PROG-1

Overview
NamePROG-1 (AFP81697.1)
Smed IDSMED30035904
Length (bp)728
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of PROG-1 (SMED30035904) t-SNE clustered cells

Violin plots show distribution of expression levels for PROG-1 (SMED30035904) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of PROG-1 (SMED30035904) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for PROG-1 (SMED30035904) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top

Expression Details

PROG-1 ( NB.21.11e, prog-1 ) is expressed during Stage 5, Stage 6, Stage 7 and Stage 8 in the Category 2 cell and integumental system

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Anatomical Expression

PAGE et. al., 2020




SMED30035904

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 42

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30035904SMESG000024882.1 SMESG000024707.1 SmedASXL_011484SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
Category 2 cellSMED30035904SMESG000024882.1 SMESG000024707.1 JX122762.1smed_ncbi_20200123PMID:26114597
Zhu et al., 2015
whole organism asexual adult fluorescence in situ hybridization evidence
parenchymaSMED30035904SMESG000024882.1 SMESG000024707.1 JX122762.1smed_ncbi_20200123PMID:26114597
Zhu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
X1 cellSMED30035904SMESG000024882.1 SMESG000024707.1 SmedASXL_011484SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30035904SMESG000024882.1 SMESG000024707.1 SmedASXL_011484SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30035904SMESG000024882.1 SMESG000024707.1 SMED30035904smed_20140614PMID:29100657
Cheng et al., 2018
FACS sorted cell population asexual adult RNA-sequencing evidence
epidermal cellSMED30035904SMESG000024882.1 SMESG000024707.1 dd_Smed_v4_332_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30035904SMESG000024882.1 SMESG000024707.1 dd_Smed_v6_332_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Category 2 cellSMED30035904SMESG000024882.1 SMESG000024707.1 JX122762.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
Category 2 cellSMED30035904SMESG000024882.1 SMESG000024707.1 JX122762.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 5 colorimetric in situ hybridization evidence
Category 2 cellSMED30035904SMESG000024882.1 SMESG000024707.1 JX122762.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
Category 2 cellSMED30035904SMESG000024882.1 SMESG000024707.1 JX122762.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
epidermal progenitor cellSMED30035904SMESG000024882.1 SMESG000024707.1 JX122762.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 5 colorimetric in situ hybridization evidence
epidermal progenitor cellSMED30035904SMESG000024882.1 SMESG000024707.1 JX122762.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
epidermal progenitor cellSMED30035904SMESG000024882.1 SMESG000024707.1 JX122762.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
epidermal progenitor cellSMED30035904SMESG000024882.1 SMESG000024707.1 JX122762.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
Category 2 cellSMED30035904SMESG000024882.1 SMESG000024707.1 SMED30035904smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
Category 2 cellSMED30035904SMESG000024882.1 SMESG000024707.1 SMED30035904smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 5 colorimetric in situ hybridization evidence
Category 2 cellSMED30035904SMESG000024882.1 SMESG000024707.1 SMED30035904smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
Category 2 cellSMED30035904SMESG000024882.1 SMESG000024707.1 SMED30035904smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
epidermal progenitor cellSMED30035904SMESG000024882.1 SMESG000024707.1 SMED30035904smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
epidermal progenitor cellSMED30035904SMESG000024882.1 SMESG000024707.1 SMED30035904smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
epidermal progenitor cellSMED30035904SMESG000024882.1 SMESG000024707.1 SMED30035904smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
epidermal progenitor cellSMED30035904SMESG000024882.1 SMESG000024707.1 SMED30035904smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 5 colorimetric in situ hybridization evidence
Category 2 cellSMED30035904SMESG000024882.1 SMESG000024707.1 AFP81697.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
Category 2 cellSMED30035904SMESG000024882.1 SMESG000024707.1 AFP81697.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 5 colorimetric in situ hybridization evidence
Category 2 cellSMED30035904SMESG000024882.1 SMESG000024707.1 AFP81697.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
Category 2 cellSMED30035904SMESG000024882.1 SMESG000024707.1 AFP81697.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
epidermal progenitor cellSMED30035904SMESG000024882.1 SMESG000024707.1 AFP81697.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
epidermal progenitor cellSMED30035904SMESG000024882.1 SMESG000024707.1 AFP81697.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
epidermal progenitor cellSMED30035904SMESG000024882.1 SMESG000024707.1 AFP81697.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
epidermal progenitor cellSMED30035904SMESG000024882.1 SMESG000024707.1 AFP81697.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 5 colorimetric in situ hybridization evidence
Category 2 cellSMED30035904SMESG000024882.1 SMESG000024707.1 JX122762.1smed_ncbi_20200123PMID:24523458
Lin et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
Category 2 cellSMED30035904SMESG000024882.1 SMESG000024707.1 JX122762.1smed_ncbi_20200123PMID:23318635
Blassberg et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
Category 2 cellSMED30035904SMESG000024882.1 SMESG000024707.1 dd_Smed_v6_332_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035904SMESG000024882.1 SMESG000024707.1 dd_Smed_v6_332_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30035904SMESG000024882.1 SMESG000024707.1 dd_Smed_v4_332_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30035904SMESG000024882.1 SMESG000024707.1 JX122762.1smed_ncbi_20200123PMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult cDNA to DNA expression microarray evidence
Category 2 cellSMED30035904SMESG000024882.1 SMESG000024707.1 JX122762.1smed_ncbi_20200123PMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
Category 2 cellSMED30035904SMESG000024882.1 SMESG000024707.1 JX122762.1smed_ncbi_20200123PMID:24415944
Scimone et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
neoblastSMED30035904SMESG000024882.1 SMESG000024707.1 SMED_01436_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30035904SMESG000024882.1 SMESG000024707.1 SMED_01436_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of PROG-1 vs. TrEMBL
Match: gnl|BL_ORD_ID|20309472 (tr|J7GX15|J7GX15_SCHMD PROG-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 294.664 bits (753), Expect = 4.159e-98
Identity = 214/218 (98.17%), Postives = 214/218 (98.17%), Query Frame = 2
Query:   35 MKVLIIFLFVIAFAYIECRPQHLLGFMRKEKSKLEKDSAXXXXXXXXXXXXXXXXXHEGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGHITKADCMKLYEETDKYCDPLYLKLDKDCDCRYVKALNDYTKRWDSYHSKCGSKYDKKCRTELRALENWFNGLYDSIDGHCDAEYDALDKYCDVEYNKVDQCEKGQKV 688
            MKVLIIFLFVIAFAYIECRPQHLLGF RKEKSKLEKDSADDVK GKDSDKSSDK SHEGSNKESDKETDKEEETNSKTSAKSPAKSSRRKKQ EKLEEEEGETLKEKLKGHITKADCMKLYEETDKYCDPLYLKLDKDCDCRYVKALNDYTKRWDSYHSKCGSKYDKKCRTELRALENWFNGLYDSIDGHCDAEYDALDKYCDVEYNKVDQCEKGQKV
Sbjct:    1 MKVLIIFLFVIAFAYIECRPQHLLGFTRKEKSKLEKDSADDVKNGKDSDKSSDKDSHEGSNKESDKETDKEEETNSKTSAKSPAKSSRRKKQAEKLEEEEGETLKEKLKGHITKADCMKLYEETDKYCDPLYLKLDKDCDCRYVKALNDYTKRWDSYHSKCGSKYDKKCRTELRALENWFNGLYDSIDGHCDAEYDALDKYCDVEYNKVDQCEKGQKV 218          
BLAST of PROG-1 vs. Planmine SMEST
Match: SMESG000024882.1 (SMESG000024882.1)

