SMED30035897

Overview
NameSMED30035897
Smed IDSMED30035897
Length (bp)5944
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30035897 (SMED30035897) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30035897 (SMED30035897) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30035897 (SMED30035897) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30035897 (SMED30035897) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035897

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30035897 SmedASXL_070455SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30035897 SmedASXL_075152SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30035897 SmedASXL_075152SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30035897 SmedASXL_075153SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30035897 SmedASXL_075153SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30035897 SmedASXL_070055SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30035897 SmedASXL_070055SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30035897 SmedASXL_023493SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30035897 vs. Planmine SMEST
Match: SMESG000063550.1 (SMESG000063550.1)

HSP 1 Score: 204.142 bits (518), Expect = 5.888e-66
Identity = 95/105 (90.48%), Postives = 99/105 (94.29%), Query Frame = 3
Query: 5310 KKAMKIELNLKSAQTKSESFAIVTETRERSKSPVRNNRVQQASNPSPKFRPKFESNKTIDIQNDGKESPIQCSYCQRPGHYVNQCWLKNRSQKSPIQIRCDHCQK 5624
            +KAMKIELNLKSAQT SESFAI+TETRERS SP RNNR+QQAS+PS KFRPKFE NKTIDIQNDGKESPIQCSYCQR GHYVNQCWLKNRSQKSPIQIRCDHCQK
Sbjct:  142 QKAMKIELNLKSAQTMSESFAIITETRERSISPFRNNRLQQASSPSSKFRPKFELNKTIDIQNDGKESPIQCSYCQRLGHYVNQCWLKNRSQKSPIQIRCDHCQK 246          

HSP 2 Score: 69.3218 bits (168), Expect = 5.888e-66
Identity = 38/69 (55.07%), Postives = 48/69 (69.57%), Query Frame = 2
Query: 5003 KRRVAKEQ*LLTGCVSHEIDWGDIKTLT*QKFYNRVQYSDESVSEFAYHS-TVAENAFEVKPDQADVAK 5206
            +R +A +   L   ++ ++  GDIK +  QKFYN VQ SDESVSEFAYH   +AE A+EVKPDQADV K
Sbjct:   73 QRSIANDWTKLKDALAAKLIGGDIKRIMRQKFYNGVQKSDESVSEFAYHLINLAEKAYEVKPDQADVTK 141          
BLAST of SMED30035897 vs. Planmine SMEST
Match: SMESG000056661.1 (SMESG000056661.1)

HSP 1 Score: 204.142 bits (518), Expect = 8.568e-65
Identity = 121/241 (50.21%), Postives = 152/241 (63.07%), Query Frame = 3
Query: 5217 E*LQNQFLTGVKKEIKKALCYVDFNDFDEFIKKAMKIELNLKSAQTKSESFAIVTETRERSKSPVRNNRVQQASNPSPKFRPKFESNKTIDIQNDGKESPIQCSYCQRPGHYVNQCWLKNRSQKSPIQIRCDHCQKM*HDSNQCWFKKNVKQSPKQMPSDWVXXXXXXXXXXXXXXDQQINVNSQYYIYGRKWHISRNCFAXXXXXXXXXXXQRDKLNLQGQIQCH*CRGYGHIA*SCPKN 5939
            E LQ+QFLT V+KEIKKALCYVDFN+FDE IKKAMKIELNLK+ Q K+ESF  + E+R+RS  P++NN  Q++++PSPKFR KFE  K+ +  N  +E P+QCS                            HCQK+ H+ N  WFK N ++SP  +                    Q+IN N Q Y  G++ H+SRNCFARSRSPST PS Q D++NLQG IQCH CRGYGH+A SCP+N
Sbjct:  137 ELLQDQFLTEVRKEIKKALCYVDFNNFDELIKKAMKIELNLKTTQPKAESFTTIVESRDRSICPIKNNLFQKSTSPSPKFRVKFEPKKSTNSPNKERERPVQCS----------------------------HCQKLGHNINPFWFKNNSRRSPSPV-------------------HQRINDNIQCYNCGKRGHVSRNCFARSRSPSTSPSPQSDRVNLQGGIQCHSCRGYGHMARSCPRN 330          

HSP 2 Score: 50.8322 bits (120), Expect = 8.568e-65
Identity = 20/28 (71.43%), Postives = 23/28 (82.14%), Query Frame = 1
Query: 4918 KIPVNQFGGDSVELVDFIADYYMYTTIY 5001
            K+PV Q+GGD VE VDF+ADYYMY T Y
Sbjct:   40 KLPVQQYGGDPVEFVDFMADYYMYATAY 67          

