ +++L +KL+ + K  +     + S  +  E    A + S +E H D R                K  P  P            + CK +      R   LE+E+D   QEN+ L+ ++  L+ +L     +E ELE  +  P       ++ + +  + +   ++L S +E+D   +  K   V  L  GG ++ SS S+  + A+A +    +   S+L+EL+ +Y  L ++YE L+Q+   R  ++  +       D   RR+L +   +E +    +   ++Y       P YK LF+D F  L+
Sbjct:   22 RNRDLELQLQQLQQLHQEQNMELQHVTKQLETLRTMTESRNRVYEEVDRISQDLERQNQKLTMDARADKQKIERLTASVEQLEQKVEDLYKKLEESNKSKDN----NASIKIQQEKRRTASLASLNESHCDNRSSFYIGNLAWTQSSTFKNLPLNPWEAELLKLQEAVQHCKTQLTIERRRREDLEVELDITEQENKSLQTKVTILEDRLSEAMMLEFELEQARQSPEGICRKCRKVLDIHEELHAQEKELLSEVEHDSPELLSKAKAV-KLEGGGSLYGSSESINKVTADAKEIDDNDAGKSILDELETQYKSLFQKYEALIQNKSKR--LSMTQTDDENPEDRAMRRRLAH---KEVQTLLHMTLNRDYFQESCQPPPYKALFKDLFATLR 404          
BLAST of Cerebellar degeneration related protein 2 vs. TrEMBL
Match: A0A210R4N5 (Cerebellar degeneration-related protein 2 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT06555 PE=4 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 3.070e-8
Identity = 48/97 (49.48%), Postives = 70/97 (72.16%), Query Frame = 2
Query:  305 EGYWYENDXXXXXXXXXXXXXRNRDLETQLNVQAKNSHNLRLEIDLLKKQLETLRELNRNKMILYEDVDKNSHDLEITNRNLLCDSKKQKEKIFNIT 595
            +G WY++DL LAAELGK LLERNR+LET +    + S +  LE + L KQLETLRE +  +M +YE++DKN+ +LE  N+ L+ DS+ +K++I  +T
Sbjct:   15 DGEWYQSDLQLAAELGKALLERNRELETHILQIQQASQDQHLENEYLNKQLETLRETSDARMRVYEELDKNAQELEKQNQRLIIDSRGEKQRIEKLT 111          
BLAST of Cerebellar degeneration related protein 2 vs. Ensembl Cavefish
Match: cdr2l (cerebellar degeneration related protein 2 like [Source:NCBI gene;Acc:103045216])

HSP 1 Score: 58.5362 bits (140), Expect = 1.248e-8
Identity = 100/354 (28.25%), Postives = 161/354 (45.48%), Query Frame = 2
Query:  314 WY-----ENDXXXXXXXXXXXXXRNRDLETQLNVQAKNSHNLRLEIDLLKKQLETLRELNRNKMILYEDVDKNSHDLEITNRNLLCDSKKQKEKIFNITKKNSYLEQSLDXXXXX------------XXXXXXXXXXXXXFHC------------SHVLSDESNHLAPI--VSDEDHIDIRKTCPPICRKCKAKEERITVLEIEMDFKNQENEELRLQIFEL---QKKLRHIEVELEDLKCFPKQNIKVESQTNTLVEDLY-SVMEYDI--DRVDEKPVEVGSLNTGGQVFTSSNSLKSIGA-EATKR------------TEKPSSLLNELDEKYNHLVKQYETLLQSSRNREE 1225
            WY     E DL LAAELGKTLLERN++LE  L     N+     EI+ L KQLE LRE+N     +YE +D  + +LEITN  L+ +SK  ++KI  +T     L+  +D LT +             +  ++  + +  F C              V+SD  +    +   +DE++  +R     +     A+  R    E E     QE E L  ++      Q+++  +E EL++++   +   ++ +  + L + L  S  E D   D       + GS  T  +   S  +L  I A +A+ R             ++  S+L E+DE+Y+ L+++YE LL   R  EE
