Guanine nucleotide-binding protein G(i) subunit alpha

Overview
NameGuanine nucleotide-binding protein G(i) subunit alpha
Smed IDSMED30035889
Length (bp)1193
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Guanine nucleotide-binding protein G(i) subunit alpha (SMED30035889) t-SNE clustered cells

Violin plots show distribution of expression levels for Guanine nucleotide-binding protein G(i) subunit alpha (SMED30035889) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Guanine nucleotide-binding protein G(i) subunit alpha (SMED30035889) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Guanine nucleotide-binding protein G(i) subunit alpha (SMED30035889) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035889

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30035889SMESG000081983.1 SMESG000023274.1 dd_Smed_v4_5082_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035889SMESG000081983.1 SMESG000023274.1 dd_Smed_v4_5082_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30035889SMESG000079991.1 SMESG000081983.1 OX_Smed_1.0.12272ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Human
Match: GNAI3 (G protein subunit alpha i3 [Source:HGNC Symbol;Acc:HGNC:4387])

HSP 1 Score: 446.432 bits (1147), Expect = 1.334e-156
Identity = 206/348 (59.20%), Postives = 271/348 (77.87%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKE-KIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            MGC  S E +A   +SK ID+ +  D ++ +  +K+LLLGAGESGKSTIVKQMKII+ +GY++DEC QYK +V+SNT+QS+ AIIRAMG+LKIDF      +DAR+LF L  + EE V++ ++   ++RLW D GV  CF+RSREYQLNDSA Y+LN + R+S  +YIPT+QDVL TRVKTTGIVET  TFK L  K+ DVGGQRSER+KWIHCFEGV  +I+  ++S+YD  L ED E+NRM ES+KLFDS+CNN+WF++ SIILFLNK DLF+ KI +SPLT+C+PEY G+N +E+A+ Y++  FE LN++K+ K IY+HFTCATDT N+ +VF+ +TD II  N+
Sbjct:    1 MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMTPELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQSNYIPTQQDVLRTRVKTTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAAAYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNL 348          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Human
Match: GNAI1 (G protein subunit alpha i1 [Source:HGNC Symbol;Acc:HGNC:4384])

HSP 1 Score: 446.432 bits (1147), Expect = 1.504e-156
Identity = 206/348 (59.20%), Postives = 268/348 (77.01%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKE-KIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            MGC  S E +A   +SK ID+ +  D ++ +  +K+LLLGAGESGKSTIVKQMKII+  GY+++EC QYK +V+SNT+QS+ AIIRAMG+LKIDF      +DAR+LF L    EE  ++ ++   ++RLW D GV  CF RSREYQLNDSA Y+LN + R++ P+YIPT+QDVL TRVKTTGIVET  TFK L+ K+ DVGGQRSER+KWIHCFEGV  +I+  ++S+YD  L ED E+NRM ES+KLFDS+CNN+WF+  SIILFLNK DLF+ KI KSPLT+C+PEY G+N +E+A+ Y++  FE LNK+K+ K IY+HFTCATDT N+ +VF+ +TD II  N+
Sbjct:    1 MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNL 348          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Human
Match: GNAI1 (G protein subunit alpha i1 [Source:HGNC Symbol;Acc:HGNC:4384])

HSP 1 Score: 446.432 bits (1147), Expect = 1.504e-156
Identity = 206/348 (59.20%), Postives = 268/348 (77.01%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKE-KIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            MGC  S E +A   +SK ID+ +  D ++ +  +K+LLLGAGESGKSTIVKQMKII+  GY+++EC QYK +V+SNT+QS+ AIIRAMG+LKIDF      +DAR+LF L    EE  ++ ++   ++RLW D GV  CF RSREYQLNDSA Y+LN + R++ P+YIPT+QDVL TRVKTTGIVET  TFK L+ K+ DVGGQRSER+KWIHCFEGV  +I+  ++S+YD  L ED E+NRM ES+KLFDS+CNN+WF+  SIILFLNK DLF+ KI KSPLT+C+PEY G+N +E+A+ Y++  FE LNK+K+ K IY+HFTCATDT N+ +VF+ +TD II  N+
Sbjct:    1 MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNL 348          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Human
Match: GNAI1 (G protein subunit alpha i1 [Source:HGNC Symbol;Acc:HGNC:4384])

HSP 1 Score: 446.432 bits (1147), Expect = 1.504e-156
Identity = 206/348 (59.20%), Postives = 268/348 (77.01%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKE-KIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            MGC  S E +A   +SK ID+ +  D ++ +  +K+LLLGAGESGKSTIVKQMKII+  GY+++EC QYK +V+SNT+QS+ AIIRAMG+LKIDF      +DAR+LF L    EE  ++ ++   ++RLW D GV  CF RSREYQLNDSA Y+LN + R++ P+YIPT+QDVL TRVKTTGIVET  TFK L+ K+ DVGGQRSER+KWIHCFEGV  +I+  ++S+YD  L ED E+NRM ES+KLFDS+CNN+WF+  SIILFLNK DLF+ KI KSPLT+C+PEY G+N +E+A+ Y++  FE LNK+K+ K IY+HFTCATDT N+ +VF+ +TD II  N+
Sbjct:    1 MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNL 348          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Human
Match: GNAI1 (G protein subunit alpha i1 [Source:HGNC Symbol;Acc:HGNC:4384])

HSP 1 Score: 446.432 bits (1147), Expect = 1.504e-156
Identity = 206/348 (59.20%), Postives = 268/348 (77.01%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKE-KIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            MGC  S E +A   +SK ID+ +  D ++ +  +K+LLLGAGESGKSTIVKQMKII+  GY+++EC QYK +V+SNT+QS+ AIIRAMG+LKIDF      +DAR+LF L    EE  ++ ++   ++RLW D GV  CF RSREYQLNDSA Y+LN + R++ P+YIPT+QDVL TRVKTTGIVET  TFK L+ K+ DVGGQRSER+KWIHCFEGV  +I+  ++S+YD  L ED E+NRM ES+KLFDS+CNN+WF+  SIILFLNK DLF+ KI KSPLT+C+PEY G+N +E+A+ Y++  FE LNK+K+ K IY+HFTCATDT N+ +VF+ +TD II  N+
Sbjct:    1 MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNL 348          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Celegans
Match: goa-1 (Guanine nucleotide-binding protein G(o) subunit alpha [Source:UniProtKB/Swiss-Prot;Acc:P51875])

HSP 1 Score: 410.994 bits (1055), Expect = 6.072e-143
Identity = 197/350 (56.29%), Postives = 252/350 (72.00%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEA-VLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKEKIIYSHFTCATDTSNINYVFNVITDSIIVKNINA 1120
            MGC  S E RA   +S+ I+K +  D  + +  IK+LLLGAGESGKSTIVKQMKII+ +G+T ++  QYKP+V+SNT+QSL AI+RAM  L + F S +   DA+ +  +   +E+    SE++ ++M+RLW D GV  CF+RS EYQLNDSA+YFL+ + RL    Y PTEQD+L TRVKTTGIVE   TFK LN K+ DVGGQRSER+KWIHCFE V  +I+  ++SEYDQ L ED   NRM ES+KLFDS+CNN+WF+  SIILFLNK DLF+ KI KSPLT+CFPEY G  ++ +AS Y++  FE  NK   K IY H TCATDT+NI +VF+ +TD II  N+  
Sbjct:    1 MGCTMSQEERAALERSRMIEKNLKEDGMQAAKDIKLLLLGAGESGKSTIVKQMKIIHESGFTAEDYKQYKPVVYSNTVQSLVAILRAMSNLGVSFGSADREVDAKLVMDVVARMEDTEPFSEELLSSMKRLWGDAGVQDCFSRSNEYQLNDSAKYFLDDLERLGEAIYQPTEQDILRTRVKTTGIVEVHFTFKNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMHESLKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICFPEYSGRQDYHEASAYIQAQFEAKNKSANKEIYCHMTCATDTTNIQFVFDAVTDVIIANNLRG 350          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Celegans
Match: gpa-16 (Guanine nucleotide-binding protein alpha-16 subunit [Source:UniProtKB/Swiss-Prot;Acc:Q9N2V6])

HSP 1 Score: 394.045 bits (1011), Expect = 2.715e-136
Identity = 191/351 (54.42%), Postives = 252/351 (71.79%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKK----KEKIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            MGCI S E  A + +SK+ID+L+  D +    TIK+LLLGAGESGKSTI+KQM+II++ GYT +E   ++ +V+ N + SL AII AM QLKI F +L+   DARKL       EE  L E++   M+ +W+D G+     RSREYQLNDSA Y+L+ + R+  P+YIPT+ D+L TR+KTTGIVET   +K     + DVGGQRSER+KWIHCFE V  +I+  ++SEYD  L+ED + NRM ES+KLFDS+CNN+WF + SIILFLNK DLF+ KIV+SPLT CFPEY G NN+E+AS Y++  FE +NK+    K + IY+ FTCATDT+NI +VF+ +TD II  N+
Sbjct:    1 MGCIMSQEDEAAKRRSKKIDRLLKEDGENSMRTIKLLLLGAGESGKSTILKQMRIIHDVGYTTEERKVFRGVVYGNIILSLNAIIHAMEQLKISFTTLDHESDARKLLMFSTTGEEDELPEELVVLMKSVWSDSGIQKALERSREYQLNDSAGYYLSQLDRICAPNYIPTQDDILRTRIKTTGIVETQFVYKDRLFLVFDVGGQRSERKKWIHCFEDVTALIFCVALSEYDMVLVEDCQTNRMRESLKLFDSICNNKWFVETSIILFLNKKDLFEEKIVRSPLTHCFPEYTGANNYEEASAYIQQQFEDMNKRTTGEKNQEIYTQFTCATDTNNIRFVFDAVTDIIIRDNL 351          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Celegans
Match: gpa-7 (Guanine nucleotide-binding protein alpha-7 subunit [Source:UniProtKB/Swiss-Prot;Acc:Q21917])

HSP 1 Score: 379.407 bits (973), Expect = 1.614e-130
Identity = 176/350 (50.29%), Postives = 254/350 (72.57%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFS-LGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKEKIIYSHFTCATDTSNINYVFNVITDSIIVKNINA 1120
            MG   S + +  +  ++ ID+ I +D       IK+LLLGAGESGKSTI+KQM+I++ +G+++ +    +P+V+SN + S+ +I+RAM  L+I++   + + D++ +F+ +  N EE  L+E++ AAMQRLW+D GV  C+ RS EYQ++DSA+YFL+++ RLS+P+Y+P+EQD+L TR+KTTGI E L   KGL  +++DVGGQRSER+KWIHCF+ V  +I+++S+SEYDQ L EDN  NRM ES+KLFDS+CN+ WF+    ILFLNK DLF  KIV+SPLTVCFPEYKG  N  +   Y++  FE LN+  ++ IY H TCATDT+N+ +V +   D II KN+ +
Sbjct:    1 MGHCTSKDQKEGKRLNRRIDEQIKKDQSMSLRIIKLLLLGAGESGKSTILKQMRILHKDGFSQQDLEMIRPVVYSNCIHSMLSILRAMFHLQIEYGEPDRVRDSQLVFATVHANKEE--LTEELAAAMQRLWHDPGVRECYRRSNEYQIDDSAKYFLDNLPRLSSPNYVPSEQDLLRTRIKTTGITEVLFELKGLTFRVIDVGGQRSERKKWIHCFDNVNAIIFISSLSEYDQTLREDNCTNRMQESLKLFDSICNSPWFADIHFILFLNKKDLFAEKIVRSPLTVCFPEYKGQQNQTECINYIQWKFEQLNRSSQREIYCHHTCATDTNNVQFVLDACLDMIIAKNLKS 348          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Celegans
Match: gpa-4 (Guanine nucleotide-binding protein alpha-4 subunit [Source:UniProtKB/Swiss-Prot;Acc:Q9BIG5])

HSP 1 Score: 366.696 bits (940), Expect = 1.673e-125
Identity = 180/354 (50.85%), Postives = 247/354 (69.77%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSE----DIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKK---EKIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            MGC  S    A + +SK ID+ +  D +R    IK+LLLGAGESGKSTIV+QM+I++  G+ K E + Y+P+VFSN +QS+ AI++AM  L I F      EDAR   S   ++  A LSE    ++   M++LW D+GV  C  R+ EYQLNDSAEY+ N++ R+S+  Y+PT+ D+L  RVK+TGIVET   +K L  K+ DVGGQRSER+KWIHCF+ V  +I+  ++SEYD  L ED  +NRM ES++LFDS+ NN WF++ SIILFLNK D+F+ +I  +PLTVCFPEY+G     + S +++  FE+LNK++   +K IYSHFTCATDT+NI +VF+ +TD II  N+
Sbjct:    1 MGCFHSTGSEAKK-RSKLIDEQLRHDHERCVGEIKLLLLGAGESGKSTIVRQMRILHETGFNKQEQMAYRPVVFSNMVQSMLAILKAMQPLNISFTDAAREEDARMFISHFLHVNNAELSEAFSLELSDLMKQLWMDEGVKKCVKRAHEYQLNDSAEYYFNALDRISSSSYLPTQDDILRARVKSTGIVETTFMYKDLCFKMFDVGGQRSERKKWIHCFDSVTAVIFCVALSEYDLRLAEDQTMNRMHESMQLFDSIVNNCWFTETSIILFLNKMDIFEERIRYTPLTVCFPEYQGGMTITETSTFIQSRFEILNKRQTPAQKEIYSHFTCATDTNNIRFVFDAVTDIIIRNNL 353          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Celegans
Match: gpa-3 (Guanine nucleotide-binding protein alpha-3 subunit [Source:UniProtKB/Swiss-Prot;Acc:P28052])