HSP 1 Score: 293.893 bits (751), Expect = 2.657e-101
Identity = 213/218 (97.71%), Postives = 214/218 (98.17%), Query Frame = 2
Query:   35 MKVLIIFLFVIAFAYIECRPQHLLGFMRKEKSKLEKDSAXXXXXXXXXXXXXXXXXHEGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGHITKADCMKLYEETDKYCDPLYLKLDKDCDCRYVKALNDYTKRWDSYHSKCGSKYDKKCRTELRALENWFNGLYDSIDGHCDAEYDALDKYCDVEYNKVDQCEKGQKV 688
            MKVLIIFLFVIAFA+IECRPQHLLGF RKEKSKLEKDSADDVK GKDSDKSSDK SHEGSNKESDKETDKEEETNSKTSAKSPAKSSRRKKQ EKLEEEEGETLKEKLKGHITKADCMKLYEETDKYCDPLYLKLDKDCDCRYVKALNDYTKRWDSYHSKCGSKYDKKCRTELRALENWFNGLYDSIDGHCDAEYDALDKYCDVEYNKVDQCEKGQKV
Sbjct:    1 MKVLIIFLFVIAFAFIECRPQHLLGFTRKEKSKLEKDSADDVKNGKDSDKSSDKDSHEGSNKESDKETDKEEETNSKTSAKSPAKSSRRKKQAEKLEEEEGETLKEKLKGHITKADCMKLYEETDKYCDPLYLKLDKDCDCRYVKALNDYTKRWDSYHSKCGSKYDKKCRTELRALENWFNGLYDSIDGHCDAEYDALDKYCDVEYNKVDQCEKGQKV 218          
BLAST of PROG-1 vs. Planmine SMEST
Match: SMESG000024707.1 (SMESG000024707.1)