HSP 3 Score: 33.8834 bits (76), Expect = 8.568e-65
Identity = 19/45 (42.22%), Postives = 27/45 (60.00%), Query Frame = 2
Query: 4994 QSTKRRVAKEQ*LLTGCVSHEIDWGDIKTLT*QKFYNRVQYSDES 5128
            Q  KR +A +   L   ++ ++  GDI+ +  QKFYNRVQ  DES
Sbjct:   92 QIDKRLIANDWTKLKDALASKLIGGDIERIMRQKFYNRVQRPDES 136          

HSP 4 Score: 21.9422 bits (45), Expect = 8.568e-65
Identity = 9/14 (64.29%), Postives = 12/14 (85.71%), Query Frame = 2
Query: 4838 SNTGNNDKTLVSTV 4879
            SN+ NND+T VST+
Sbjct:    3 SNSNNNDQTPVSTM 16          
BLAST of SMED30035897 vs. Planmine SMEST
Match: SMESG000056661.1 (SMESG000056661.1)

HSP 1 Score: 204.142 bits (518), Expect = 1.087e-64
Identity = 121/241 (50.21%), Postives = 152/241 (63.07%), Query Frame = 3
Query: 5217 E*LQNQFLTGVKKEIKKALCYVDFNDFDEFIKKAMKIELNLKSAQTKSESFAIVTETRERSKSPVRNNRVQQASNPSPKFRPKFESNKTIDIQNDGKESPIQCSYCQRPGHYVNQCWLKNRSQKSPIQIRCDHCQKM*HDSNQCWFKKNVKQSPKQMPSDWVXXXXXXXXXXXXXXDQQINVNSQYYIYGRKWHISRNCFAXXXXXXXXXXXQRDKLNLQGQIQCH*CRGYGHIA*SCPKN 5939
            E LQ+QFLT V+KEIKKALCYVDFN+FDE IKKAMKIELNLK+ Q K+ESF  + E+R+RS  P++NN  Q++++PSPKFR KFE  K+ +  N  +E P+QCS                            HCQK+ H+ N  WFK N ++SP  +                    Q+IN N Q Y  G++ H+SRNCFARSRSPST PS Q D++NLQG IQCH CRGYGH+A SCP+N
Sbjct:  137 ELLQDQFLTEVRKEIKKALCYVDFNNFDELIKKAMKIELNLKTTQPKAESFTTIVESRDRSICPIKNNLFQKSTSPSPKFRVKFEPKKSTNSPNKERERPVQCS----------------------------HCQKLGHNINPFWFKNNSRRSPSPV-------------------HQRINDNIQCYNCGKRGHVSRNCFARSRSPSTSPSPQSDRVNLQGGIQCHSCRGYGHMARSCPRN 330          

HSP 2 Score: 50.8322 bits (120), Expect = 1.087e-64
Identity = 20/28 (71.43%), Postives = 23/28 (82.14%), Query Frame = 1
Query: 4918 KIPVNQFGGDSVELVDFIADYYMYTTIY 5001
            K+PV Q+GGD VE VDF+ADYYMY T Y
Sbjct:   40 KLPVQQYGGDPVEFVDFMADYYMYATAY 67          

HSP 3 Score: 33.8834 bits (76), Expect = 1.087e-64
Identity = 19/45 (42.22%), Postives = 27/45 (60.00%), Query Frame = 2
Query: 4994 QSTKRRVAKEQ*LLTGCVSHEIDWGDIKTLT*QKFYNRVQYSDES 5128
            Q  KR +A +   L   ++ ++  GDI+ +  QKFYNRVQ  DES
Sbjct:   92 QIDKRLIANDWTKLKDALASKLIGGDIERIMRQKFYNRVQRPDES 136          

HSP 4 Score: 21.557 bits (44), Expect = 1.087e-64
Identity = 9/14 (64.29%), Postives = 12/14 (85.71%), Query Frame = 2
Query: 4838 SNTGNNDKTLVSTV 4879
            SN+ NND+T VST+
Sbjct:    3 SNSNNNDQTPVSTM 16          
BLAST of SMED30035897 vs. Planmine SMEST
Match: SMESG000047220.1 (SMESG000047220.1)