HSP 1 Score: 331.643 bits (849), Expect = 8.486e-112
Identity = 159/350 (45.43%), Postives = 232/350 (66.29%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEA-VLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKEKIIYSHFTCATDTSNINYVFNVITDSIIVKNINA 1120
            MG   S E +    KSK IDK + ++   +   +K+LLLGAGE GKST++KQM+I++++G+T +E  Q K +VF+NTLQ++TAI++ M  L++ F       DA+ +    K ++EA V  E++  A+Q LWND  V     +  E+Q+ +SA +FL+S+ R+  PDY PTEQD+L +R+KTTGIVE     K ++ ++ DVGGQRSER+KWIHCFE V  +I++A+ISEYDQ L ED   NRM ES++LF+S+CN++WF   S+ILFLNK DLF  KI ++ +   FP+YKG   ++++  Y+   F+ LN   EK IY H TCATDT  +  + + + D II  N+  
Sbjct:    1 MGLCQSAEDKELTLKSKAIDKEMMQNHMSQQKVVKLLLLGAGECGKSTVLKQMRILHDHGFTAEEAEQQKSVVFNNTLQAMTAILKGMEALRMTFDKPIRENDAKFVMESHKMLQEAKVFPEELANAIQALWNDKAVQQVIAKGNEFQMPESAPHFLSSLDRIKLPDYNPTEQDILLSRIKTTGIVEVKFQMKSVDFRVFDVGGQRSERKKWIHCFEDVNAIIFIAAISEYDQVLFEDETTNRMIESMRLFESICNSRWFINTSMILFLNKKDLFAEKIKRTSIKSAFPDYKGAQTYDESCRYIEEKFDGLNANPEKTIYMHQTCATDTDQVQMILDSVIDMIIQANLQG 350          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Fly
Match: Galphai (gene:FBgn0001104 transcript:FBtr0076934)

HSP 1 Score: 424.476 bits (1090), Expect = 3.950e-148
Identity = 202/350 (57.71%), Postives = 265/350 (75.71%), Query Frame = 2
Query:   74 MGCIPSNEVRANE--NKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKK-EKIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            MGC  S   R  E   +SK ID+ +  + +R +S +K+LLLGAGESGKSTIVKQMKII++ GY+++EC +Y+ +VFSNT+QSL  IIRAMG+LKI+FA     + AR+ F+     +E +L  +I   M++LW D GV   F RSREYQLNDSA Y+LNS+ R++ P+YIPT+QDVL TRVKTTGI+ET  + K L+ K+ DVGGQRSER+KWIHCFEGV  +I+  ++S YD  L ED E+NRM ES+KLFDS+CN++WF + SIILFLNK DLF+ KI +SPLT+CFPEY G N FE+A+ Y+RM FE LNK+K +K IY+H TCATDT+N+ +VF+ +TD II  N+
Sbjct:    1 MGCAVST-ARDKEAIERSKNIDRALRAEGERAASEVKLLLLGAGESGKSTIVKQMKIIHDTGYSQEECEEYRRVVFSNTVQSLMVIIRAMGRLKIEFADPSRTDIARQFFTHASAADEGILLPEIVLLMKKLWADGGVQQSFARSREYQLNDSAGYYLNSLDRIAQPNYIPTQQDVLRTRVKTTGIIETHFSCKQLHFKLFDVGGQRSERKKWIHCFEGVTAIIFCVALSGYDLVLAEDEEMNRMIESLKLFDSICNSKWFVETSIILFLNKKDLFEEKIKRSPLTICFPEYTGTNTFEEAANYIRMKFENLNKRKDQKEIYTHLTCATDTNNVKFVFDAVTDVIIKNNL 349          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Fly
Match: Galphao (gene:FBgn0001122 transcript:FBtr0088267)

HSP 1 Score: 414.075 bits (1063), Expect = 3.958e-144
Identity = 198/350 (56.57%), Postives = 255/350 (72.86%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEA-VLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKEKIIYSHFTCATDTSNINYVFNVITDSIIVKNINA 1120
            MGC  S E RA   +SK+I+K +  D  + +  IK+LLLGAGESGKSTIVKQMKII+ +G+T ++  QY+P+V+SNT+QSL AI+RAM  L I +++ E   DA+ +F + + + +    SE++ AAM+RLW D GV  CF+RS EYQLNDSA+YFL+ + RL   DY PTEQD+L TRVKTTGIVE   +FK LN K+ DVGGQRSER+KWIHCFE V  +I+  ++SEYDQ L ED   NRM ES+KLFDS+CNN+WF+  SIILFLNK DLF+ KI KSPLT+CFPEY G   + +A+ Y++  FE  NK   K IY H TCATDT+NI +VF+ +TD II  N+  
Sbjct:    1 MGCTTSAEERAAIQRSKQIEKNLKEDGIQAAKDIKLLLLGAGESGKSTIVKQMKIIHESGFTAEDFKQYRPVVYSNTIQSLVAILRAMPTLSIQYSNNERESDAKMVFDVCQRMHDTEPFSEELLAAMKRLWQDAGVQECFSRSNEYQLNDSAKYFLDDLDRLGAKDYQPTEQDILRTRVKTTGIVEVHFSFKNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTDTSIILFLNKKDLFEEKIRKSPLTICFPEYTGGQEYGEAAAYIQAQFEAKNKSTSKEIYCHMTCATDTNNIQFVFDAVTDVIIANNLRG 350          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Fly
Match: Galphao (gene:FBgn0001122 transcript:FBtr0088269)

HSP 1 Score: 414.075 bits (1063), Expect = 3.958e-144
Identity = 198/350 (56.57%), Postives = 255/350 (72.86%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEA-VLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKEKIIYSHFTCATDTSNINYVFNVITDSIIVKNINA 1120
            MGC  S E RA   +SK+I+K +  D  + +  IK+LLLGAGESGKSTIVKQMKII+ +G+T ++  QY+P+V+SNT+QSL AI+RAM  L I +++ E   DA+ +F + + + +    SE++ AAM+RLW D GV  CF+RS EYQLNDSA+YFL+ + RL   DY PTEQD+L TRVKTTGIVE   +FK LN K+ DVGGQRSER+KWIHCFE V  +I+  ++SEYDQ L ED   NRM ES+KLFDS+CNN+WF+  SIILFLNK DLF+ KI KSPLT+CFPEY G   + +A+ Y++  FE  NK   K IY H TCATDT+NI +VF+ +TD II  N+  
Sbjct:    1 MGCTTSAEERAAIQRSKQIEKNLKEDGIQAAKDIKLLLLGAGESGKSTIVKQMKIIHESGFTAEDFKQYRPVVYSNTIQSLVAILRAMPTLSIQYSNNERESDAKMVFDVCQRMHDTEPFSEELLAAMKRLWQDAGVQECFSRSNEYQLNDSAKYFLDDLDRLGAKDYQPTEQDILRTRVKTTGIVEVHFSFKNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTDTSIILFLNKKDLFEEKIRKSPLTICFPEYTGGQEYGEAAAYIQAQFEAKNKSTSKEIYCHMTCATDTNNIQFVFDAVTDVIIANNLRG 350          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Fly
Match: Galphao (gene:FBgn0001122 transcript:FBtr0088264)

HSP 1 Score: 414.075 bits (1063), Expect = 3.958e-144
Identity = 198/350 (56.57%), Postives = 255/350 (72.86%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEA-VLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKEKIIYSHFTCATDTSNINYVFNVITDSIIVKNINA 1120
            MGC  S E RA   +SK+I+K +  D  + +  IK+LLLGAGESGKSTIVKQMKII+ +G+T ++  QY+P+V+SNT+QSL AI+RAM  L I +++ E   DA+ +F + + + +    SE++ AAM+RLW D GV  CF+RS EYQLNDSA+YFL+ + RL   DY PTEQD+L TRVKTTGIVE   +FK LN K+ DVGGQRSER+KWIHCFE V  +I+  ++SEYDQ L ED   NRM ES+KLFDS+CNN+WF+  SIILFLNK DLF+ KI KSPLT+CFPEY G   + +A+ Y++  FE  NK   K IY H TCATDT+NI +VF+ +TD II  N+  
Sbjct:    1 MGCTTSAEERAAIQRSKQIEKNLKEDGIQAAKDIKLLLLGAGESGKSTIVKQMKIIHESGFTAEDFKQYRPVVYSNTIQSLVAILRAMPTLSIQYSNNERESDAKMVFDVCQRMHDTEPFSEELLAAMKRLWQDAGVQECFSRSNEYQLNDSAKYFLDDLDRLGAKDYQPTEQDILRTRVKTTGIVEVHFSFKNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTDTSIILFLNKKDLFEEKIRKSPLTICFPEYTGGQEYGEAAAYIQAQFEAKNKSTSKEIYCHMTCATDTNNIQFVFDAVTDVIIANNLRG 350          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Fly
Match: Galphao (gene:FBgn0001122 transcript:FBtr0088268)

HSP 1 Score: 414.075 bits (1063), Expect = 3.958e-144
Identity = 198/350 (56.57%), Postives = 255/350 (72.86%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEA-VLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKEKIIYSHFTCATDTSNINYVFNVITDSIIVKNINA 1120
            MGC  S E RA   +SK+I+K +  D  + +  IK+LLLGAGESGKSTIVKQMKII+ +G+T ++  QY+P+V+SNT+QSL AI+RAM  L I +++ E   DA+ +F + + + +    SE++ AAM+RLW D GV  CF+RS EYQLNDSA+YFL+ + RL   DY PTEQD+L TRVKTTGIVE   +FK LN K+ DVGGQRSER+KWIHCFE V  +I+  ++SEYDQ L ED   NRM ES+KLFDS+CNN+WF+  SIILFLNK DLF+ KI KSPLT+CFPEY G   + +A+ Y++  FE  NK   K IY H TCATDT+NI +VF+ +TD II  N+  
Sbjct:    1 MGCTTSAEERAAIQRSKQIEKNLKEDGIQAAKDIKLLLLGAGESGKSTIVKQMKIIHESGFTAEDFKQYRPVVYSNTIQSLVAILRAMPTLSIQYSNNERESDAKMVFDVCQRMHDTEPFSEELLAAMKRLWQDAGVQECFSRSNEYQLNDSAKYFLDDLDRLGAKDYQPTEQDILRTRVKTTGIVEVHFSFKNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTDTSIILFLNKKDLFEEKIRKSPLTICFPEYTGGQEYGEAAAYIQAQFEAKNKSTSKEIYCHMTCATDTNNIQFVFDAVTDVIIANNLRG 350          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Zebrafish
Match: gnai3 (guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3 [Source:ZFIN;Acc:ZDB-GENE-070713-6])

HSP 1 Score: 449.129 bits (1154), Expect = 9.031e-158
Identity = 210/348 (60.34%), Postives = 267/348 (76.72%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKE-KIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            MGC  S E +A   KSK ID+ +  D ++ S  +K+LLLGAGESGKSTIVKQMKII+ +GY++DEC QYK +V+SNT+QS+ AIIRAMG+LKIDF      +DAR+LF L    EE V++ D+   ++RLW D+GV +CF RSREYQLNDSA Y+LN + R+S P Y PT+QDVL TRVKTTGIVET  TFK L  K+ DVGGQRSER+KWIHCFEGV  +I+  ++S+YD  L ED E+NRM ES+KLFDS+CNN+WF+  S+ILFLNK DLF+ KI KSPLT+C+PEY G   +E+A+ Y++  FE LNK+KE K IY+HFTCATDT N+ +VF+ +TD II  N+
Sbjct:    1 MGCTLSTEDKAAMEKSKMIDRTLREDGEKASREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGDPARADDARQLFVLAGTAEEGVMTADLSGVIRRLWKDEGVQMCFVRSREYQLNDSAAYYLNDLERISQPTYTPTQQDVLRTRVKTTGIVETHFTFKELYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSVILFLNKKDLFEDKIKKSPLTICYPEYCGTCTYEEAAAYIQCQFEDLNKRKETKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNL 348          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Zebrafish
Match: gnai2b (guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5861])

HSP 1 Score: 444.891 bits (1143), Expect = 4.525e-156
Identity = 206/349 (59.03%), Postives = 270/349 (77.36%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEE-AVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKE-KIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            MGC  S E +A   +SK IDK +  D ++ +  +K+LLLGAGESGKSTIVKQMKII+ +GY++DEC QY+ +V+SNT+QS+ AII+AM  LKID+     ++DAR+LF+L    EE  +L++D+   ++RLW D GV  CF+RSREYQLNDSA Y+LN + R++  DYIPT+QDVL TRVKTTGIVET  TFK L+ K+ DVGGQRSER+KWIHCFEGV  +I+  ++S YD  L ED E+NRM ES+KLFDS+CNN+WF++ SIILFLNK DLF+ KI +SPLT+CFPEY G N +++A+ Y++  FE LNKKK+ K IY+HFTCATDT N+ +VF+ +TD II  N+
Sbjct:    1 MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYRAVVYSNTIQSIMAIIKAMSNLKIDYGESARVDDARQLFALSAAAEEQGILTDDLANVIRRLWADSGVQGCFSRSREYQLNDSAAYYLNDLDRIARSDYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKITRSPLTICFPEYSGANKYDEAASYIQTKFEDLNKKKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNL 349          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Zebrafish
Match: gnai1 (guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1310])

HSP 1 Score: 442.58 bits (1137), Expect = 3.927e-155
Identity = 205/348 (58.91%), Postives = 267/348 (76.72%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKE-KIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            MGC  S E +A   +SK ID+ +  D ++ +  +K+LLLGAGESGKSTIVKQMKII+  GY+++EC QYK +V+SNT+QS+ AIIRAMG+LKIDF      +DAR+LF L  + EE  ++ ++   ++RLW D GV  CF+RSREYQLNDSA Y+LN + R+S   YIPT+QDVL TRVKTTGIVET  TFK L+ K+ DVGGQRSER+KWIHCFEGV  +I+  ++S+YD  L ED E+NRM ES+KLFDS+CNN+WF+  SIILFLNK DLF+ KI KS LT+C+PEY G+N +E+A+ Y++  FE LNK+K+ K IY+HFTCATDT N+ +VF+ +TD II  N+
Sbjct:    1 MGCTLSTEDKAAVERSKMIDRNLRDDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDAARADDARQLFVLAGSAEEGFMTAELAGVIKRLWKDGGVQACFSRSREYQLNDSAAYYLNDLDRISQATYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIRKSTLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNL 348          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Zebrafish
Match: gnaia (guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide a [Source:ZFIN;Acc:ZDB-GENE-030131-2229])