HSP 1 Score: 228.409 bits (581), Expect = 1.186e-75
Identity = 109/109 (100.00%), Postives = 109/109 (100.00%), Query Frame = 2
Query:  362 GHITKADCMKLYEETDKYCDPLYLKLDKDCDCRYVKALNDYTKRWDSYHSKCGSKYDKKCRTELRALENWFNGLYDSIDGHCDAEYDALDKYCDVEYNKVDQCEKGQKV 688
            GHITKADCMKLYEETDKYCDPLYLKLDKDCDCRYVKALNDYTKRWDSYHSKCGSKYDKKCRTELRALENWFNGLYDSIDGHCDAEYDALDKYCDVEYNKVDQCEKGQKV
Sbjct:  102 GHITKADCMKLYEETDKYCDPLYLKLDKDCDCRYVKALNDYTKRWDSYHSKCGSKYDKKCRTELRALENWFNGLYDSIDGHCDAEYDALDKYCDVEYNKVDQCEKGQKV 210          

HSP 2 Score: 80.4925 bits (197), Expect = 2.641e-18
Identity = 38/39 (97.44%), Postives = 38/39 (97.44%), Query Frame = 2
Query:   35 MKVLIIFLFVIAFAYIECRPQHLLGFMRKEKSKLEKDSA 151
            MKVLIIFLFVIAFAYIECRPQHL GFMRKEKSKLEKDSA
Sbjct:    1 MKVLIIFLFVIAFAYIECRPQHLFGFMRKEKSKLEKDSA 39          
BLAST of PROG-1 vs. Planmine SMEST
Match: SMESG000024881.1 (SMESG000024881.1)

HSP 1 Score: 67.781 bits (164), Expect = 4.285e-14
Identity = 40/97 (41.24%), Postives = 53/97 (54.64%), Query Frame = 2
Query:  377 ADCMKLYEETDKYCDPLYLKLDKDCDCRYVKALNDYTKRWDSYHSKCGSKYDKKCRTELRALENWFNGLYDSIDGHCDAEYDALDKYCDVEYNKVDQ 667
             +C   YEE DK CDP Y  LDK C  +YV+   D+ K+  + + KC     K  R  +R LE    G YD +D  CD +Y ALDK C  +Y K+D+
Sbjct:   40 TECEDEYEELDKLCDPKYEALDKQCLPKYVQINADFAKQVVNANLKCQETPTKAGRKVVRDLEKQIFGDYDKLDKTCDPQYAALDKECLEQYQKLDK 136          
BLAST of PROG-1 vs. Planmine SMEST
Match: SMESG000072142.1 (SMESG000072142.1)

HSP 1 Score: 56.9954 bits (136), Expect = 2.731e-10
Identity = 32/99 (32.32%), Postives = 48/99 (48.48%), Query Frame = 2
Query:  377 ADCMKLYEETDKYCDPLYLKLDKDCDCRYVKALNDYTKRWDSYHSKCGSKYDKKCRTELRALENWFNGLYDSIDGHCDAEYDALDKYCDVEYNKVDQCE 673
            ADC+ + ++ D+ CD  YL LD  CD RY          +D    +C +    +C  +   L+    G YD +D  CD  Y+ LD +CD  Y   ++CE
Sbjct:   25 ADCLTMLDKIDRECDRKYLVLDNHCDSRYAHLHKTCDINYDKLSGRCKNNMSMRCILKYGRLDRKCLGAYDRVDTFCDKRYNVLDTHCDELYKIQEKCE 123          
BLAST of PROG-1 vs. Planmine SMEST
Match: SMESG000072142.1 (SMESG000072142.1)