HSP 1 Score: 235.728 bits (600), Expect = 1.299e-64
Identity = 126/218 (57.80%), Postives = 170/218 (77.98%), Query Frame = 3
Query: 5211 VKE*LQNQFLTGVKKEIKKALCYVDFNDFDEFIKKAMKIELNLKSAQTKSESFAIVTETRERSKSPVRNNRVQQASNPSPKFRPKFESNKTIDIQNDGKESPIQCSYCQRPGHYVNQCWLKNRSQKSPIQIRCDHCQKM*HDSNQCWFKKNVKQSPKQMPSDWVXXXXXXXXXXXXXXDQQINVNSQYYIYGRKWHISRNCFAXXXXXXXXXXXQRDK 5864
            VKE LQ+Q LTGV+KEIKKALCYVDFN+FDE IKKAMKIELNLK+ Q K+ESF  + E+R RS SP++NN  Q++++PSP FR KFE  K+ +   + ++ P+QCS+CQ+ GH +NQCW +N +Q+SP  ++CDHCQ+  H ++Q WFK   ++SPK+M  DW+KG+G K F+K +TN+Q IN N QYY +G++ H+SRNC+ARSRSPST  S QRD+
Sbjct:  141 VKELLQDQLLTGVRKEIKKALCYVDFNNFDELIKKAMKIELNLKTTQPKAESFTTIDESRVRSISPIKNNLFQKSTSPSPNFRVKFEPRKSTNSPKEERDRPVQCSHCQKLGHNINQCWFRNNAQRSPSSVQCDHCQRKVHSNSQSWFKNEEQRSPKRMWPDWLKGDGGKRFSKMSTNNQLINDNIQYYNWGKRGHVSRNCYARSRSPSTSSSPQRDR 358          
BLAST of SMED30035897 vs. Planmine SMEST
Match: SMESG000047220.1 (SMESG000047220.1)