HSP 1 Score: 442.58 bits (1137), Expect = 8.320e-155
Identity = 203/348 (58.33%), Postives = 275/348 (79.02%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKE-KIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            MGC  S++ ++ + +SK ID+ +  D ++ S  +K+LLLGAGESGKSTIVKQMKII+  GY+++EC QY+ +V+SNT+QS+ AIIRAMG+L+IDFA  E  +DAR+LF +  +++E  ++ ++   ++RLW D+GV +CF RSREYQLNDSA Y+LN + R+SN  Y+PT+QDVL TRVKTTGIVET  TFK L+ K+ DVGGQRSER+KWIHCFEGV ++I+  S+S+YD  L ED E+NRM ES+KLFDS+CNN+WF+  SIILFLNK DLF+ KI  SPL++CFPEY G++ +E+A+ Y++  FE LNK+K+ K IYSHFTCATDT N+ +VF+ +TD II  N+
Sbjct:   24 MGCTLSSDDKSAQERSKMIDRNLRDDGEKASREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYRVVVYSNTIQSIIAIIRAMGRLRIDFADPERADDARQLFVMAGSVDEGFMTSELAGVIKRLWRDEGVRLCFHRSREYQLNDSASYYLNDLDRISNSSYVPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTSIIFCVSLSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIRMSPLSICFPEYPGSDVYEEAAAYIQCQFEDLNKRKDTKEIYSHFTCATDTKNVQFVFDAVTDVIIKNNL 371          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Zebrafish
Match: gnaia (guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide a [Source:ZFIN;Acc:ZDB-GENE-030131-2229])

HSP 1 Score: 442.58 bits (1137), Expect = 8.320e-155
Identity = 203/348 (58.33%), Postives = 275/348 (79.02%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKE-KIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            MGC  S++ ++ + +SK ID+ +  D ++ S  +K+LLLGAGESGKSTIVKQMKII+  GY+++EC QY+ +V+SNT+QS+ AIIRAMG+L+IDFA  E  +DAR+LF +  +++E  ++ ++   ++RLW D+GV +CF RSREYQLNDSA Y+LN + R+SN  Y+PT+QDVL TRVKTTGIVET  TFK L+ K+ DVGGQRSER+KWIHCFEGV ++I+  S+S+YD  L ED E+NRM ES+KLFDS+CNN+WF+  SIILFLNK DLF+ KI  SPL++CFPEY G++ +E+A+ Y++  FE LNK+K+ K IYSHFTCATDT N+ +VF+ +TD II  N+
Sbjct:   24 MGCTLSSDDKSAQERSKMIDRNLRDDGEKASREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYRVVVYSNTIQSIIAIIRAMGRLRIDFADPERADDARQLFVMAGSVDEGFMTSELAGVIKRLWRDEGVRLCFHRSREYQLNDSASYYLNDLDRISNSSYVPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTSIIFCVSLSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIRMSPLSICFPEYPGSDVYEEAAAYIQCQFEDLNKRKDTKEIYSHFTCATDTKNVQFVFDAVTDVIIKNNL 371          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Xenopus
Match: rgp1 (RGP1 homolog, RAB6A GEF complex partner 1 [Source:Xenbase;Acc:XB-GENE-997629])

HSP 1 Score: 447.588 bits (1150), Expect = 5.269e-157
Identity = 207/348 (59.48%), Postives = 270/348 (77.59%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKE-KIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            MGC  S E +A   +SK ID+ +  D ++ S  +K+LLLGAGESGKSTIVKQMKII+ +GY+++EC QYK +V+SNT+QS+ AIIRAMG+L+IDF  +   +DAR+LF L  + EE V+S ++   +QRLW D GV  CF+RSREYQLNDSA Y+LN I R++  +YIPT+QDVL TRVKTTGIVET  TFK L  K+ DVGGQRSER+KWIHCFEGV  +I+  ++S+YD  L ED E+NRM ES+KLFDS+CNN+WF   SIILFLNK DLF+ KI +SPLT+C+PEY G+N +E+A+ Y++  FE LN++K+ K IY+HFTCATDT N+ +VF+ +TD II  N+
Sbjct:    1 MGCTLSAEDKAAAERSKMIDRNLREDGEKASKEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEEECRQYKVVVYSNTIQSIIAIIRAMGRLRIDFGDVARADDARQLFVLASSAEEGVMSPELAGVIQRLWEDPGVQACFSRSREYQLNDSASYYLNDIERIAQVNYIPTQQDVLRTRVKTTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLLLAEDEEMNRMHESMKLFDSICNNKWFIDTSIILFLNKKDLFEEKISRSPLTICYPEYSGSNTYEEAAAYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKSNL 348          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Xenopus
Match: gnai2 (guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 [Source:NCBI gene;Acc:394861])

HSP 1 Score: 444.506 bits (1142), Expect = 9.660e-156
Identity = 204/349 (58.45%), Postives = 269/349 (77.08%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEE-AVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKE-KIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            MGC  S E +A   +SK IDK +  D ++ +  +K+LLLGAGESGKSTIVKQMKII+ +GY+++EC QY+ +VFSNT+QS+ AII+AMG LKIDF      +DAR+LF+L    EE  +L +D+   ++RLW D GV  CF+RSREYQLNDSA Y+LN + R++  DY+PT+QDVL TRVKTTGIVET  TFK L+ K+ DVGGQRSER+KWIHCFEGV  +I+  ++S YD  L ED E+NRM ES+KLFDS+CNN+WF++ SIILFLNK DLF+ KI +SPL++CFPEY G N +++A+ Y++  FE LNK+++ K IY+HFTCATDT N+ +VF+ +TD II  N+
Sbjct:    1 MGCTVSAEDKAAAERSKNIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEEECRQYRAVVFSNTIQSIMAIIKAMGNLKIDFGDPARADDARQLFALSSTAEEQGILPDDLAGVIRRLWADPGVQACFSRSREYQLNDSAAYYLNDLERIARSDYVPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKITRSPLSICFPEYSGANQYDEAASYIQTKFEDLNKRRDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNL 349          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Xenopus
Match: gnai1 (guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 [Source:NCBI gene;Acc:100038283])

HSP 1 Score: 444.121 bits (1141), Expect = 5.438e-155
Identity = 207/354 (58.47%), Postives = 269/354 (75.99%), Query Frame = 2
Query:   56 LVQTIVMGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKE-KIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            LV T  MGC  S E +A   +SK ID+ +  D ++ +  +K+LLLGAGESGKSTIVKQMKII+  GY+++EC QYK +V+SNT+QS+ AIIRAMG+LKIDF      +DAR+LF L    EE  ++ ++   ++RLW D GV  CF RSREYQLNDSA Y+LN + R++   YIPT+QDVL TRVKTTGIVET  TFK L+ K+ DVGGQRSER+KWIHCFEGV  +I+  ++S+YD  L ED E+NRM ES+KLFDS+CNN+WF+  SIILFLNK DLF+ KI +SPLT+C+PEY G+N +E+A+ Y++  FE LNK+K+ K IY+HFTCATDT N+ +VF+ +TD II  N+
Sbjct:   38 LVTTDAMGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDPSRADDARQLFVLAGAAEEGFMTAELAGVIKRLWKDGGVQACFNRSREYQLNDSAAYYLNDLDRIAQNSYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICYPEYPGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNL 391          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Xenopus
Match: gnai1 (guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 [Source:NCBI gene;Acc:100038283])

HSP 1 Score: 439.884 bits (1130), Expect = 5.370e-154
Identity = 204/348 (58.62%), Postives = 266/348 (76.44%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKE-KIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            MGC  S E +A   +SK ID+ +  D ++ +  +K+LLLGAGESGKSTIVKQMKII+  GY+++EC QYK +V+SNT+QS+ AIIRAMG+LKIDF      +DAR+LF L    EE  ++ ++   ++RLW D GV  CF RSREYQLNDSA Y+LN + R++   YIPT+QDVL TRVKTTGIVET  TFK L+ K+ DVGGQRSER+KWIHCFEGV  +I+  ++S+YD  L ED E+NRM ES+KLFDS+CNN+WF+  SIILFLNK DLF+ KI +SPLT+C+PEY G+N +E+A+ Y++  FE LNK+K+ K IY+HFTCATDT N+ +VF+ +TD II  N+
Sbjct:    1 MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDPSRADDARQLFVLAGAAEEGFMTAELAGVIKRLWKDGGVQACFNRSREYQLNDSAAYYLNDLDRIAQNSYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICYPEYPGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNL 348          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Xenopus
Match: rgp1 (RGP1 homolog, RAB6A GEF complex partner 1 [Source:Xenbase;Acc:XB-GENE-997629])

HSP 1 Score: 410.609 bits (1054), Expect = 1.716e-142
Identity = 195/349 (55.87%), Postives = 259/349 (74.21%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAG-ESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKE-KIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            MGC  S E +A   +SK ID+ +  D ++ S  +K+LLLG   E G        +II+ +GY+++EC QYK +V+SNT+QS+ AIIRAMG+L+IDF  +   +DAR+LF L  + EE V+S ++   +QRLW D GV  CF+RSREYQLNDSA Y+LN I R++  +YIPT+QDVL TRVKTTGIVET  TFK L  K+ DVGGQRSER+KWIHCFEGV  +I+  ++S+YD  L ED E+NRM ES+KLFDS+CNN+WF   SIILFLNK DLF+ KI +SPLT+C+PEY G+N +E+A+ Y++  FE LN++K+ K IY+HFTCATDT N+ +VF+ +TD II  N+
Sbjct:    1 MGCTLSAEDKAAAERSKMIDRNLREDGEKASKEVKLLLLGEDWEIG-------YEIIHEDGYSEEECRQYKVVVYSNTIQSIIAIIRAMGRLRIDFGDVARADDARQLFVLASSAEEGVMSPELAGVIQRLWEDPGVQACFSRSREYQLNDSASYYLNDIERIAQVNYIPTQQDVLRTRVKTTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLLLAEDEEMNRMHESMKLFDSICNNKWFIDTSIILFLNKKDLFEEKISRSPLTICYPEYSGSNTYEEAAAYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKSNL 342          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Mouse
Match: Gnai1 (guanine nucleotide binding protein (G protein), alpha inhibiting 1 [Source:MGI Symbol;Acc:MGI:95771])

HSP 1 Score: 446.432 bits (1147), Expect = 1.032e-156
Identity = 206/348 (59.20%), Postives = 268/348 (77.01%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKE-KIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            MGC  S E +A   +SK ID+ +  D ++ +  +K+LLLGAGESGKSTIVKQMKII+  GY+++EC QYK +V+SNT+QS+ AIIRAMG+LKIDF      +DAR+LF L    EE  ++ ++   ++RLW D GV  CF RSREYQLNDSA Y+LN + R++ P+YIPT+QDVL TRVKTTGIVET  TFK L+ K+ DVGGQRSER+KWIHCFEGV  +I+  ++S+YD  L ED E+NRM ES+KLFDS+CNN+WF+  SIILFLNK DLF+ KI KSPLT+C+PEY G+N +E+A+ Y++  FE LNK+K+ K IY+HFTCATDT N+ +VF+ +TD II  N+
Sbjct:    1 MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNL 348          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Mouse
Match: Gnai3 (guanine nucleotide binding protein (G protein), alpha inhibiting 3 [Source:MGI Symbol;Acc:MGI:95773])

HSP 1 Score: 444.891 bits (1143), Expect = 5.202e-156
Identity = 205/348 (58.91%), Postives = 270/348 (77.59%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKE-KIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            MGC  S E +A   +SK ID+ +  D ++ +  +K+LLLGAGESGKSTIVKQMKII+ +GY++DEC QYK +V+SNT+QS+ AIIRAMG+LKIDF      +DAR+LF L  + EE V++ ++   ++RLW D GV  CF+RSREYQLNDSA Y+LN + R+S  +YIPT+QDVL TRVKTTGIVET  TFK L  K+ DVGGQRSER+KWIHCFEGV  +I+  ++S+YD  L ED E+NRM ES+KLFDS+CNN+WF+  SIILFLNK DLF+ KI +SPLT+C+PEY G+N +E+A+ Y++  FE LN++K+ K +Y+HFTCATDT N+ +VF+ +TD II  N+
Sbjct:    1 MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGESARADDARQLFVLAGSAEEGVMTSELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQTNYIPTQQDVLRTRVKTTGIVETHFTFKELYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAAAYIQCQFEDLNRRKDTKEVYTHFTCATDTKNVQFVFDAVTDVIIKNNL 348          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Mouse
Match: Gnai2 (guanine nucleotide binding protein (G protein), alpha inhibiting 2 [Source:MGI Symbol;Acc:MGI:95772])

HSP 1 Score: 439.884 bits (1130), Expect = 4.033e-154
Identity = 205/349 (58.74%), Postives = 268/349 (76.79%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEE-AVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKE-KIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            MGC  S E +A   +SK IDK +  D ++ +  +K+LLLGAGESGKSTIVKQMKII+ +GY+++EC QY+ +V+SNT+QS+ AI++AMG L+IDFA  +  +DAR+LF+L    EE  +L ED+   ++RLW D GV  CF RSREYQLNDSA Y+LN + R++  DYIPT+QDVL TRVKTTGIVET  TFK L+ K+ DVGGQRSER+KWIHCFEGV  +I+  ++S YD  L ED E+NRM ES+KLFDS+CNN+WF+  SIILFLNK DLF+ KI +S LT+CFPEY G N +++A+ Y++  FE LNK+K+ K IY+HFTCATDT N+ +VF+ +TD II  N+
Sbjct:    1 MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPQRADDARQLFALSCAAEEQGMLPEDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKITQSSLTICFPEYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNL 349          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Mouse
Match: Gnai2 (guanine nucleotide binding protein (G protein), alpha inhibiting 2 [Source:MGI Symbol;Acc:MGI:95772])