Sbjct:   18 WYDQRDLEQDLHLAAELGKTLLERNKELEDSLQQMYINNEEQVQEIEYLSKQLEMLREMNEQHAKVYEQLDVTARELEITNEKLVLESKTSQQKIDRLTGTMEMLQGQVDMLTARVEELRTLEELRVRREKKERRKTVHSFPCLKELCTAPRYEDGFVVSDPGSDDLQVQNSADEENERLRGAVASLRATVAAERSRRENAERECAAVLQEFERLEQRLLGAEGCQRRVHELEAELQEMQQLRRSRARLLTGEDGLEQTLLSSAPETDTPEDATAAAQEDGGSGETPVRKSCSDTALDVISAVDASGRRKGSYALHANGVRKRGMSILREVDEQYHALLEKYEELLGKCRRHEE 371          
BLAST of Cerebellar degeneration related protein 2 vs. Ensembl Cavefish
Match: cdr2l (cerebellar degeneration related protein 2 like [Source:NCBI gene;Acc:103045216])

HSP 1 Score: 57.3806 bits (137), Expect = 2.221e-8
Identity = 82/322 (25.47%), Postives = 140/322 (43.48%), Query Frame = 2
Query:  368 RNRDLETQLNVQAKNSHNLRLEIDLLKKQLETLRELNRNKMILYEDVDKNSHDLEITNRNLLCDSKKQKEKIFNITKKNSYLEQSLDXXXXX------------XXXXXXXXXXXXXFHCSHVLSDESNHLAPIVSDEDHI-----DIRKTCPPICRKCKAKEERITVLEIEMDFKNQENEELRLQIFEL---QKKLRHIEVELEDLKCFPKQNIKVESQTNTLVEDLY-SVMEYDI--DRVDEKPVEVGSLNTGGQVFTSSNSLKSIGA-EATKR------------TEKPSSLLNELDEKYNHLVKQYETLLQSSRNREE 1225
            RN++LE  L     N+     EI+ L KQLE LRE+N     +YE +D  + +LEITN  L+ +SK  ++KI  +T     L+  +D LT +             +  ++  + +  F C   L     +  P+  +  H       +R     +     A+  R    E E     QE E L  ++      Q+++  +E EL++++   +   ++ +  + L + L  S  E D   D       + GS  T  +   S  +L  I A +A+ R             ++  S+L E+DE+Y+ L+++YE LL   R  EE
Sbjct:   23 RNKELEDSLQQMYINNEEQVQEIEYLSKQLEMLREMNEQHAKVYEQLDVTARELEITNEKLVLESKTSQQKIDRLTGTMEMLQGQVDMLTARVEELRTLEELRVRREKKERRKTVHSFPCLKELCTAPRY-RPLTGNLPHFYEENERLRGAVASLRATVAAERSRRENAERECAAVLQEFERLEQRLLGAEGCQRRVHELEAELQEMQQLRRSRARLLTGEDGLEQTLLSSAPETDTPEDATAAAQEDGGSGETPVRKSCSDTALDVISAVDASGRRKGSYALHANGVRKRGMSILREVDEQYHALLEKYEELLGKCRRHEE 343          
BLAST of Cerebellar degeneration related protein 2 vs. Ensembl Medaka
Match: cdr2l (cerebellar degeneration-related protein 2-like [Source:NCBI gene;Acc:101159356])

HSP 1 Score: 55.4546 bits (132), Expect = 1.179e-7
Identity = 49/110 (44.55%), Postives = 65/110 (59.09%), Query Frame = 2
Query:  314 WY-----ENDXXXXXXXXXXXXXRNRDLETQLNVQAKNSHNLRLEIDLLKKQLETLRELNRNKMILYEDVDKNSHDLEITNRNLLCDSKKQKEKIFNITKKNSYLEQSLD 628
            WY     E DL LAAELGKTLLERN++LE  L     N+     EI+ L KQLE LRE+N     +YE +D  + +LEITN  L+ +SK  ++KI  +T     L+  +D
Sbjct:   22 WYDQRDLEQDLHLAAELGKTLLERNKELEESLQQMYGNNDEQVQEIEYLSKQLEMLREVNEQHAKVYEQLDVTARELEITNEKLVLESKASQQKIDRLTGTMESLQGQVD 131          
BLAST of Cerebellar degeneration related protein 2 vs. Planmine SMEST
Match: SMESG000009992.1 (SMESG000009992.1)

HSP 1 Score: 711.449 bits (1835), Expect = 0.000e+0