HSP 1 Score: 235.728 bits (600), Expect = 1.597e-64
Identity = 126/218 (57.80%), Postives = 170/218 (77.98%), Query Frame = 3
Query: 5211 VKE*LQNQFLTGVKKEIKKALCYVDFNDFDEFIKKAMKIELNLKSAQTKSESFAIVTETRERSKSPVRNNRVQQASNPSPKFRPKFESNKTIDIQNDGKESPIQCSYCQRPGHYVNQCWLKNRSQKSPIQIRCDHCQKM*HDSNQCWFKKNVKQSPKQMPSDWVXXXXXXXXXXXXXXDQQINVNSQYYIYGRKWHISRNCFAXXXXXXXXXXXQRDK 5864
            VKE LQ+Q LTGV+KEIKKALCYVDFN+FDE IKKAMKIELNLK+ Q K+ESF  + E+R RS SP++NN  Q++++PSP FR KFE  K+ +   + ++ P+QCS+CQ+ GH +NQCW +N +Q+SP  ++CDHCQ+  H ++Q WFK   ++SPK+M  DW+KG+G K F+K +TN+Q IN N QYY +G++ H+SRNC+ARSRSPST  S QRD+
Sbjct:  147 VKELLQDQLLTGVRKEIKKALCYVDFNNFDELIKKAMKIELNLKTTQPKAESFTTIDESRVRSISPIKNNLFQKSTSPSPNFRVKFEPRKSTNSPKEERDRPVQCSHCQKLGHNINQCWFRNNAQRSPSSVQCDHCQRKVHSNSQSWFKNEEQRSPKRMWPDWLKGDGGKRFSKMSTNNQLINDNIQYYNWGKRGHVSRNCYARSRSPSTSSSPQRDR 364          
The following BLAST results are available for this feature:
BLAST of SMED30035897 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035897 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035897 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035897 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035897 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035897 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035897 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035897 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035897 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035897 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035897 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035897 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035897 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035897 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000063550.15.888e-6690.48SMESG000063550.1[more]
SMESG000056661.18.568e-6550.21SMESG000056661.1[more]
SMESG000056661.11.087e-6450.21SMESG000056661.1[more]
SMESG000047220.11.299e-6457.80SMESG000047220.1[more]
SMESG000047220.11.597e-6457.80SMESG000047220.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035897 ID=SMED30035897|Name=SMED30035897|organism=Schmidtea mediterranea sexual|type=transcript|length=5944bp
TAAAAATAATAAATTTATATTTTATGTTCTTCTAAAATTTAATTAAATTA
AACTTAATTTAAAAAAATTAAATTAAAAATCCATCTGAAATCATAAATCG
CAAATTACTAAAATCGCAAATTATCCTGAAAAAACGCTACCTGGAAAGTA
AAATAAAAAGCACAGTCCCGAGATTTCGATAATCGAGTCTACTGTATTTA
AAATAATAACGTAGTTTTAAAAAAATATAAGGACTAATTGGTTTTCAAAT
ATTAAAATATAACGGAACGCTTTCAATTAAAAAAATTATAGAAAAATTTA
AAGGTATTAATAATTTTATAAATTTATTTTCATTATGACAATTGATCAAA
AAAGAATTTCGTTTCAATTTTGCAAAACGAAAATATGAAACGAATGGTTT
TAGTTTTCGTTATAAGTTTTTATAAGTTTTTCGTTTAAGTTTTTCGTATC
GGTATTTCGTCATGTAACGAAAAAAGAAAAATCTTTATGTAACGCTATTT
CGAAATAAAACTATTGATATGCAAAAAAATTAAAAATTTCGGAAACAAAA
AAATCATTTTTATTCAAATATTAATTACAAATATTAATGTAATATAAAAT
AAAAAATAATTCACCTAAAAATTTTGTAATAAAAAATTTTAAACAAAAAT
AAAATAACTTTTATGACAACATAGTTGACATTATATTTAAAGCATTTTTT