HSP 1 Score: 439.884 bits (1130), Expect = 4.033e-154
Identity = 205/349 (58.74%), Postives = 268/349 (76.79%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEE-AVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKE-KIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            MGC  S E +A   +SK IDK +  D ++ +  +K+LLLGAGESGKSTIVKQMKII+ +GY+++EC QY+ +V+SNT+QS+ AI++AMG L+IDFA  +  +DAR+LF+L    EE  +L ED+   ++RLW D GV  CF RSREYQLNDSA Y+LN + R++  DYIPT+QDVL TRVKTTGIVET  TFK L+ K+ DVGGQRSER+KWIHCFEGV  +I+  ++S YD  L ED E+NRM ES+KLFDS+CNN+WF+  SIILFLNK DLF+ KI +S LT+CFPEY G N +++A+ Y++  FE LNK+K+ K IY+HFTCATDT N+ +VF+ +TD II  N+
Sbjct:    1 MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPQRADDARQLFALSCAAEEQGMLPEDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKITQSSLTICFPEYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNL 349          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Mouse
Match: Gnat3 (guanine nucleotide binding protein, alpha transducing 3 [Source:MGI Symbol;Acc:MGI:3588268])

HSP 1 Score: 416.001 bits (1068), Expect = 9.889e-145
Identity = 189/348 (54.31%), Postives = 261/348 (75.00%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKE-KIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            MG   S+E + +  +SKE++K +  D +R++ T+K+LLLGAGESGKSTIVKQMKII+ NGY+K EC+++K +++SNTLQS+ AI++AM  L ID+ +  S ED  +L S+   +E+  ++  +   ++RLW D G+  CF R+ EYQLNDSA Y+LN + RL+ P Y+P EQDVLH+RVKTTGI+ET  +FK LN ++ DVGGQRSER+KWIHCFEGV  +I+ A++S YD  L+ED E+NRM ES+ LF+S+CN+++F+  SI+LFLNK DLF+ K+ K  L++CFPEY G N FEDA  Y++  F  LN KKE K IYSH TCATDT N+ +VF+ +TD II +N+
Sbjct:    1 MGSGISSESKESARRSKELEKKLQEDAERDARTVKLLLLGAGESGKSTIVKQMKIIHKNGYSKQECMEFKAVIYSNTLQSILAIVKAMATLGIDYVNPRSREDQEQLHSMANTLEDGDMTPQLAEIIKRLWGDPGIQACFERASEYQLNDSAAYYLNDLDRLTAPGYVPNEQDVLHSRVKTTGIIETQFSFKDLNFRMFDVGGQRSERKKWIHCFEGVTCIIFCAALSAYDMVLVEDEEVNRMHESLHLFNSICNHKYFATTSIVLFLNKKDLFQEKVAKVHLSICFPEYTGPNTFEDAGNYIKNQFLDLNLKKEDKEIYSHMTCATDTQNVKFVFDAVTDIIIKENL 348          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. UniProt/SwissProt
Match: sp|P30682|GNAI_LYMST (Guanine nucleotide-binding protein G(i) subunit alpha OS=Lymnaea stagnalis OX=6523 PE=2 SV=3)

HSP 1 Score: 468.003 bits (1203), Expect = 2.353e-164
Identity = 215/348 (61.78%), Postives = 277/348 (79.60%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKE-KIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            MGC+ S E +A   +SK+IDK +  D ++ +  +K+LLLGAGESGKSTIVKQMKII+  GY+++ECLQYKP+V+SN +QS+ AII+AMGQLKI F   +  EDAR+ F+L  + +E  +S ++   M+RLW D GV  CF+RSREYQLNDSAEY+LN++ R+S P YIPTEQDVL TRVKTTGIVET  TFK L+ K+ DVGGQRSER+KWIHCFEGV  +I++ ++SEYD  L ED E+NRM ES+KLFDS+CNN+WF++ SIILFLNK DLF+ KI KSPLT+CFPEY G N +E+A+ Y+++ FE LNKKK+ K IYSHFTCATDT+N+ +VF+ +TD II  N+
Sbjct:    1 MGCVTSQEDKAAVERSKQIDKSLRMDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEKGYSQEECLQYKPVVYSNAIQSMIAIIKAMGQLKIQFGHPDRAEDARQFFALAGHADEGEMSAELSGIMKRLWKDVGVQECFSRSREYQLNDSAEYYLNALDRISAPGYIPTEQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFIVAMSEYDLTLAEDQEMNRMMESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIKKSPLTICFPEYTGANTYEEAAAYIQLQFENLNKKKDTKEIYSHFTCATDTNNVQFVFDAVTDVIIKNNL 348          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. UniProt/SwissProt
Match: sp|P51876|GNAI_PLATR (Guanine nucleotide-binding protein G(i) subunit alpha OS=Planorbella trivolvis OX=283763 PE=2 SV=2)

HSP 1 Score: 464.922 bits (1195), Expect = 4.603e-163
Identity = 213/348 (61.21%), Postives = 277/348 (79.60%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKE-KIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            MGC+ S E +A   +SK+IDK +  D ++ +  +K+LLLGAGESGKSTIVKQMKII+  GY+++ECLQY P+V+SN +QS+ AII+AMGQLKI F   +  E+AR+ F+L  + +E  +S+++   M+RLW D GV  CF+RSREYQLNDSAEY+LN++ R+S P YIPTEQDVL TRVKTTGIVET  TFK L+ K+ DVGGQRSER+KWIHCFEGV  +I++ ++SEYD  L ED E+NRM ES+KLFDS+CNN+WF++ SIILFLNK DLF+ KI KSPLT+CFPEY G N +E+A+ Y+++ FE LNKKK+ K IYSHFTCATDT+N+ +VF+ +TD II  N+
Sbjct:    1 MGCVTSQEDKAAVERSKQIDKSLRMDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEKGYSQEECLQYNPVVYSNAIQSMIAIIKAMGQLKIQFGHPDRAEEARQFFALAGHADEGEMSQELSGIMKRLWKDVGVQECFSRSREYQLNDSAEYYLNALDRISAPGYIPTEQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFIVAMSEYDLTLAEDQEMNRMMESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIKKSPLTICFPEYTGANTYEEAAAYIQLQFENLNKKKDTKEIYSHFTCATDTNNVQFVFDAVTDVIIKNNL 348          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. UniProt/SwissProt
Match: sp|P30676|GNAI_PATPE (Guanine nucleotide-binding protein G(i) subunit alpha OS=Patiria pectinifera OX=7594 PE=1 SV=3)

HSP 1 Score: 462.225 bits (1188), Expect = 5.212e-162
Identity = 213/348 (61.21%), Postives = 274/348 (78.74%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKK-EKIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            MGC  S E +A   +SK ID+ +  D ++ +  +K+LLLGAGESGKSTIVKQMKII+  GY++++C QYKP+V+SNT+QS+ AIIRAMG LK+DF   +  +DAR+LF+L    EE  LS ++ A M+RLW D GV  CF+RSREYQLNDSA Y+LN++ RL+ P YIPT+QDVL TRVKTTGIVET  TFK L+ K+ DVGGQRSER+KWIHCFEGV  +I+  ++S YD  L ED E+NRM ES+KLFDS+CNN+WF++ SIILFLNK DLF+ KI KSPLT+CFPEY G+N +E+A+ Y++M FE LNK+K +K IY+HFTCATDT+NI +VF+ +TD II  N+
Sbjct:    1 MGCATSAEDKAAAERSKAIDRNLRIDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEEGYSEEDCKQYKPVVYSNTIQSMIAIIRAMGSLKVDFGDGDRTDDARQLFALAGQAEEGELSPELAAVMKRLWADGGVQGCFSRSREYQLNDSASYYLNALDRLAAPGYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKITKSPLTICFPEYTGSNTYEEAAAYIQMQFEDLNKRKDQKEIYTHFTCATDTNNIQFVFDAVTDVIIKNNL 348          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. UniProt/SwissProt
Match: sp|P41776|GNAI_HOMAM (Guanine nucleotide-binding protein G(i) subunit alpha OS=Homarus americanus OX=6706 PE=2 SV=2)

HSP 1 Score: 448.358 bits (1152), Expect = 1.346e-156
Identity = 211/349 (60.46%), Postives = 270/349 (77.36%), Query Frame = 2
Query:   74 MGCIPSNEV-RANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKK-EKIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            MGC  SN   +    +SK+IDK +    +R +  +K+LLLGAGESGKSTIVKQMKII+  GY+++EC QY+P+V+SNT+QSL AIIRAMGQLKIDF      +DAR  F+L    +E  L+ ++   M+RLWN+ GV  C  RSREYQLND+A Y+LN++ R++ P YIPT+QDVL TRVKTTGIVET  +FK LN K+ DVGGQRSER+KWIHCFEGV  +I+V ++S YD  L ED E+NRM ES+KLFDS+CNN+WF + SIILFLNK DLF+ KI KSPLT+CFPEY+G+N +ED++ Y+RM FE LNK+K +K IY+HFTCATDT+NI +VF+ +TD II  N+
Sbjct:    1 MGCAMSNAADKEAAERSKKIDKDLRLAGERAAREVKLLLLGAGESGKSTIVKQMKIIHETGYSREECEQYRPVVYSNTIQSLMAIIRAMGQLKIDFRDSSRADDARHFFTLASAADEGELTPELANIMKRLWNESGVQHCRNRSREYQLNDTAAYYLNALDRIARPGYIPTQQDVLRTRVKTTGIVETNFSFKNLNFKLFDVGGQRSERKKWIHCFEGVTAIIFVVALSGYDLVLAEDEEMNRMIESMKLFDSICNNKWFVETSIILFLNKKDLFEQKITKSPLTICFPEYQGSNVYEDSANYIRMKFENLNKRKDQKEIYTHFTCATDTNNIQFVFDAVTDVIIKNNL 349          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. UniProt/SwissProt
Match: sp|P10824|GNAI1_RAT (Guanine nucleotide-binding protein G(i) subunit alpha-1 OS=Rattus norvegicus OX=10116 GN=Gnai1 PE=1 SV=3)

HSP 1 Score: 446.817 bits (1148), Expect = 4.981e-156
Identity = 206/348 (59.20%), Postives = 268/348 (77.01%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKE-KIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            MGC  S E +A   +SK ID+ +  D ++ +  +K+LLLGAGESGKSTIVKQMKII+  GY+++EC QYK +V+SNT+QS+ AIIRAMG+LKIDF      +DAR+LF L    EE  ++ ++   ++RLW D GV  CF RSREYQLNDSA Y+LN + R++ P+YIPT+QDVL TRVKTTGIVET  TFK L+ K+ DVGGQRSER+KWIHCFEGV  +I+  ++S+YD  L ED E+NRM ES+KLFDS+CNN+WF+  SIILFLNK DLF+ KI KSPLT+C+PEY G+N +E+A+ Y++  FE LNK+K+ K IY+HFTCATDT N+ +VF+ +TD II  N+
Sbjct:    1 MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDAARADDARQLFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNL 348          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. TrEMBL
Match: M9V131 (G protein subunit alpha i OS=Terebratalia transversa OX=34513 GN=Gai PE=2 SV=1)

HSP 1 Score: 475.707 bits (1223), Expect = 5.891e-165
Identity = 225/348 (64.66%), Postives = 277/348 (79.60%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKE-KIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            MGC  S++ +  E +SK+IDK +  D +R +  +K+LLLGAGESGKSTIVKQMKII++ GY+ DECLQYKP+VFSNT+QS+ AIIRAMGQLKIDF   E  +DAR+LF+L   +EE  LS D+   M+RLW D GV  CF RSREYQLNDSAEY+LN++ R+S  DYIPTEQDVL TRVKTTGIVET  TFK L+ K+ DVGGQRSER+KWIHCFEGV ++I++ ++SEYD  L ED E+NRM ES+KLFDS+CNN+WF+  SIILFLNK DLF+ KI KSPLTVCFPEY G N FEDA+ Y+++ FE LNK+ E K IY HFTCATDT+N+ +VF+ +TD II  N+
Sbjct:    1 MGCANSSDDKQAEARSKQIDKTLRSDGERAAREVKLLLLGAGESGKSTIVKQMKIIHDKGYSTDECLQYKPVVFSNTVQSMIAIIRAMGQLKIDFGYQERADDARQLFTLA-GVEEGELSPDLAGVMKRLWRDPGVQECFARSREYQLNDSAEYYLNALERISLHDYIPTEQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTSIIFIVALSEYDLTLAEDQEMNRMMESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIRKSPLTVCFPEYSGPNTFEDAAAYIQLQFEKLNKRSETKEIYVHFTCATDTNNVQFVFDAVTDVIIKNNL 347          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. TrEMBL
Match: R7V8M3 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_178654 PE=4 SV=1)