Identity = 418/419 (99.76%), Postives = 419/419 (100.00%), Query Frame = 2
Query:  236 MAAFXXXXXXXXXXXXDKCSLVDEGYWYENDXXXXXXXXXXXXXRNRDLETQLNVQAKNSHNLRLEIDLLKKQLETLRELNRNKMILYEDVDKNSHDLEITNRNLLCDSKKQKEKIFNITKKNSYLEQSLDXXXXXXXXXXXXXXXXXXFHCSHVLSDESNHLAPIVSDEDHIDIRKTCPPICRKCKAKEERITVLEIEMDFKNQENEELRLQIFELQKKLRHIEVELEDLKCFPKQNIKVESQTNTLVEDLYSVMEYDIDRVDEKPVEVGSLNTGGQVFTSSNSLKSIGAEATKRTEKPSSLLNELDEKYNHLVKQYETLLQSSRNREEMACDKCSSIAYNDEDFRRKLDNIFSEETRRQRKLLTTQNYRPKYKELFRDAFDILKDMKQXXXXXXXXXXXXXXXXXMEELNRGGGVPK 1492
            MAAFNEEIYESSNIIEDKCSLVDEGYWYENDLLLAAELGKTLLERNRDLETQLNVQAKNSHNLRLEIDLLKKQLETLRELNRNKMILYEDVDKNSHDLEITNRNLLCDSKKQKEKIFNITKKNSYLEQSLDELTEKLKSTEKEMEELKKFHCSHVLSDESNHLAPIVSDEDHIDIRKTCPPICRKCKAKEERITVLEIEMDFKNQENEELRLQIFELQKKLRHIEVELEDLKCFPKQNIKVESQTNTLVEDLYSVMEYDIDRVDEKPVEVGSLNTGGQVFTSSNSLKSIGAEATKRTEKPSSLLNELDEKYNHLVKQYETLLQSSRNREEMACDKCSSIAYNDEDFRRKLDNIFSEETRRQRKLLTTQNYRPKYKELFRDAFDILKDMKQNKRNIGANIRNNNNNIKME+LNRGGGVPK
Sbjct:    1 MAAFNEEIYESSNIIEDKCSLVDEGYWYENDLLLAAELGKTLLERNRDLETQLNVQAKNSHNLRLEIDLLKKQLETLRELNRNKMILYEDVDKNSHDLEITNRNLLCDSKKQKEKIFNITKKNSYLEQSLDELTEKLKSTEKEMEELKKFHCSHVLSDESNHLAPIVSDEDHIDIRKTCPPICRKCKAKEERITVLEIEMDFKNQENEELRLQIFELQKKLRHIEVELEDLKCFPKQNIKVESQTNTLVEDLYSVMEYDIDRVDEKPVEVGSLNTGGQVFTSSNSLKSIGAEATKRTEKPSSLLNELDEKYNHLVKQYETLLQSSRNREEMACDKCSSIAYNDEDFRRKLDNIFSEETRRQRKLLTTQNYRPKYKELFRDAFDILKDMKQNKRNIGANIRNNNNNIKMEQLNRGGGVPK 419          
The following BLAST results are available for this feature:
BLAST of Cerebellar degeneration related protein 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CDR2L9.483e-744.34cerebellar degeneration related protein 2 like [So... [more]
CDR26.540e-637.88cerebellar degeneration related protein 2 [Source:... [more]
CDR27.015e-633.33cerebellar degeneration related protein 2 [Source:... [more]
back to top
BLAST of Cerebellar degeneration related protein 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cerebellar degeneration related protein 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cerebellar degeneration related protein 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cdr2l7.626e-928.09cerebellar degeneration-related protein 2-like [So... [more]
cdr2l7.626e-928.09cerebellar degeneration-related protein 2-like [So... [more]
cdr2l7.626e-928.09cerebellar degeneration-related protein 2-like [So... [more]
back to top
BLAST of Cerebellar degeneration related protein 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tuba4b4.489e-1126.16tubulin alpha 4b [Source:Xenbase;Acc:XB-GENE-48992... [more]
