PROG-1

Overview
NamePROG-1 (AFP81697.1)
Smed IDSMED30035904
Length (bp)728
Neoblast Clusters

Zeng et. al., 2018


▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of PROG-1 (SMED30035904) t-SNE clustered cells

Violin plots show distribution of expression levels for PROG-1 (SMED30035904) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of PROG-1 (SMED30035904) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for PROG-1 (SMED30035904) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017


Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Download CSV of Expression Data

 

back to top

Expression Details

PROG-1 ( NB.21.11e, prog-1 ) is expressed during Stage 5, Stage 6, Stage 7 and Stage 8 in the Category 2 cell and integumental system

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Homology
BLAST of PROG-1 vs. TrEMBL
Match: tr|J7GX15|J7GX15_SCHMD (PROG-1 OS=Schmidtea mediterranea PE=2 SV=1)

HSP 1 Score: 294.664 bits (753), Expect = 7.581e-97
Identity = 214/218 (98.17%), Postives = 214/218 (98.17%), Query Frame = 2
Query:   35 MKVLIIFLFVIAFAYIECRPQHLLGFMRKEKSKLEKDSAXXXXXXXXXXXXXXXXXHEGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGHITKADCMKLYEETDKYCDPLYLKLDKDCDCRYVKALNDYTKRWDSYHSKCGSKYDKKCRTELRALENWFNGLYDSIDGHCDAEYDALDKYCDVEYNKVDQCEKGQKV 688
            MKVLIIFLFVIAFAYIECRPQHLLGF RKEKSKLEKDSADDVK GKDSDKSSDK SHEGSNKESDKETDKEEETNSKTSAKSPAKSSRRKKQ EKLEEEEGETLKEKLKGHITKADCMKLYEETDKYCDPLYLKLDKDCDCRYVKALNDYTKRWDSYHSKCGSKYDKKCRTELRALENWFNGLYDSIDGHCDAEYDALDKYCDVEYNKVDQCEKGQKV
Sbjct:    1 MKVLIIFLFVIAFAYIECRPQHLLGFTRKEKSKLEKDSADDVKNGKDSDKSSDKDSHEGSNKESDKETDKEEETNSKTSAKSPAKSSRRKKQAEKLEEEEGETLKEKLKGHITKADCMKLYEETDKYCDPLYLKLDKDCDCRYVKALNDYTKRWDSYHSKCGSKYDKKCRTELRALENWFNGLYDSIDGHCDAEYDALDKYCDVEYNKVDQCEKGQKV 218          
The following BLAST results are available for this feature:
BLAST of PROG-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Human)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PROG-1 vs. Ensembl Celegans
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Celegan)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PROG-1 vs. Ensembl Fly
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Drosophila)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PROG-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Zebrafish)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PROG-1 vs. Ensembl Xenopus
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Xenopus)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PROG-1 vs. Ensembl Mouse
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Mouse)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PROG-1 vs. UniProt
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PROG-1 vs. TrEMBL
Analysis Date: 2017-05-17 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 1
Match NameE-valueIdentityDescription
tr|J7GX15|J7GX15_SCHMD7.581e-9798.17PROG-1 OS=Schmidtea mediterranea PE=2 SV=1[more]
back to top
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2016-09-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 7..25
NoneNo IPR availableTMHMMTMhelixcoord: 10..32
NoneNo IPR availableTMHMMTMhelixcoord: 42..64
NoneNo IPR availableTMHMMTMhelixcoord: 15..37
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..13
score: 0.483
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..21
score: 0.778
NoneNo IPR availableTMHMMTMhelixcoord: 7..26
NoneNo IPR availableTMHMMTMhelixcoord: 9..31
NoneNo IPR availableTMHMMTMhelixcoord: 10..28

Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000008Stage 8
PLANA:0000007Stage 7
PLANA:0000006Stage 6
PLANA:0000005Stage 5
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0004529integumental system
PLANA:0000028Category 2 cell
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035904 ID=SMED30035904|Name=PROG-1|organism=Schmidtea mediterranea sexual|type=transcript|length=728bp
GCAATATTTTGTCATGAATGTTTAATTGAAAAATATGAAAGTTTTAATTA
TATTTCTATTTGTGATTGCGTTCGCGTATATTGAATGCCGTCCTCAACAT
CTATTGGGGTTCATGAGGAAAGAAAAGTCCAAGCTAGAAAAAGACTCAGC
AGATGACGTGAAACAAGGAAAAGATTCGGATAAAAGCTCTGATAAATATT
CACATGAAGGATCTAATAAAGAGTCTGACAAAGAGACAGATAAAGAAGAA
GAAACTAATTCTAAGACTTCTGCAAAGTCTCCCGCCAAATCAAGTAGACG
AAAGAAACAAGTGGAAAAATTGGAAGAAGAGGAAGGAGAAACTTTAAAAG
AGAAATTAAAAGGACACATTACGAAAGCAGATTGCATGAAATTATACGAA
GAAACTGATAAATACTGCGATCCACTTTATTTGAAGCTCGACAAAGATTG
CGACTGCAGATATGTGAAAGCATTGAATGACTACACGAAAAGATGGGACA
GTTATCATTCCAAATGTGGTAGCAAATATGACAAAAAATGCCGAACCGAA
TTGCGAGCTTTGGAGAATTGGTTTAATGGCCTTTATGATTCAATCGACGG
CCACTGTGACGCAGAATATGACGCGCTGGATAAATATTGTGACGTAGAAT
ACAACAAAGTTGATCAATGTGAAAAAGGACAGAAAGTGTAATAAAATTGA
TTTGTAATAAAATTTATTAAATAAAAAA
back to top

protein sequence of SMED30035904-orf-1

>SMED30035904-orf-1 ID=SMED30035904-orf-1|Name=SMED30035904-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=219bp
MKVLIIFLFVIAFAYIECRPQHLLGFMRKEKSKLEKDSADDVKQGKDSDK
SSDKYSHEGSNKESDKETDKEEETNSKTSAKSPAKSSRRKKQVEKLEEEE
GETLKEKLKGHITKADCMKLYEETDKYCDPLYLKLDKDCDCRYVKALNDY
TKRWDSYHSKCGSKYDKKCRTELRALENWFNGLYDSIDGHCDAEYDALDK
YCDVEYNKVDQCEKGQKV*
back to top
Aliases
The feature 'PROG-1' has the following synonyms
Synonym
NB.21.11e
prog-1
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30035904
GenBankAFP81697.1