TTGTACGATGAAATTATTCATCTATTAATTTTATCAATGTTTAAATTGCT
TTGCATTTTGTTTATGTTTATTATTAAGTGACTAGTTTTTTCATTAGTAT
ATCTTATAATAAATCCTCATCTATATTCCTTTTATCAGTTAATATTTATT
TCGTTAAAATTCTTTCAACCAAAACATGTGTTGCAGGTGCAATTAAAGCA
ATTTTGAAAACTTTCCCAAATTTTTTATCTTTGTTATCCTAAATTCAATT
GCCGTCAATTTAAACTAATATTGTAAAAACAGATTTTGTAAAGAAACATA
ATTTTGCCAGAGATTCTACAGTTTTTGTCAATTTTAGAGATCCCATATAA
ACAAAGAAAATATAAAGACAATTTATAAAGATTTATGTTATTGCTAGTGC
AATAACACCAAGTCACATGACAATTGTGACAATGTTGAATTTATTAATTA
TTTTATGTTAAAGGCTATTGAAAATTTGTTATTGGTAATTAAAAAACAGG
TAATTTAAAAATTTCAGGGGCTGGAAAAAGTGAGTCAGAGATTACTCACT
AAACAAATCGATAAAATGGCTGACATTTAAAAGTTTTCTCACAAATGCTA
GTAGTGATATGAATGTATTAAGTCAGTCTAAATAACATGTAAATGGTTTA
CACAAATAAAACTATGTATGATATGTATATACAGACAAACTTTTCATTAT
CTTATCCATGAAGAATACACATAAAAATAATTTGCGCCTTTCTCAGTGTT
AAATAATATAATGGAAAATCAAAATTATCAGTCAATAAGATTTTTGACTC
AGCAACAAAATGGATATCCATGCAAAGAAATACAAAATCCTATAGAAGCA
ATATTGATTTATCCCATATATGAATAATGACTACTCATATTAGGGGCAAG
CGACGATAACAAAGCATTTGAAGATTCTTCAATGAGGTCCACTTGAATTC
TTAAAAGTTGAAATAATGTCCCGAGTTTTTAGCAGCAAGACATATTTTAA
TTCCAGCTTTGAGTGGGCATGATGAATGACCTGTAAAAGAATGAATTTGC
ACAAGTTGACAAAACCTTAAATAGGATTCCTTCTCGTGAATAAATTATAT
TTCTTGGATATATTCATTTTTATCGTGCTTTATATGTAGTACCAATTCAT
TTTTCTAGTGGTATTTATAAATTAACCAATTATCTACAATTTGCGAAGTT
TATTAAAACATGTATTATATCGTCAGGTAGATTCTAAACTCCTTTATTCA
TAATAATTTTATTTATCCTGTCATAACAAACTTTTATCACTAGGCAAAAT
ACAATTTTTAGTTTCTTGATGATCATCGGCAATAATCAACAATGTTGAGA
GTTGTTACCATATACACTTTCACACGAGAAGCACTTGTCTGTCAAATCCA
AGGCTATGGCTTTAAGCGATAAAAATTAAAAGTTCAAAGTAGCGCAGTTG
AGCTGGAAATAGAAAATATGTGTAAATGCCATATCGATAATGTTAACCGA
TTTGAAGGAGTGGTGACTTACTGACAAATAGACATCAATTTATATTTTTT
ATTTTACCTATATAAATCAGCTTTAGAATAAGTTCAACTTGATAAACCCC
AATAAACGCGAAAAACTTTGCTCGGTGTCAGTACCATTCAGAGCTATTAC
TCTGTGTAAAGCGTCAATAGCCTCATTTGACATAAATTGCTTCCTTATTA
AAAATTCAAAGAGATAATCTGTGGGGGGTAATGTAAGATATCTTATTTGA
GTTTCCCAAACATTTCCATAGTAAAAGTGACAGTGGAGCGTGAAGAAACA
AACTAAATCCTGGGTTCGAATGACTGGTTTCACTTTCTTTTAAATCATTG
AATAATATTCAGCATTGCTAGTTGTTTTTATTGAGAAAATCAAGTTAAGG
AATTCTTTTTGAATCACAAAACTGGCTGATTTGACTCCTTGGTAGTGGTG
AATTTAAATATTGCCATTGCCGATTGCTTCTTTTACCTCTGAAGTTTTTC
TCAGCGCTGCAAAAGTTGTGTGACTTTTTCCAATAATTCTCTATATTCAG
GTATCAAAAGATCTTGCTAAATTAAGGAATATTTTTTAATTTTTTTCTAA
ACTACCAAAAAAACTTTAATTATAACACTTAAATTATATATAAAATTAAA
TGAAATTAAGCCTTTTGAACTCCAAGGGTTTGTAAACCGGCGTGATTTAG
CAACACATCTTAATGGCCGGAGATAAATTGATACTTGTTGCTTTTACTTA
TATTGCTTTTATAGTATTATTAAATATTCACTTGTTATACTGATATTTTT
TTTATAAGCAATAAATTATTTTTACCTTTGTCGAGGTTTGACTAAAAAGG
CACGAAATGAAAACAATCACAAAAACTAATTGCAAATCAATAAAACATCG
AAATTCAAAATTAATTAAAAAATCAAAAATTTTTAAAATAAATATTTTTT
GAGTAAAACTGGTATAGGCGTATTCAAAATGATGAGACGCGTTCGCAAAT
AATAAAATCAAATCATAAAAAATATTTAAAGATTAAAATTAATAAAAGGT
TGATTATCTAATGAAAAACCCGAGCAGTGTTTGAAACCTGAGTTGTCAAC
AAAATTATTAAATTAGACCTGGGAATTGAGAAACCCGAGATAAAAGAAAA
CCCGGCGGTAATTGAAAATGACAAAATTACCATGAGACATTTAAATTTAA
ATACGAAAGCTCAATTTGGTAATAAATTAGCTCCTAAAAGAAACCCGAGG
AAGTAAACAAAAATTAATTATACAATAATTAATTTGAGGAAATCTCAATT
CAATATAGAAAATATAATATAAAAAAGATACAACCTAGTCAGATAGCCAG