tuba4b8.451e-1123.72tubulin alpha 4b [Source:Xenbase;Acc:XB-GENE-48992... [more]
back to top
BLAST of Cerebellar degeneration related protein 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Cdr2l1.437e-644.34cerebellar degeneration-related protein 2-like [So... [more]
Cdr29.101e-633.33cerebellar degeneration-related 2 [Source:MGI Symb... [more]
back to top
BLAST of Cerebellar degeneration related protein 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q6NZT2|CDR2L_DANRE5.756e-828.09Cerebellar degeneration-related protein 2-like OS=... [more]
sp|Q86X02|CDR2L_HUMAN4.554e-644.34Cerebellar degeneration-related protein 2-like OS=... [more]
back to top
BLAST of Cerebellar degeneration related protein 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267F9F24.182e-1940.13Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FMI11.304e-1840.13Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GP361.327e-1840.13Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A2T7PZL51.412e-1026.97Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A210R4N53.070e-849.48Cerebellar degeneration-related protein 2 OS=Mizuh... [more]
back to top
BLAST of Cerebellar degeneration related protein 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cdr2l1.248e-828.25cerebellar degeneration related protein 2 like [So... [more]
cdr2l2.221e-825.47cerebellar degeneration related protein 2 like [So... [more]
back to top
BLAST of Cerebellar degeneration related protein 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cerebellar degeneration related protein 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cerebellar degeneration related protein 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cerebellar degeneration related protein 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cdr2l1.179e-744.55cerebellar degeneration-related protein 2-like [So... [more]
back to top
BLAST of Cerebellar degeneration related protein 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000009992.10.000e+099.76SMESG000009992.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035905 ID=SMED30035905|Name=Cerebellar degeneration related protein 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1780bp
AAAAATTGCATGTTTAATGAATTTAAACTTTTATTAAAAGTGTATACAAA
GTGTAGAAAAGTCATTGAAATTTGTCTAAGTGTTGAAAAACGACACAGAT
TTGTTGCAACACGCGTTAATGAAATCACGTGATTAATTACTACTAACTAT
TAGCAGCAGCCAATCAAATCAGTTGGAATATTGATTAAATCATTTGTTTA
TTTTTCAATAGATAATTATTTTCTTCTGATAAAATATGGCTGCTTTCAAT
GAAGAAATTTATGAATCAAGCAATATAATCGAGGACAAATGTTCTTTAGT