HSP 1 Score: 56.9954 bits (136), Expect = 2.765e-10
Identity = 32/99 (32.32%), Postives = 48/99 (48.48%), Query Frame = 2
Query:  377 ADCMKLYEETDKYCDPLYLKLDKDCDCRYVKALNDYTKRWDSYHSKCGSKYDKKCRTELRALENWFNGLYDSIDGHCDAEYDALDKYCDVEYNKVDQCE 673
            ADC+ + ++ D+ CD  YL LD  CD RY          +D    +C +    +C  +   L+    G YD +D  CD  Y+ LD +CD  Y   ++CE
Sbjct:   28 ADCLTMLDKIDRECDRKYLVLDNHCDSRYAHLHKTCDINYDKLSGRCKNNMSMRCILKYGRLDRKCLGAYDRVDTFCDKRYNVLDTHCDELYKIQEKCE 126          
The following BLAST results are available for this feature:
BLAST of PROG-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PROG-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PROG-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PROG-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PROG-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PROG-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PROG-1 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PROG-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 1
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|203094724.159e-9898.17tr|J7GX15|J7GX15_SCHMD PROG-1 OS=Schmidtea mediter... [more]
back to top
BLAST of PROG-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PROG-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PROG-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PROG-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PROG-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PROG-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000024882.12.657e-10197.71SMESG000024882.1[more]
SMESG000024707.11.186e-75100.00SMESG000024707.1[more]
SMESG000024881.14.285e-1441.24SMESG000024881.1[more]
SMESG000072142.12.731e-1032.32SMESG000072142.1[more]
SMESG000072142.12.765e-1032.32SMESG000072142.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30035904
GenBankAFP81697.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035904 ID=SMED30035904|Name=PROG-1|organism=Schmidtea mediterranea sexual|type=transcript|length=728bp
GCAATATTTTGTCATGAATGTTTAATTGAAAAATATGAAAGTTTTAATTA
TATTTCTATTTGTGATTGCGTTCGCGTATATTGAATGCCGTCCTCAACAT
CTATTGGGGTTCATGAGGAAAGAAAAGTCCAAGCTAGAAAAAGACTCAGC
AGATGACGTGAAACAAGGAAAAGATTCGGATAAAAGCTCTGATAAATATT
CACATGAAGGATCTAATAAAGAGTCTGACAAAGAGACAGATAAAGAAGAA
GAAACTAATTCTAAGACTTCTGCAAAGTCTCCCGCCAAATCAAGTAGACG
AAAGAAACAAGTGGAAAAATTGGAAGAAGAGGAAGGAGAAACTTTAAAAG
AGAAATTAAAAGGACACATTACGAAAGCAGATTGCATGAAATTATACGAA
GAAACTGATAAATACTGCGATCCACTTTATTTGAAGCTCGACAAAGATTG
CGACTGCAGATATGTGAAAGCATTGAATGACTACACGAAAAGATGGGACA
GTTATCATTCCAAATGTGGTAGCAAATATGACAAAAAATGCCGAACCGAA
TTGCGAGCTTTGGAGAATTGGTTTAATGGCCTTTATGATTCAATCGACGG
CCACTGTGACGCAGAATATGACGCGCTGGATAAATATTGTGACGTAGAAT
ACAACAAAGTTGATCAATGTGAAAAAGGACAGAAAGTGTAATAAAATTGA
TTTGTAATAAAATTTATTAAATAAAAAA
back to top

protein sequence of SMED30035904-orf-1

>SMED30035904-orf-1 ID=SMED30035904-orf-1|Name=SMED30035904-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=219bp
MKVLIIFLFVIAFAYIECRPQHLLGFMRKEKSKLEKDSADDVKQGKDSDK
SSDKYSHEGSNKESDKETDKEEETNSKTSAKSPAKSSRRKKQVEKLEEEE
GETLKEKLKGHITKADCMKLYEETDKYCDPLYLKLDKDCDCRYVKALNDY
TKRWDSYHSKCGSKYDKKCRTELRALENWFNGLYDSIDGHCDAEYDALDK
YCDVEYNKVDQCEKGQKV*
back to top
Aliases
The feature 'PROG-1' has the following synonyms
Synonym
NB.21.11e
prog-1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000033epidermal progenitor cell
PLANA:0000418head
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002075pigment cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
PLANA:0004529integumental system
PLANA:0000028Category 2 cell
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000007Stage 7
PLANA:0000006Stage 6
PLANA:0000005Stage 5
PLANA:0000008Stage 8
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 29..105
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 29..78
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 87..105
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.807