HSP 1 Score: 475.322 bits (1222), Expect = 9.557e-165
Identity = 219/348 (62.93%), Postives = 279/348 (80.17%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKE-KIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            MGC  SN+ +A + +SK IDK +  D ++ S  +K+LLLGAGESGKSTIVKQMKII+  GY+ +ECLQYKP+V+SNT+QS+ AIIR+MGQLKIDF   +  EDAR+LF+L  N EE  L++D+ A M+RLW D GV  CF+RSREYQLNDSAEY+LN++ R+S   Y+PTEQDVL TRVKTTGIVET  TFK L+ K+ DVGGQRSER+KWIHCFEGV  +I++  +SEYD  L ED E+NRM ES+KLFDS+CNN+WF+  SIILFLNK DLF+ KI KSPLT+CFPE+ G+N +E+A+ Y++M FE LNK+K+ K IY+HFTCATDT+N+ +VF+ +TD II  N+
Sbjct:    1 MGCAVSNDDKAAQERSKAIDKGLRADGEKASREVKLLLLGAGESGKSTIVKQMKIIHEKGYSSEECLQYKPVVYSNTIQSMIAIIRSMGQLKIDFGHPDRAEDARQLFALAGNAEEGDLTQDLAAIMKRLWKDSGVQECFSRSREYQLNDSAEYYLNALDRISQQGYVPTEQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFIVGMSEYDLTLAEDQEMNRMMESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICFPEFTGSNTYEEAAAYIQMQFENLNKRKDTKEIYTHFTCATDTNNVQFVFDAVTDVIIKNNL 348          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. TrEMBL
Match: Q0ZA02 (Guanine nucleotide-binding protein G(I) alpha subunit OS=Aplysia californica OX=6500 PE=2 SV=1)

HSP 1 Score: 469.929 bits (1208), Expect = 1.111e-162
Identity = 216/348 (62.07%), Postives = 279/348 (80.17%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKE-KIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            MGC+ S E +A   +SK+IDK +  D ++ +  +K+LLLGAGESGKSTIVKQMKII+  GY+++ECLQYKP+V+SN +QS+ AII+AMGQLKI+F   +  EDAR+ F+L  + +E  +S ++   M+RLW D GV  CF+RSREYQLNDSAEY+LN++ R+S P YIPTEQDVL TRVKTTGIVET  TFK L+ K+ DVGGQRSER+KWIHCFEGV  +I++ ++SEYD  L ED E+NRM ES+KLFDS+CNN+WF++ SIILFLNK DLF+ KI KSPLT+CFPEY G NN+E+A+ Y+++ FE LNKKK+ K IYSHFTCATDT+N+ +VF+ +TD II  N+
Sbjct:    1 MGCVTSQEDKAAVERSKQIDKTLRIDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEKGYSQEECLQYKPVVYSNAIQSMIAIIKAMGQLKIEFGHPDRAEDARQFFALAGHADEGEMSPELSGIMKRLWKDVGVQECFSRSREYQLNDSAEYYLNALDRISAPGYIPTEQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFIVAMSEYDLTLAEDQEMNRMMESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIKKSPLTICFPEYPGGNNYEEAATYIQLQFENLNKKKDTKEIYSHFTCATDTNNVQFVFDAVTDVIIKNNL 348          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. TrEMBL
Match: V4AZH1 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_226384 PE=4 SV=1)

HSP 1 Score: 469.929 bits (1208), Expect = 1.226e-162
Identity = 218/348 (62.64%), Postives = 278/348 (79.89%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKE-KIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            MGC+ S+E +    +SK+IDK +  D ++ S  +K+LLLGAGESGKSTIVKQMKII+  GY+++ECLQYKP+V+SNT+QS+ AIIRAMG LKIDF   +  EDARK FSL  N +E  LS ++   M++LW D GV  CF+RSREYQLNDSAEY+LN++ R+S+  YIPTEQDVL TRVKTTGIVET  TFK L+ K+ DVGGQRSER+KWIHCFEGV  +I++ ++SEYD  L ED E+NRM ES+KLFDS+CNN+WF+  SIILFLNK DLF+ KI KSPLTVCFPE+ G+N +E+A+ Y++M FE LNK+K+ K IY+HFTCATDT+N+ +VF+ +TD II  N+
Sbjct:    1 MGCVTSSEDKVAMERSKQIDKGLKADGEKSSREVKLLLLGAGESGKSTIVKQMKIIHEKGYSQEECLQYKPVVYSNTIQSMIAIIRAMGLLKIDFGHPDRAEDARKFFSLAGNADEGELSPEVATIMKKLWKDSGVQECFSRSREYQLNDSAEYYLNAMDRISHTGYIPTEQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFIVAMSEYDLTLAEDQEMNRMMESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTVCFPEFSGSNTYEEAAAYIQMQFENLNKRKDTKEIYTHFTCATDTNNVQFVFDAVTDVIIKNNL 348          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. TrEMBL
Match: A0A2H4WCW2 (Gi-alpha OS=Argopecten irradians OX=31199 GN=Gi-alpha PE=2 SV=1)

HSP 1 Score: 468.774 bits (1205), Expect = 3.865e-162
Identity = 217/348 (62.36%), Postives = 278/348 (79.89%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKE-KIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            MGC  S + +A   +SK+IDK + +D ++ +  +K+LLLGAGESGKSTIVKQMKII+  GY+++ECLQYKP+V+SN +QS+ AIIRAMGQLKI+F   +  EDAR+LF+L  N +E  LS ++ A M+RLW D GV  CF RSREYQLNDSAEY+L+S+ R+S   YIPTEQDVL TRVKTTGIVET  TFK L+ K+ DVGGQRSER+KWIHCFEGV  +I++ ++SEYD  L+ED E+NRM ES+KLFDS+CNN+WF+  SIILFLNK DLF+ KI KSPLT+CFPE+ G NN+E A+ Y+++ FE LNK+KE K IY+HFTCATDT+N+ +VF+ +TD II  N+
Sbjct:    1 MGCAVSADDKAAVERSKQIDKTLRQDREKAAREVKLLLLGAGESGKSTIVKQMKIIHEKGYSQEECLQYKPVVYSNAIQSMMAIIRAMGQLKIEFGHPDRAEDARQLFALTNNTDEGELSSELAAIMKRLWKDSGVQECFGRSREYQLNDSAEYYLSSLDRISQSGYIPTEQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFIVAMSEYDLTLVEDQEMNRMMESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIRKSPLTICFPEFSGENNYEQAATYIQVQFENLNKRKETKEIYTHFTCATDTNNVQFVFDAVTDVIIKNNL 348          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Cavefish
Match: gnaia (guanine nucleotide-binding protein G(i) subunit alpha-1 [Source:NCBI gene;Acc:103035761])

HSP 1 Score: 446.817 bits (1148), Expect = 6.036e-157
Identity = 205/348 (58.91%), Postives = 272/348 (78.16%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKE-KIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            MGC  S+E +  + +SK ID+ +  D ++ +  +K+LLLGAGESGKSTIVKQMKII+  GY+++EC QYK +V+SNT+QS+ AIIRAMG+LKIDF+     +DAR+LF L  + EE  ++ ++   +QRLW D GV  CF+RSREYQLNDSA Y+LN + R+S+  Y+PT+QDVL TRVKTTGIVET  TFK L+ K+ DVGGQRSER+KWIHCFEGV  +I+  S+S+YD  L ED E+NRM ES+KLFDS+CNN+WF++ SIILFLNK DLF+ KI +SPLT+C+PEY G+N +E+A+ Y++  FE LNK+K+ K IY+HFTCATDT N+ +VF+ +TD II  N+
Sbjct:    1 MGCTLSSEDKVAQERSKMIDRNLRDDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFSDAARADDARQLFVLAGSAEEGYMTGELAGIIQRLWKDGGVQACFSRSREYQLNDSASYYLNDLDRISSAAYVPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVSLSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIKRSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNL 348          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Cavefish
Match: gnai2b (guanine nucleotide-binding protein G(i) subunit alpha-2 [Source:NCBI gene;Acc:111193748])

HSP 1 Score: 439.113 bits (1128), Expect = 6.302e-154
Identity = 205/349 (58.74%), Postives = 267/349 (76.50%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEE-AVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKE-KIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            MGC  S E +A   +SK IDK +  D ++ +  +K+LLLGAGESGKSTIVKQMKII+ +GY++DEC QY+ +V+SNT+QS+ AII+AMG LKI+++     +DAR+LF+L    EE  +L +D+   ++RLW D GV  CF RSREYQLNDSA Y+LN + R++  DYIPT+QDVL TRVKTTGIVET  TFK L+ K+ DVGGQRSER+KWIHCFEGV  +I+  ++S YD  L ED E+NRM ES+KLFDS+CNN+WF++ SIILFLNK DLF+ KI  SPL +CFPEY G N +++A+ Y++  FE LNKKK+ K IY+HFTCATDT N+ +VF+ +TD II  N+
Sbjct:    1 MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYRAVVYSNTIQSIMAIIKAMGNLKIEYSDASRADDARQLFALSAAAEEQGILPDDLSNVIRRLWADSGVQGCFGRSREYQLNDSAAYYLNDLERIARADYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKITSSPLNICFPEYSGANKYDEAASYIQTKFEDLNKKKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNL 349          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Cavefish
Match: gnai2a (guanine nucleotide-binding protein G(i) subunit alpha-2 [Source:NCBI gene;Acc:103033963])

HSP 1 Score: 423.32 bits (1087), Expect = 1.162e-147
Identity = 209/349 (59.89%), Postives = 267/349 (76.50%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVL-SEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKE-KIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            MGC  S E +A   +S+ IDK +  D ++ +  +K+LLLGAGESGKSTIVKQMKII+ +GY++DEC QY+ +VFSNT+QS+ AII+AM  LKID+      +DAR+LF+L    EE     ED+ +A+ RLW+D GV  CFTRSREYQLNDSA Y+LN + R++  +YIP++ DVL TRVKTTGIVET  TFK L+ K+ DVGGQRSER+KWIHCFEGV  +I+  ++S YD  L ED E+NRM ES+KLFDS+CNN+WF++ SIILFLNK DLF+ KI  SPLT+CFPEY G + +++ASEY+R  FE LNKKK+ K IYSHFTCATDT NI +VF+ +TD II  N+
Sbjct:    1 MGCTVSQEDKAAAERSRHIDKSLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECRQYRAVVFSNTIQSIMAIIKAMSNLKIDYEDPARADDARQLFALAAAAEEQGALPEDLSSAITRLWSDAGVQSCFTRSREYQLNDSAAYYLNDLDRIAMSNYIPSQPDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVAMSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIAHSPLTICFPEYTGASKYDEASEYIRTKFEDLNKKKDTKEIYSHFTCATDTKNIQFVFDAVTDVIIKNNL 349          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Cavefish
Match: ENSAMXT00000018576.2 (pep primary_assembly:Astyanax_mexicanus-2.0:7:25573287:25606043:1 gene:ENSAMXG00000018022.2 transcript:ENSAMXT00000018576.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 409.068 bits (1050), Expect = 3.361e-142
Identity = 192/344 (55.81%), Postives = 256/344 (74.42%), Query Frame = 2
Query:   86 PSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKE-KIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            P +++     +S+ + KL+S +  + + T          SGKSTIVKQMKII+  GY+++EC QYK +V+SNT+QS+ AIIRAMG+LKIDF      +DAR+LF L  + EE  ++ ++   ++RLW D GV  CF+RSREYQLNDSA Y+LN + R+S   YIPT+QDVL TRVKTTGIVET  TFK L+ K+ DVGGQRSER+KWIHCFEGV  +I+  ++S+YD  L ED E+NRM ES+KLFDS+CNN+WF+  SIILFLNK DLF+ KI +SPLT+C+PEY G+N +E+A+ Y++  FE LNK+K+ K IY+HFTCATDT N+ +VF+ +TD II  N+
Sbjct:    1 PPDDISRVNQRSRTLHKLLSEN-NKHTHTHTHTHTHTYSSGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDAARADDARQLFVLAGSAEEGFMTAELAGVIKRLWKDGGVQACFSRSREYQLNDSAAYYLNDLDRISQTTYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNL 343          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Cavefish
Match: gnao1a (G protein subunit alpha o1 [Source:NCBI gene;Acc:103039135])

HSP 1 Score: 402.905 bits (1034), Expect = 1.010e-139
Identity = 190/348 (54.60%), Postives = 252/348 (72.41%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEA-VLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKEKIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            MGC  S E RA  ++SK I+K +  D    +  +K+LLLGAGESGKSTIVKQMKII+ +G++ D+  QYKP+V+SNT+QSL AI+RAM  L +++   E   DA+ +  +   +E+    S ++  AM RLW D G+  CF+R+REYQLNDSA+Y+L+S+ R+   DY PTEQD+L TRVKTTGIVET  TFK L+ ++ DVGGQRSER+KWIHCFE V  +I+  ++S YDQ L ED   NRM ES+KLFDS+CNN+WF+  SIILFLNK D+F+ KI KSPLT+CFPEY G + F +  EY++  +E  NK   K +Y+H TCATDT+NI +VF+ +TD II  N+
Sbjct:    1 MGCTLSAEERAALDRSKAIEKNLKEDGITAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSGDDVKQYKPVVYSNTIQSLAAIVRAMDTLGLEYGDKERKADAKMVCDVVSRMEDTEPYSPELLTAMMRLWADSGIQECFSRAREYQLNDSAQYYLDSLDRIGAADYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLKLFDSICNNKWFTSTSIILFLNKKDIFEEKIKKSPLTICFPEYTGPDTFTEGVEYIQSQYESKNKSFHKEVYAHTTCATDTNNIQFVFDAVTDVIIANNL 348          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Sea Lamprey
Match: gnai3 (guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3 [Source:ZFIN;Acc:ZDB-GENE-070713-6])