TTGGTTGAAGAGAGTTAAAATTTACGAAGGTAAGATTTAAGAAGTTAATC
TGGTGGAAGTCTAGTATTTTGAAATTAAGTAGTTAATAGTCAAGTAGTTA
TTTATTGAGAATACTGTTGGATGTTTTTGCTCTTGAAATTTGTAAAGCCC
GATTGTCTCCTTTAAAAATTGACGGGAAAAACGAGGTGAATATTATGTAT
TGTGCTTTGATAAATCAAAAATAGATTTAGAATAATTTAACAAATACTTG
AACTACAAAAATGTATTAACAACGATATATAACTTGAATTTTTGTTGCTG
TTTGGTTAGTTCAGAAAATATGGGATTTTCGTTAATCTTTTACAAAATTG
GGCTGTTATTTCTTTTAGTTCTAGATCAATTGTCCTATTATTATTTTTGG
TTTAATTTTTTTTCTTGAATAATTTTTTGTCGATTTGGTCTTTTTGATTA
TTTTTCGATTTTATTTCTTCGCCATTGCAAGTTATTTAATTTCTGTTCTC
TTGTGAGATTTTATCCTTTCTGTTCAAAATTCTGCTGACTTATTTAGAAA
ATTGGAAAATCTTTTCAAACTTCTGTTGTTTATTATTATTTCATTTCAAT
TTTTAAATAATTTTATAACAAATTGAATTTTTTTAAACTTAAGTTGACAT
AATAAATAAGACACATGTAACAAAAAAATCAGTCAAACATAGACAAATTA
CGTCATTAAACAGAAGTTGAACCATTAGACCGACGAATAAAGATTAAAGT
GTTATTGGAATTGTAATGATTTCACGTATTATGGAAAATGTATAGTGTTA
GTTATTGTGATTTTAAATATACGTAATTGTGTTGGGTTGTTCGATTTATT
TAAAACAGGACACTGATGGAGTCAGAGTTAGTATCGATTTGTAATAAATA
CCCGACATATTTGATGGATGAGTCCGGCGAGATCAAAAGTTGTGATCAAA
ATTTTGAAGTGAATATTTGAGTTAAAAATTGGTGCAAATTATGTAATTGA
TTAAAAGTTGATTTAGTAAGTGTAAAATATTATAAAATTAATTAAGTGAT
GAGAAATGATAAAATTGGTGATGTATTTAAAGGAGAATTATGAAATATTG
AGGTAAATTGAAATATAATTATGAAAATTGATTATTTAAATTTGAAAAGT
CAAGATTATAACGAAAGGTAAATTTTATAATTGTAATACTTTAAAATTTA
GACAAATAAAACTTGACCAGATCAATTTTTATAAATTAAGAAAACAGAAA
CAAGTGGAAATTAAAATGAGTGCTCCAGAAAACAACGAGCAATACTGGAA
ATAATGATAAAACACTCGTGTCCACAGTTATCCTGAGAAATGGCATAAAA
CGACTATGCGAATAGCCAAAATACCAGTAAATCAATTCGGAGGAGATTCG
GTGGAACTTGTCGACTTCATTGCGGATTACTACATGTATACTACAATCTA
CAAAGAGAAGAGTGGCAAAAGAACAATAGCTATTAACTGGATGCGTTAGC
CACGAAATTGATTGGGGTGATATCAAAACATTAACGTGACAAAAGTTCTA
CAATAGAGTACAGTATTCAGATGAATCCGTAAGTGAATTTGCTTACCATT
CAACTGTTGCAGAAAATGCTTTTGAAGTGAAACCAGACCAAGCTGATGTT
GCTAAAGCAGGTAAAGGAGTAGTTACAGAATCAATTCTTGACAGGAGTTA
AAAAGGAAATTAAAAAGGCTTTATGTTATGTAGATTTTAATGACTTTGAT
GAGTTTATTAAGAAAGCAATGAAAATTGAGCTGAATTTGAAAAGCGCACA
GACCAAGTCAGAATCGTTTGCAATAGTCACTGAAACCAGAGAGAGATCAA
AAAGTCCAGTTAGAAATAATCGGGTCCAACAAGCAAGTAATCCATCACCA
AAGTTCAGGCCAAAGTTTGAATCAAATAAGACAATAGATATTCAGAATGA
CGGAAAAGAAAGTCCAATTCAATGCAGTTATTGTCAGAGGCCGGGGCACT
ACGTTAATCAATGTTGGCTCAAAAATAGATCTCAAAAGAGCCCAATTCAA
ATCCGGTGCGATCATTGCCAAAAGATGTGACATGATAGTAATCAATGCTG
GTTCAAGAAGAATGTAAAGCAAAGTCCAAAACAAATGCCATCAGATTGGG
TGAAGGGTAATGGTGAGAAAAATTTTAATAAAAAAAACACAAATGATCAG
CAAATTAATGTTAACTCTCAATACTATATTTACGGCAGAAAATGGCATAT
CTCACGAAATTGTTTTGCCAGATCAAGATCTCCATCAACATAACCTTCAT
CACAGAGAGATAAATTAAATCTTCAAGGTCAAATTCAGTGTCACTAATGC
AGAGGTTATGGACATATCGCCTGATCATGCCCAAAGAATGTAAA
back to top

protein sequence of SMED30035897-orf-1

>SMED30035897-orf-1 ID=SMED30035897-orf-1|Name=SMED30035897-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=104bp
MKIELNLKSAQTKSESFAIVTETRERSKSPVRNNRVQQASNPSPKFRPKF
ESNKTIDIQNDGKESPIQCSYCQRPGHYVNQCWLKNRSQKSPIQIRCDHC
QKM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR001878Znf_CCHC
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0008270zinc ion binding