CGATGAAGGATATTGGTACGAAAATGATCTCTTGTTAGCAGCAGAACTGG
GAAAAACACTGCTGGAAAGGAATCGCGACCTTGAAACTCAATTGAATGTT
CAAGCAAAAAATTCTCACAATTTACGATTGGAAATAGATCTGCTAAAGAA
GCAACTAGAAACATTGAGAGAACTGAACCGTAACAAAATGATTCTATACG
AAGACGTGGACAAAAACAGCCACGATTTGGAAATTACAAATAGAAATTTA
TTGTGCGACAGCAAGAAACAAAAAGAAAAAATATTCAACATCACCAAGAA
AAATTCATATCTCGAACAGAGTCTCGATGAGCTGACTGAGAAATTGAAAT
CCACCGAGAAAGAGATGGAAGAATTGAAGAAGTTCCATTGTTCTCATGTA
TTGAGTGATGAATCCAATCACTTAGCACCGATTGTTTCGGATGAGGATCA
CATCGATATACGGAAAACATGTCCACCAATTTGCAGGAAATGCAAAGCAA
AAGAAGAAAGGATCACAGTGCTGGAAATCGAAATGGATTTCAAAAATCAA
GAAAACGAAGAATTGCGCTTGCAAATATTTGAGCTCCAGAAGAAATTGCG
TCACATTGAAGTCGAATTAGAAGATTTGAAATGTTTTCCTAAACAAAATA
TCAAGGTGGAATCCCAAACTAATACATTGGTTGAAGATCTCTATTCGGTA
ATGGAATATGATATCGACAGAGTGGACGAAAAACCAGTTGAGGTAGGCAG
CCTGAATACCGGGGGCCAGGTATTCACCTCCTCTAATTCCTTGAAATCGA
TTGGTGCCGAAGCAACGAAACGAACGGAAAAGCCGTCCTCGCTGCTGAAT
GAATTGGATGAGAAATACAATCACCTGGTGAAGCAATATGAAACTCTCCT
GCAATCATCACGAAATCGAGAGGAAATGGCCTGTGACAAATGCTCATCGA
TTGCGTACAACGATGAGGATTTCCGGCGGAAACTCGACAACATATTCTCA
GAAGAAACTCGCCGCCAGAGGAAACTTTTGACCACTCAGAATTACCGGCC
GAAATACAAGGAGTTATTCCGTGACGCATTTGACATCTTGAAGGACATGA
AGCAGAACAAGCGGAACATTGGTGCCAATATTAGGAACAATAATAACAAT
ATCAAAATGGAGGAGTTGAATCGAGGGGGAGGAGTTCCTAAATGATCTCG
TTATCAATTGATTTTTCCATTCTTTCGGTGATAGTTCTTATTTTTGAATT
TGCTGTTTGCTGATAGGCTAAGCATTGTAATGTGTGTTTGCGTGTGTGTG
ATACGACTTTCCTCTGTTCCATTCCCTGTAATGTGTGACTGTGTGTGTGT
GTTCCATTTGTGCGGATTTATCGATTTTTTGCAATCAATGTATCGCATTT
GTTTTTATATATTTTATTTTCAATATTTTTACTACATCTTATTCTCATTG
ATTATTATTATTATTATCCATTCAATACAT
back to top

protein sequence of SMED30035905-orf-1

>SMED30035905-orf-1 ID=SMED30035905-orf-1|Name=SMED30035905-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=420bp
MAAFNEEIYESSNIIEDKCSLVDEGYWYENDLLLAAELGKTLLERNRDLE
TQLNVQAKNSHNLRLEIDLLKKQLETLRELNRNKMILYEDVDKNSHDLEI
TNRNLLCDSKKQKEKIFNITKKNSYLEQSLDELTEKLKSTEKEMEELKKF
HCSHVLSDESNHLAPIVSDEDHIDIRKTCPPICRKCKAKEERITVLEIEM
DFKNQENEELRLQIFELQKKLRHIEVELEDLKCFPKQNIKVESQTNTLVE
DLYSVMEYDIDRVDEKPVEVGSLNTGGQVFTSSNSLKSIGAEATKRTEKP
SSLLNELDEKYNHLVKQYETLLQSSRNREEMACDKCSSIAYNDEDFRRKL
DNIFSEETRRQRKLLTTQNYRPKYKELFRDAFDILKDMKQNKRNIGANIR
NNNNNIKMEELNRGGGVPK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR026079CDR2
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 186..227
NoneNo IPR availableCOILSCoilCoilcoord: 123..150
NoneNo IPR availableCOILSCoilCoilcoord: 60..90
NoneNo IPR availableCOILSCoilCoilcoord: 304..324
IPR026079Cerebellar degeneration-related protein 2PANTHERPTHR19232FAMILY NOT NAMEDcoord: 170..393
coord: 23..149