HSP 1 Score: 443.736 bits (1140), Expect = 2.030e-156
Identity = 203/348 (58.33%), Postives = 267/348 (76.72%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKE-KIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            MGC  S E +A   +S+ ID+ +  D ++ S  +K+LLLGAGESGKSTIVKQMKII+  GYT++EC QYK +V+SNT+QS+ AIIRAMG L+IDF      +DAR+LF L  + E+ +++ ++   ++RLW D GV  CF R+REYQLNDSA Y+LN + R+S P Y+PT+QDVL TRVKTTGIVET  TFK L+ K+ DVGGQRSER+KWIHCFEGV  +I+  ++S YD  L ED E+NRM ES+KLFDS+CNN+WF + SIILFLNK DLF+ K+++SPLT+C+PEY G N +E+A+ Y++  FE LNK+KE K IY+HFTCATDT N+ +VF+ +TD II  N+
Sbjct:    1 MGCTLSTEDKAAVERSRMIDRNLREDGEKASREVKLLLLGAGESGKSTIVKQMKIIHEAGYTEEECKQYKAVVYSNTIQSVIAIIRAMGNLRIDFGDAGRADDARQLFVLAGSAEDGLMTPELAQVIKRLWADPGVQACFRRAREYQLNDSAAYYLNDLERISQPSYVPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFIETSIILFLNKKDLFEEKVIRSPLTICYPEYTGGNTYEEAAAYIQTQFENLNKRKESKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNL 348          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004355.1 (pep scaffold:Pmarinus_7.0:GL477714:209323:228779:-1 gene:ENSPMAG00000003914.1 transcript:ENSPMAT00000004355.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 417.542 bits (1072), Expect = 1.531e-146
Identity = 196/316 (62.03%), Postives = 245/316 (77.53%), Query Frame = 2
Query:  170 TIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKE-KIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            T   +  GAGESGKSTIVKQMKII+ +GY++DEC QY  +VFSN +QS+ AIIRAMG+LKIDF  +   EDAR+LF L    EE V++ D+   ++RLW+D GV  CF RSREYQLNDSA Y+LN + R+SN  YIPT+QDVL TRVKTTGIVET  TFK L+ K+ DVGGQRSER+KWIHCFEGV  +I+  ++S YD  L ED E NRM ES+KLFDS+CNN+WF++ SIILFLNK DLF+ KI KSPL++CF EY G+N +E+A+ Y++  FE LNK+K+ K IYSHFTCATDT N+ +VF+ +TD II  N+
Sbjct:    1 TSAFVFAGAGESGKSTIVKQMKIIHEDGYSEDECKQYTAVVFSNAIQSIIAIIRAMGKLKIDFGDVSRAEDARQLFVLAGVAEEGVMTPDLSEVIKRLWSDSGVQACFRRSREYQLNDSAAYYLNDLERISNLSYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEETNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKINKSPLSICFAEYIGSNTYEEAAAYIQCQFEDLNKRKDTKEIYSHFTCATDTKNVQFVFDAVTDVIIKNNL 316          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Sea Lamprey
Match: gnat2 (guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2 [Source:ZFIN;Acc:ZDB-GENE-011128-10])

HSP 1 Score: 393.66 bits (1010), Expect = 6.570e-137
Identity = 182/333 (54.65%), Postives = 246/333 (73.87%), Query Frame = 2
Query:  119 SKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKE-KIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            SKE++K ++ D ++E+ T+K+LLLGAGESGKSTIVKQMKII+ NGY++ ECL++K I++SNTLQS+ AI+RAM    ID+       D R+LF+L  ++EE  +  ++ A + RLW D GV   F R+ EYQLNDSA Y+LN + RL NP Y+P EQDVL +RVKTTGI+E    FK L  ++ DVGGQRSER+KWIHCFEGV  +I+  ++S YD  L+ED+E+NRM ES+ LF+S+CN+++F+  SI+LFLNK DLF+ K+ K  L +CFP+Y G N F+DA  Y++  F  LN +KE K IYSH TCATDT N+ +VF+ +TD II  N+
Sbjct:    3 SKELEKKLAEDAEKEARTVKLLLLGAGESGKSTIVKQMKIIHKNGYSEAECLEFKAIIYSNTLQSILAIVRAMETFSIDYGDPARAADGRQLFNLADSLEEGSMPNELSAIIIRLWKDTGVQASFDRASEYQLNDSASYYLNDLDRLMNPSYLPNEQDVLRSRVKTTGIIEDSFCFKDLQFRMFDVGGQRSERKKWIHCFEGVTCIIFCGALSAYDMVLVEDDEVNRMHESLHLFNSICNHRYFNDTSIVLFLNKKDLFEEKVKKVHLNICFPDYDGPNTFDDAGAYIKNQFLDLNLRKEAKEIYSHLTCATDTQNVKFVFDAVTDIIIKNNL 335          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007349.1 (pep scaffold:Pmarinus_7.0:GL488470:4533:13151:-1 gene:ENSPMAG00000006632.1 transcript:ENSPMAT00000007349.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 280.796 bits (717), Expect = 7.247e-93
Identity = 139/315 (44.13%), Postives = 205/315 (65.08%), Query Frame = 2
Query:  179 ILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEE-AVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFED--ASEYVRMTFEMLNKKKEKIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            +  +G GESGKST +KQM+II+ +GYT+D+   +  +V  N   ++ A+IRAM  L I +A+  +   A+ L  +  ++E+   L +    A++ LW D G+  C+ R RE+QL DSA+Y+LN + R+S  +Y+PT+QD+L  R+ TTGI+E     + +  ++VDVGGQRSERRKWIHCFE V +++++ ++SEYDQ L+E +  NRM ES  LF ++    WF   S+ILFLNK DL + KI+ S L   FP++   N F+   A E++   F  LN   EK+IYSHFTCATDT NI +VF  + D+I+  N+
Sbjct:    1 LFCVGTGESGKSTFIKQMRIIHGSGYTEDDKRSFIKLVHQNVFSAMQAMIRAMETLGIPYANAGNQAHAQLLREV--DVEKICSLDKPYIEAVRCLWADPGIEECYDRRREFQLTDSAKYYLNDLARISAVNYLPTQQDILRVRIPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDSENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIIHSHLVDYFPDFDVRNQFDPQAAREFILRMFVELNPDTEKVIYSHFTCATDTENIRFVFAAVKDAILQLNL 313          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007354.1 (pep scaffold:Pmarinus_7.0:GL488470:4533:13151:-1 gene:ENSPMAG00000006632.1 transcript:ENSPMAT00000007354.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 279.641 bits (714), Expect = 1.763e-92
Identity = 138/314 (43.95%), Postives = 205/314 (65.29%), Query Frame = 2
Query:  179 ILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEE-AVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKG-NNNFEDASEYVRMTFEMLNKKKEKIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            +  +G GESGKST +KQM+II+ +GYT+D+   +  +V  N   ++ A+IRAM  L I +A+  +   A+ L  +  ++E+   L +    A++ LW D G+  C+ R RE+QL DSA+Y+LN + R+S  +Y+PT+QD+L  R+ TTGI+E     + +  ++VDVGGQRSERRKWIHCFE V +++++ ++SEYDQ L+E +  NRM ES  LF ++    WF   S+ILFLNK DL + KI+ S L   FP++ G   + + A E++   F  LN   EK+IYSHFTCATDT NI +VF  + D+I+  N+
Sbjct:    1 LFCVGTGESGKSTFIKQMRIIHGSGYTEDDKRSFIKLVHQNVFSAMQAMIRAMETLGIPYANAGNQAHAQLLREV--DVEKICSLDKPYIEAVRCLWADPGIEECYDRRREFQLTDSAKYYLNDLARISAVNYLPTQQDILRVRIPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDSENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIIHSHLVDYFPDFDGPQQDPQAAREFILRMFVELNPDTEKVIYSHFTCATDTENIRFVFAAVKDAILQLNL 312          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Yeast
Match: GPA2 (Nucleotide binding alpha subunit of the heterotrimeric G protein; interacts with the receptor Gpr1p, has signaling role in response to nutrients; required for the recruitment of Ras-GTP at the plasma membrane and in the nucleus [Source:SGD;Acc:S000000822])

HSP 1 Score: 245.358 bits (625), Expect = 1.296e-77
Identity = 126/316 (39.87%), Postives = 196/316 (62.03%), Query Frame = 2
Query:  173 IKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFAS---LESIEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGV--LVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKG-LNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKEKIIYSHFTCATDTSNINYVFNVITDSII 1102
            +K+LLLGAGESGKST+++Q+KI++ NG+++ E  +Y P+++ N L+    +I+A  +  ++      L   + +R +     N       EDI   +  LW       LV    + ++ L DS  YF+ +  R+++P+Y PT+QD+L +R  T+GI +T++     + + I DVGGQRSER+KWIHCF+ V  +I+  S+SEYDQ L+ED   NR  ES+ LFD++ N++WF++ S++LFLNK DLF  K+ K P+   FP+Y G ++   A++Y+   F  LN+     IY H T ATDTSNI  VF  I ++I+
Sbjct:  124 LKVLLLGAGESGKSTVLQQLKILHQNGFSEQEIKEYIPLIYQNLLEIGRNLIQARTRFNVNLEPECELTQQDLSRTMSYEMPNNYTGQFPEDIAGVISTLWALPSTQDLVNGPNASKFYLMDSTPYFMENFTRITSPNYRPTQQDILRSRQMTSGIFDTVIDMGSDIKMHIYDVGGQRSERKKWIHCFDNVTLVIFCVSLSEYDQTLMEDKNQNRFQESLVLFDNIVNSRWFARTSVVLFLNKIDLFAEKLSKVPMENYFPDYTGGSDINKAAKYILWRFVQLNRANLS-IYPHVTQATDTSNIRLVFAAIKETIL 438          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Yeast
Match: GPA1 (Subunit of the G protein involved in pheromone response; GTP-binding alpha subunit of the heterotrimeric G protein; negatively regulates the mating pathway by sequestering G(beta)gamma and by triggering an adaptive response; activates Vps34p at the endosome; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000001047])

HSP 1 Score: 225.328 bits (573), Expect = 9.413e-70
Identity = 107/232 (46.12%), Postives = 154/232 (66.38%), Query Frame = 2
Query:  425 VLSEDIFAAMQRLWNDD-GVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGN-NNFEDASEYVRMTFEMLNKKKEKIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            ++ EDI  A+++LWN+D G+  CF RS E+QL  SA Y+ ++I + ++P+Y+ T++D+L  R+KTTGI ET         K++D GGQRSER+KWIHCFEG+  +++V ++SEYDQ L ED  +NRM ESI LFD++ N++WF     ILFLNK DLF+ K+   P+   FP+Y+G   + E   +Y    F  LN K  K IY   TCATDT  + +V + +TD II +N+
Sbjct:  236 LIHEDIAKAIKQLWNNDKGIKQCFARSNEFQLEGSAAYYFDNIEKFASPNYVCTDEDILKGRIKTTGITETEFNIGSSKFKVLDAGGQRSERKKWIHCFEGITAVLFVLAMSEYDQMLFEDERVNRMHESIMLFDTLLNSKWFKDTPFILFLNKIDLFEEKVKSMPIRKYFPDYQGRVGDAEAGLKYFEKIFLSLN-KTNKPIYVKRTCATDTQTMKFVLSAVTDLIIQQNL 466          

HSP 2 Score: 69.707 bits (169), Expect = 1.801e-13
Identity = 39/106 (36.79%), Postives = 67/106 (63.21%), Query Frame = 2
Query:   74 MGCIPSNEVRANEN----KSKEIDKLISRDFQ----RESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAII---RAMG-QLKID 355
            MGC  S +   +E+    ++K  + +I +  Q    R+ + IK+LLLGAGESGKST++KQ+K+++  G++  E LQY  +++++ +QS+  +I   R +G QL  D
Sbjct:    1 MGCTVSTQTIGDESDPFLQNKRANDVIEQSLQLEKQRDKNEIKLLLLGAGESGKSTVLKQLKLLHQGGFSHQERLQYAQVIWADAIQSMKILIIQARKLGIQLDCD 106          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Nematostella
Match: EDO49692 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG04])

HSP 1 Score: 462.225 bits (1188), Expect = 1.874e-163
Identity = 212/348 (60.92%), Postives = 275/348 (79.02%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKE-KIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            MGC  S E +A   +SK IDK +  D +R +  +K+LLLGAGESGKSTIVKQMKII+ +GY+K+EC QYK +V+SNT+QS+ AIIRAMG LKI+F   +  +DAR++F+L  ++E+   + ++ + M+RLW+D G+  CF RSREYQLNDSA Y+LN++ RL +PDY+PTEQDVL TRVKTTGIVET  TFK L+ K+ DVGGQRSER+KWIHCFEGV  +I+  ++S YD  L ED E+NRM ES+KLFDS+CNN+WF+  SIILFLNK DLF  KIVKSPLT+CFPEY G+N +E+A+ Y++M FE LNK+K+ K IY+HFTCATDT+NI +VF+ +TD II  N+
Sbjct:    1 MGCTLSAEDKAAAERSKMIDKNLRADGERAAREVKLLLLGAGESGKSTIVKQMKIIHEHGYSKEECTQYKQVVYSNTIQSMIAIIRAMGTLKIEFGHPDRADDAREMFALAGSMEDVKFTAELISIMKRLWSDSGIQACFARSREYQLNDSASYYLNALDRLGSPDYVPTEQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMMESMKLFDSICNNKWFTDTSIILFLNKKDLFAEKIVKSPLTICFPEYTGSNTYEEAAAYIQMQFENLNKRKDTKEIYTHFTCATDTNNIQFVFDAVTDVIIKNNL 348          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Nematostella
Match: EDO32540 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUS4])

HSP 1 Score: 386.341 bits (991), Expect = 1.581e-133
Identity = 186/350 (53.14%), Postives = 250/350 (71.43%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFS-LGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKEKIIYSHFTCATDTSNINYVFNVITDSIIVKNINA 1120
            MGC  S E RA   +SK I+K +  +  R    +K+LLLGAGESGKSTIVKQM+II+++G++ ++ +QY+P+VFSNT+ SL  IIRAM +L+IDF +   + DA+ +F  + +  +    + ++  +M+RLW D GV  CF RSREYQL DSA+Y+L+S+ R+  P+Y  TEQD+L TRVKTTGIVE    +K L+ K+ DVGGQRSER+KWIHCFE V  +IY  ++S YD  L ED   NRM ES+KLF+S+ NN+WF   S+ILFLNK DLF+ KI K PLT+CFPEY G + F++ ++Y+R  FE  N   EK IY+H TCATDT NIN+VFN +TD+II  N+  
Sbjct:    1 MGCTLSAEERAAIARSKAIEKNLKLEGARAERDVKLLLLGAGESGKSTIVKQMRIIHDHGFSPEDYIQYRPLVFSNTIYSLLTIIRAMDKLRIDFENDARLMDAKLVFDVIARADDTEPFTPELTESMERLWKDAGVQQCFHRSREYQLGDSAKYYLDSLQRIGAPNYEATEQDLLRTRVKTTGIVEVQFDYKRLHFKLFDVGGQRSERKKWIHCFEDVTAIIYCVALSAYDLTLEEDESTNRMEESLKLFESIINNKWFVDTSVILFLNKKDLFEEKISKFPLTLCFPEYSGPSTFDEGAKYIRKQFESKNLNDEKEIYTHLTCATDTQNINFVFNAVTDTIIANNLKG 350          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Nematostella
Match: EDO41465 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S470])

HSP 1 Score: 310.842 bits (795), Expect = 6.578e-104
Identity = 154/349 (44.13%), Postives = 225/349 (64.47%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSL-GKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNN-NFEDASEYVRMTFEMLNKKKEKIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            M C  S E +  +  + EI+K I +D + +   +K+LLLG GESGKST +KQM+II+  GY+ ++   Y P+V+ N + ++ ++ RAM  LKI +    ++E A  + ++  KN+       + + A + LW+D G+  C+ R REYQL+DSA+Y+L  + RL+ PDY+PTEQDVL  R  T+GI+E     + +  ++VDVGGQRSERRKWIHCFE V +++++ ++SEYDQ L+E +  NRM ES  LF ++    WF   SIILFLNK DL + KI+ S L   FPE+ G   + + A E++   F  LN   +KIIYSHFTCATDT NI +VF  + D+I+  N+
Sbjct:    1 MDCCLSEEAKERKRINAEIEKQIRQDKRNQRRELKLLLLGTGESGKSTFIKQMRIIHGQGYSDEDKRGYIPLVYQNIITAMHSLTRAMETLKIPYKDSSNLEKASYIRTVDPKNV--TTFEREYYEATKSLWSDAGMQECYDRRREYQLSDSAKYYLTDLDRLAKPDYLPTEQDVLRARAPTSGIIEYPFDLETIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDSENRMEESKALFRTIITYPWFQNSSIILFLNKKDLLEEKIMFSHLVEYFPEFDGPQCDAQAAREFILKMFVDLNPDTDKIIYSHFTCATDTENIRFVFAAVKDTILQLNL 347          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Nematostella
Match: EDO47993 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKI8])

HSP 1 Score: 282.337 bits (721), Expect = 9.133e-93
Identity = 139/353 (39.38%), Postives = 219/353 (62.04%), Query Frame = 2
Query:   77 GCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSEDIF----AAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGN-NNFEDASEYVRMTFEMLNKKKEKIIYSHFTCATDTSNINYVFNVITDSIIVKNINA 1120
            GC  + E      +S++IDK I+++  +    +KILLLGAGESGKST +KQM+II    +  D   +YKP+V+SN L+ +  +  A  +L+ID+ + ++   A ++ +L        +  + F     +++RLW D G+   F R RE+QL DS  YFL+ + R+   DYIPT+QD+LH+R  T GIVE     K +  K+VDVGGQRS+R KW  CF+ V +++++ S S YDQ L+ED   NR+ ES  +F+++ NN++F+  SIILFLNKTDL   K+  + +   FP ++G+ +  ED   ++   F+   +++ K ++ HFT A DT NI +VF+ + D+I+ +N+ A
Sbjct:    5 GCCLTQEEAEQRAQSQKIDKQIAQEKAQLRRQVKILLLGAGESGKSTFLKQMRIIYGKDFDADALQEYKPVVYSNILKGMKVLADARRKLRIDWDAPDNEMHAERILTLQA---PPRIDTEFFLQYAESVRRLWTDAGIRDSFDRRREFQLGDSTRYFLDHLDRICRADYIPTKQDMLHSRKATKGIVEHEFMIKSIPFKMVDVGGQRSQRAKWFQCFDEVTSILFLVSSSAYDQVLMEDRTTNRLVESCNIFETIVNNKFFANVSIILFLNKTDLLTEKVKHTNIKDFFPAFQGDPHKLEDVQNFILQMFDSKRRERSKALFHHFTTAVDTENIKFVFHAVKDTILQENLKA 354          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Nematostella
Match: EDO49193 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHA6])

HSP 1 Score: 215.312 bits (547), Expect = 2.379e-66
Identity = 132/337 (39.17%), Postives = 182/337 (54.01%), Query Frame = 2
Query:  167 STIKILLLGAGESGKSTIVKQMKIINN-NGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSE-----DIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIV--KSPLTVCFPEYKGNNNFEDAS------------------EYVRMTFEMLNKKKEKIIYSHFTCATDTSNINYVFNVITDSI 1099
            +T ++LLLGAGESGKSTIVKQM+I+++ +G+T+ E  Q    +  N   ++  I  AM  L         + +    F L    E A   +     + +   + LW D GVL C+ RS EYQL D A+YFL+ +  +   DY+PTEQD+L  RV T+GI+ET      +   + DVGGQR ERRKWI CF  V  +I+V + S Y+  L ED   NR+ ES++LF S+ NN+W    S+ILFLNK DL K K+   KS +   FP++       DA+                  E++R++    + K     Y HFTCA DT NI  VFN   D I
Sbjct:   39 ATHRLLLLGAGESGKSTIVKQMRILHDVHGFTELEKRQKIEDIKKNIRDAILTITGAMSTL----TPPVKLANPNNQFRLDYVHEVATAPDFDYPPEFYEHTKILWQDAGVLECYERSNEYQLIDCAQYFLDRVDTIQQQDYLPTEQDLLRCRVLTSGIIETRFEVDRVKFHMFDVGGQRDERRKWIQCFNDVTAIIFVVACSSYNLVLREDASQNRLKESLELFKSIWNNRWLRTISVILFLNKQDLLKDKVRAGKSKIEDYFPDFARYRTPPDATAEPGDEEAVTRAKYFIRDEFLRISTASGDGK--HYCYPHFTCAVDTENIRRVFNDCRDII 369          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Medaka
Match: gnai3 (Gi1 alpha subunit [Source:NCBI gene;Acc:100144384])

HSP 1 Score: 449.899 bits (1156), Expect = 3.071e-158
Identity = 208/348 (59.77%), Postives = 271/348 (77.87%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKE-KIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            MGC  S + +A + +SK ID+ +  D ++ +  +K+LLLGAGESGKSTIVKQMKII+  GY+++EC QYK +V+SNT+QS+ AIIRAMG+LKIDFA     +DAR+LF L  + EE  ++ ++   +QRLW D GV  CF+RSREYQLNDSA Y+LN + R+S+  Y+PT+QDVL TRVKTTGIVET  TFK L+ K+ DVGGQRSER+KWIHCFEGV  +I+  ++S+YD  L ED E+NRM ES+KLFDS+CNN+WF+  SIILFLNK DLF+ KI KSPLT+CFPEY G+N +E+A+ YV+  FE LNK+K+ K IY+HFTCATDT N+ +VF+ +TD II  N+
Sbjct:    1 MGCTLSTDDKAAQERSKMIDRNLRDDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFADQARADDARQLFILAGSTEEGFMTGELAGVIQRLWKDGGVQACFSRSREYQLNDSAAYYLNDLDRISHASYVPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICFPEYAGSNTYEEAAAYVQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNL 348          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Medaka
Match: ENSORLT00000020087.2 (guanine nucleotide-binding protein G(i) subunit alpha-1 [Source:NCBI gene;Acc:101157265])

HSP 1 Score: 446.047 bits (1146), Expect = 1.261e-156
Identity = 205/348 (58.91%), Postives = 271/348 (77.87%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKE-KIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            MGC  S E +A   +SK ID+ +  D ++ +  +K+LLLGAGESGKSTIVKQMKII+  GY+++EC QYK +V+SNT+QS+ AIIRAMG+LKIDF      EDAR+LF L  + EE  ++ ++   ++RLW+DDGV  CF+RSREYQLNDSA Y+LN + R+S  +YIPT+QDVL TRVKTTGIVET  TFK L+ K+ DVGGQRSER+KWIHCFEGV  +I+  ++S+YD  L ED E+NRM ES+KLFDS+CNN+WF+  SIILFLNK DLF+ KI +SPL++C+PEY G+N +E+A+ Y++  FE LNK+++ K IY+HFTCATDT N+ +VF+ +TD II  N+
Sbjct:    1 MGCTLSTEDKAAVERSKMIDRNLRDDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFKDSSRAEDARQLFVLAGSAEEGSMTTELAGVIKRLWSDDGVQACFSRSREYQLNDSAAYYLNDLDRISQANYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLSICYPEYAGSNTYEEAAAYIQCQFEDLNKRRDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNL 348          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Medaka
Match: gnai2b (guanine nucleotide-binding protein G(i) subunit alpha-2 [Source:NCBI gene;Acc:105358374])

HSP 1 Score: 441.039 bits (1133), Expect = 1.010e-154
Identity = 204/349 (58.45%), Postives = 268/349 (76.79%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEE-AVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKE-KIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            MGC  S E +A   +SK IDK +  D ++ +  +K+LLLGAGESGKSTIVKQMKII+ +GY++DEC QY+ +V+SNT+QS+ AI++AM  LKID++    ++DA++LF+L    EE  +L +D+   M+RLW D G+  CFTRSREYQLNDSA Y+LN + R++  DYIPT+QDVL TRVKTTGIVET  TFK L+ K+ DVGGQRSER+KWIHCFEGV  +I+  ++S YD  L ED E+NRM ES+KLFDS+CNN+WF++ SIILFLNK DLF+ KI  SPL++CFPEY G N F++A+ Y++  FE LNKKK+   IY+HFTCATDT N+ +VF+ +TD II  N+
Sbjct:    1 MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYRAVVYSNTIQSIMAIVKAMASLKIDYSDPARMDDAQQLFALSAAAEEQGILPDDLANVMRRLWADSGIQSCFTRSREYQLNDSAAYYLNDLERIAKADYIPTQQDVLRTRVKTTGIVETHFTFKELHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKITHSPLSICFPEYSGANKFDEAASYIQTKFEDLNKKKDTNEIYTHFTCATDTKNVQFVFDAVTDVIIKNNL 349          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Medaka
Match: gnai3 (guanine nucleotide-binding protein G(k) subunit alpha [Source:NCBI gene;Acc:101158355])

HSP 1 Score: 437.187 bits (1123), Expect = 3.959e-153
Identity = 204/348 (58.62%), Postives = 267/348 (76.72%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKE-KIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            MGC  S E +A   +SK IDK +  D ++ S  +K+LLLGAGESGKSTIVKQMKII+ +GY+++EC QYK +V+SNT+QS+ AIIRAMGQL IDF +    +DAR+LF+L    +E V+S ++   ++RLWND GV  CF RSREYQLNDSA Y+LN + R+   +Y+PT+QDVL TRVKTTGIVET  TFK L  K+ DVGGQRSER+KWIHCFEGV  +I+  ++S+YD  L ED E+NRM ES+KLFDS+CNN+WF+  SIILFLNK DLF+ KI +SPLT+C+PEY G + +++ + Y++  FE LNK+K+ K IY+HFTCATDT N+ +VF+ +TD II  N+
Sbjct:    1 MGCTISAEDKAAVERSKMIDKNLREDREKSSREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEEECKQYKVVVYSNTIQSIMAIIRAMGQLNIDFGNAAREDDARQLFALASTADEGVMSAELTGVIRRLWNDSGVQACFDRSREYQLNDSAAYYLNDLDRICELNYVPTQQDVLRTRVKTTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTLTSIILFLNKKDLFEEKIGRSPLTICYPEYTGGSTYDETAAYIQCRFEDLNKRKDIKEIYTHFTCATDTKNVQFVFDAVTDVIIKINL 348          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Medaka
Match: gnai2 (guanine nucleotide-binding protein G(i) subunit alpha 2 [Source:NCBI gene;Acc:100125814])

HSP 1 Score: 433.335 bits (1113), Expect = 1.351e-151
Identity = 203/349 (58.17%), Postives = 264/349 (75.64%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEE-AVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKE-KIIYSHFTCATDTSNINYVFNVITDSIIVKNI 1114
            MGC  S E +A  ++SK IDK +  D ++ +  +K+LLLGAGESGKSTIVKQMKII+ +GY++DEC QY+ +V+SNT+QS+ AII+AM  L +D+   E  EDA++LF +    EE   L E++   ++ LW D G+  C TR+REYQLNDSA Y+L  + R+S PDYIPT+QDVL TRVKTTGIVET  TFK L+ K+ DVGGQRSER+KWIHCFEGV  +I+  ++S YD  L ED E+NRM ES+KLFDS+CNN+WF++ SIILFLNK DLF+ KI  SPLT+CFPEY+G N +++A  Y++  FE LNKKKE K IY+HFTCATDT N+ +VF+ +TD II  N+
Sbjct:    1 MGCTVSQEDKAAADRSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYRAVVYSNTVQSIMAIIKAMTILHLDYERPEREEDAKRLFKMAAEAEERGDLPEELANIIKDLWADSGIQHCLTRAREYQLNDSAAYYLKDLERISKPDYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVAMSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEQKIAHSPLTICFPEYEGPNTYQEAQAYIQTKFEDLNKKKETKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNL 349          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Planmine SMEST
Match: SMESG000081983.1 (SMESG000081983.1)

HSP 1 Score: 716.842 bits (1849), Expect = 0.000e+0
Identity = 349/349 (100.00%), Postives = 349/349 (100.00%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKEKIIYSHFTCATDTSNINYVFNVITDSIIVKNINA 1120
            MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKEKIIYSHFTCATDTSNINYVFNVITDSIIVKNINA
Sbjct:    1 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKEKIIYSHFTCATDTSNINYVFNVITDSIIVKNINA 349          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Planmine SMEST
Match: SMESG000081983.1 (SMESG000081983.1)

HSP 1 Score: 604.364 bits (1557), Expect = 0.000e+0
Identity = 293/293 (100.00%), Postives = 293/293 (100.00%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGN 952
            MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGN
Sbjct:    1 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGN 293          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Planmine SMEST
Match: SMESG000055191.1 (SMESG000055191.1)

HSP 1 Score: 405.601 bits (1041), Expect = 6.509e-141
Identity = 195/350 (55.71%), Postives = 250/350 (71.43%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEA-VLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKEKIIYSHFTCATDTSNINYVFNVITDSIIVKNINA 1120
            MGC  S + R   +KS+ IDK +  D  + +  +K+LLLGAGESGKSTIVKQMKII+  G+T+++  QYKP+V+SNT QS+ AI+RAM  L I F  ++   DA+ +  + + +E+    SE++  AM+RLW D GV  CF RS EYQLNDSA+YFL+ + RL   DY+PTEQD+L TRVKTTGIVE    FK +N K+ DVGGQRSER+KWIHCFE V  +I+  ++SEYDQ L ED   NRM ES+KLFDS+CNN+WF+  SIILFLNK DLF  KI KSPLTVCFPEY G   +E+A+ Y++ +FE  N    K IY H TCATDT+NI +VF+ +TD II  N+  
Sbjct:    1 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRG 350          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Planmine SMEST
Match: SMESG000055191.1 (SMESG000055191.1)

HSP 1 Score: 399.053 bits (1024), Expect = 2.241e-138
Identity = 192/345 (55.65%), Postives = 247/345 (71.59%), Query Frame = 2
Query:   89 SNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEA-VLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKEKIIYSHFTCATDTSNINYVFNVITDSIIVKNINA 1120
            S + R   +KS+ IDK +  D  + +  +K+LLLGAGESGKSTIVKQMKII+  G+T+++  QYKP+V+SNT QS+ AI+RAM  L I F  ++   DA+ +  + + +E+    SE++  AM+RLW D GV  CF RS EYQLNDSA+YFL+ + RL   DY+PTEQD+L TRVKTTGIVE    FK +N K+ DVGGQRSER+KWIHCFE V  +I+  ++SEYDQ L ED   NRM ES+KLFDS+CNN+WF+  SIILFLNK DLF  KI KSPLTVCFPEY G   +E+A+ Y++ +FE  N    K IY H TCATDT+NI +VF+ +TD II  N+  
Sbjct:    2 SKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRG 346          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Planmine SMEST
Match: SMESG000026676.1 (SMESG000026676.1)

HSP 1 Score: 397.127 bits (1019), Expect = 1.793e-137
Identity = 192/350 (54.86%), Postives = 247/350 (70.57%), Query Frame = 2
Query:   74 MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEEA-VLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNKKKEKIIYSHFTCATDTSNINYVFNVITDSIIVKNINA 1120
            MGC  S + R   +KS+ IDK +  D  + +  +K+LLLGAGESGKSTIVKQMKII+  G+T ++  QYKP+V+SNT QS+ AI+RAM  L I F   +   DA+ +  + + +E+    SE++  A +RLW D GV  CF RS EYQLNDSA+YFL+ I RL   DY+PTEQD+L TR+KTTGIVE    FK +N K+ DVGGQRSER+KWIHCFE V  +I+  ++SEYDQ L ED   NRM ES+KLFDS+CNN+WF++ SIILFLNK DLF  KI +SPLTVCF EY G   +E+A+ Y++ +FE  N    K IY H TCATDT+NI +VF+ +TD II  N+  
Sbjct:    1 MGCALSKDEREALDKSRNIDKKLKEDGVQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTNEDNKQYKPVVYSNTTQSMIAILRAMTTLNISFGDPDRSADAKIVSDVIQAMEDTEPFSEELLEATKRLWADSGVQECFNRSNEYQLNDSAKYFLDDIDRLGAGDYMPTEQDILRTRIKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTQTSIILFLNKKDLFAEKIKRSPLTVCFSEYTGRQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRG 350          
The following BLAST results are available for this feature:
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GNAI31.334e-15659.20G protein subunit alpha i3 [Source:HGNC Symbol;Acc... [more]
GNAI11.504e-15659.20G protein subunit alpha i1 [Source:HGNC Symbol;Acc... [more]
GNAI11.504e-15659.20G protein subunit alpha i1 [Source:HGNC Symbol;Acc... [more]
GNAI11.504e-15659.20G protein subunit alpha i1 [Source:HGNC Symbol;Acc... [more]
GNAI11.504e-15659.20G protein subunit alpha i1 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
goa-16.072e-14356.29Guanine nucleotide-binding protein G(o) subunit al... [more]
gpa-162.715e-13654.42Guanine nucleotide-binding protein alpha-16 subuni... [more]
gpa-71.614e-13050.29Guanine nucleotide-binding protein alpha-7 subunit... [more]
gpa-41.673e-12550.85Guanine nucleotide-binding protein alpha-4 subunit... [more]
gpa-38.486e-11245.43Guanine nucleotide-binding protein alpha-3 subunit... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Galphai3.950e-14857.71gene:FBgn0001104 transcript:FBtr0076934[more]
Galphao3.958e-14456.57gene:FBgn0001122 transcript:FBtr0088267[more]
Galphao3.958e-14456.57gene:FBgn0001122 transcript:FBtr0088269[more]
Galphao3.958e-14456.57gene:FBgn0001122 transcript:FBtr0088264[more]
Galphao3.958e-14456.57gene:FBgn0001122 transcript:FBtr0088268[more]
back to top
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gnai39.031e-15860.34guanine nucleotide binding protein (G protein), al... [more]
gnai2b4.525e-15659.03guanine nucleotide binding protein (G protein), al... [more]
gnai13.927e-15558.91guanine nucleotide binding protein (G protein), al... [more]
gnaia8.320e-15558.33guanine nucleotide binding protein (G protein), al... [more]
gnaia8.320e-15558.33guanine nucleotide binding protein (G protein), al... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rgp15.269e-15759.48RGP1 homolog, RAB6A GEF complex partner 1 [Source:... [more]
gnai29.660e-15658.45guanine nucleotide binding protein (G protein), al... [more]
gnai15.438e-15558.47guanine nucleotide binding protein (G protein), al... [more]
gnai15.370e-15458.62guanine nucleotide binding protein (G protein), al... [more]
rgp11.716e-14255.87RGP1 homolog, RAB6A GEF complex partner 1 [Source:... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gnai11.032e-15659.20guanine nucleotide binding protein (G protein), al... [more]
Gnai35.202e-15658.91guanine nucleotide binding protein (G protein), al... [more]
Gnai24.033e-15458.74guanine nucleotide binding protein (G protein), al... [more]
Gnai24.033e-15458.74guanine nucleotide binding protein (G protein), al... [more]
Gnat39.889e-14554.31guanine nucleotide binding protein, alpha transduc... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P30682|GNAI_LYMST2.353e-16461.78Guanine nucleotide-binding protein G(i) subunit al... [more]
sp|P51876|GNAI_PLATR4.603e-16361.21Guanine nucleotide-binding protein G(i) subunit al... [more]
sp|P30676|GNAI_PATPE5.212e-16261.21Guanine nucleotide-binding protein G(i) subunit al... [more]
sp|P41776|GNAI_HOMAM1.346e-15660.46Guanine nucleotide-binding protein G(i) subunit al... [more]
sp|P10824|GNAI1_RAT4.981e-15659.20Guanine nucleotide-binding protein G(i) subunit al... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
M9V1315.891e-16564.66G protein subunit alpha i OS=Terebratalia transver... [more]
R7V8M39.557e-16562.93Uncharacterized protein OS=Capitella teleta OX=283... [more]
Q0ZA021.111e-16262.07Guanine nucleotide-binding protein G(I) alpha subu... [more]
V4AZH11.226e-16262.64Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A2H4WCW23.865e-16262.36Gi-alpha OS=Argopecten irradians OX=31199 GN=Gi-al... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gnaia6.036e-15758.91guanine nucleotide-binding protein G(i) subunit al... [more]
gnai2b6.302e-15458.74guanine nucleotide-binding protein G(i) subunit al... [more]
gnai2a1.162e-14759.89guanine nucleotide-binding protein G(i) subunit al... [more]
ENSAMXT00000018576.23.361e-14255.81pep primary_assembly:Astyanax_mexicanus-2.0:7:2557... [more]
gnao1a1.010e-13954.60G protein subunit alpha o1 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gnai32.030e-15658.33guanine nucleotide binding protein (G protein), al... [more]
ENSPMAT00000004355.11.531e-14662.03pep scaffold:Pmarinus_7.0:GL477714:209323:228779:-... [more]
gnat26.570e-13754.65guanine nucleotide binding protein (G protein), al... [more]
ENSPMAT00000007349.17.247e-9344.13pep scaffold:Pmarinus_7.0:GL488470:4533:13151:-1 g... [more]
ENSPMAT00000007354.11.763e-9243.95pep scaffold:Pmarinus_7.0:GL488470:4533:13151:-1 g... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
GPA21.296e-7739.87Nucleotide binding alpha subunit of the heterotrim... [more]
GPA19.413e-7046.12Subunit of the G protein involved in pheromone res... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO496921.874e-16360.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO325401.581e-13353.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414656.578e-10444.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479939.133e-9339.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491932.379e-6639.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gnai33.071e-15859.77Gi1 alpha subunit [Source:NCBI gene;Acc:100144384][more]
ENSORLT00000020087.21.261e-15658.91guanine nucleotide-binding protein G(i) subunit al... [more]
gnai2b1.010e-15458.45guanine nucleotide-binding protein G(i) subunit al... [more]
gnai33.959e-15358.62guanine nucleotide-binding protein G(k) subunit al... [more]
gnai21.351e-15158.17guanine nucleotide-binding protein G(i) subunit al... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081983.10.000e+0100.00SMESG000081983.1[more]
SMESG000081983.10.000e+0100.00SMESG000081983.1[more]
SMESG000055191.16.509e-14155.71SMESG000055191.1[more]
SMESG000055191.12.241e-13855.65SMESG000055191.1[more]
SMESG000026676.11.793e-13754.86SMESG000026676.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035889 ID=SMED30035889|Name=Guanine nucleotide-binding protein G(i) subunit alpha|organism=Schmidtea mediterranea sexual|type=transcript|length=1193bp
TTCCGATCTATTTGTGCTAAAGGTTCTTTCATGTATTAGGTATTCATAAC
AATATTTAGTACAAACAATAGTGATGGGTTGTATTCCTAGTAATGAAGTT
CGTGCTAATGAAAACAAATCTAAAGAAATAGACAAATTAATATCTAGAGA
TTTTCAGAGAGAGAGTTCTACCATCAAAATATTATTACTTGGAGCTGGAG
AGTCAGGTAAAAGTACTATTGTGAAGCAAATGAAAATTATAAATAATAAT
GGTTACACAAAAGATGAGTGCTTACAATATAAACCTATTGTTTTTAGCAA
CACTCTTCAAAGTTTAACTGCAATAATAAGAGCAATGGGACAACTTAAGA
TTGATTTTGCAAGTCTAGAAAGCATAGAAGATGCTCGTAAACTATTTTCA
TTGGGAAAAAACATTGAAGAGGCTGTGCTAAGTGAGGATATTTTCGCAGC
AATGCAACGTTTATGGAATGACGATGGGGTTCTTGTATGTTTTACAAGGT
CACGAGAATACCAATTAAATGATTCAGCTGAATATTTTCTCAATTCCATT
GGAAGGTTATCGAATCCAGATTATATACCCACAGAACAAGATGTTTTACA
TACGCGTGTTAAAACTACAGGGATCGTAGAAACGCTTGTAACTTTCAAAG
GATTGAATTTAAAAATAGTGGATGTTGGTGGACAAAGGTCGGAACGAAGA
AAATGGATTCATTGTTTCGAAGGAGTTATGACAATGATATATGTAGCTTC
TATTAGTGAATACGATCAATTTCTCATTGAAGATAATGAAATAAATAGAA
TGTTTGAATCAATCAAACTTTTTGACTCCGTTTGCAATAATCAATGGTTT
TCTAAATGTTCTATAATATTATTTCTTAACAAAACGGATTTATTTAAGTT
GAAAATAGTTAAATCTCCTTTAACTGTTTGTTTTCCAGAATATAAAGGTA
ATAATAACTTTGAAGATGCTTCTGAATACGTTAGAATGACATTTGAAATG
TTGAATAAAAAAAAAGAGAAAATTATATACAGCCATTTTACATGTGCAAC
TGACACGTCTAATATAAATTACGTTTTCAATGTAATAACAGATAGCATTA
TTGTGAAAAATATCAACGCTATTGGCATTTTTTAATAATTAAAATTTATA
ATAATTTAATTGAATTCTATTTGTGTATTTGGCAGATCGGAAG
back to top

protein sequence of SMED30035889-orf-1

>SMED30035889-orf-1 ID=SMED30035889-orf-1|Name=SMED30035889-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=354bp
MGCIPSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIV
KQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLES
IEDARKLFSLGKNIEEAVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLND
SAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVD
VGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLF
DSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDAS
EYVRMTFEMLNKKKEKIIYSHFTCATDTSNINYVFNVITDSIIVKNINAI
GIF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001019Gprotein_alpha_su
IPR001408Gprotein_alpha_I
IPR011025GproteinA_insert
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0004871signal transducer activity
GO:0003924GTPase activity
GO:0031683G-protein beta/gamma-subunit complex binding
GO:0019001guanyl nucleotide binding
GO:0005525GTP binding
GO:0000166nucleotide binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007188adenylate cyclase-modulating G-protein coupled receptor signaling pathway
GO:0007165signal transduction