TNF receptor associated factor-2

Overview
NameTNF receptor associated factor-2
Smed IDSMED30035887
Length (bp)1102
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor associated factor-2 (SMED30035887) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor associated factor-2 (SMED30035887) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor associated factor-2 (SMED30035887) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor associated factor-2 (SMED30035887) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035887

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30035887h1SMcG0015077 Contig1182GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30035887h1SMcG0015077 Contig1182GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
ovarySMED30035887h1SMcG0015077 SMED30035887smed_20140614PMID:279364
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30035887h1SMcG0015077 SMED30035887smed_20140614PMID:279364
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor associated factor-2 vs. TrEMBL
Match: I1ZID8 (TNF receptor associated factor-2 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 7.915e-29
Identity = 70/195 (35.90%), Postives = 109/195 (55.90%), Query Frame = 1
Query:  139 EDMWKMLGKYNFDIDPQLQINLKCLICKRLLVDACCGLCYCSYCRKCITPYLSR-NRKCPGNKPDCQIEQLSL-EEIIDDSTANARISEIIVSCPADGCIYRDKLLTIYNHFRVCDKKSIPCPFNEMGCMKSDIKNDEISVHLRNEIYDHSQLLIDWIRNMKNEMTTLI-----------VLKQQETAQNELKKL 684
            E + ++L  YNF+++  +  NLKC +CK LLV+AC   C C +C KCI  Y+SR N  CPG   +C+ E L++   I  D   N +I+++ V CP + C    +L+ I  H R+C  KS  CPF  +GC +  +   +++ HL+N  + HS+L+ID I NM+N+   L            ++K    +QNE+  L
Sbjct:    4 EKINRLLITYNFEVEGGVPDNLKCDLCKNLLVNACQSRCGCRFCSKCIMEYVSRGNLYCPGGTSECKEENLTICSNIHTDYRVNRKIAKMRVKCPEETCKVYCELVDIEEHLRLCTMKSQNCPFFVLGCNQPKMVIQDLTNHLQNGTFQHSKLIIDIISNMRNDFFGLTTKEVELREDINLIKNHFQSQNEIMML 198          
BLAST of TNF receptor associated factor-2 vs. TrEMBL
Match: T1E101 (TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 2.926e-27
Identity = 78/269 (29.00%), Postives = 152/269 (56.51%), Query Frame = 1
Query:  133 KFEDMWKMLGKYNFD-IDPQLQINLKCLICKRLLVDACCGLCYCSYCRKCITPYLSRNRK-CPGNKPDCQIEQLSLE-EIIDDSTANARISEIIVSCPADGCIYRDKLLTIYNHFRVCDKKSIPCPFNEMGCMKSDIKNDEISVHLRNEIYDHSQLLIDWIRNMKNEMTTLIVLKQQETAQNELKKLEKTIEDKIEEAFNYEEEQQRNEELFRDLKDQLNII---TNNTGELERKIMSIKSNNERDLSFLFESRKKLGEEINQLMNDAD 921
            K +++ ++L KYN   +D  +  +L C++C +L+ DAC   C C YC  CI  YLS+N   CPG+K +C+ + L+LE ++  +   + RIS I+V CP   C Y  +LL +  H   C  +S+ CP   +GC +  +  DE++ HL +++  H+QL++ +   +K+E+         ET + ++  L++ +  ++++A N E+  Q  E L  +L+++ N+I   + +  E++ +++++ ++ E +L  L    +   +EI  + ND +
Sbjct:    5 KLDNVQELLSKYNVKRVDESVNNDLLCILCNKLMRDACESACGCHYCYTCIRIYLSQNHNYCPGDKTECKEDYLNLEGDVFRNIRLSTRISRIVVKCPNIRCNYTSELLRLKEHLDKCTPESVECPCVTIGCEEEPLLKDEMAKHLTDQVLRHTQLIMSFCNELKSEIN-----HNNETTKEDISHLKEVL--RVQKALNDEKTAQM-EFLIEELRNKDNMILVLSQDIQEVKNEMITLLTSKESELKKLKSDIQIFRQEIEFMKNDLE 265          
BLAST of TNF receptor associated factor-2 vs. TrEMBL
Match: A0A0F7GWW3 (TNF receptor associated factor 4 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 9.079e-13
Identity = 38/107 (35.51%), Postives = 63/107 (58.88%), Query Frame = 1
Query:  355 EEIIDDSTANARISEIIVSCPADGCIYRDKLLTIYNHFRVCDKKSIPCPFNEMGCMKSDIKNDEISVHLRNEIYDHSQLLIDWIRNMKNEMTTLIVLKQQETAQNEL 675
            E I  D   N +I+++ V C    C Y D+L  + +H R C  +S+ CP++ +GC K +I  D+++ HL++EI+ H++LL+D++ N  NEM  L       +  NEL
Sbjct:   14 ENICVDYPMNMKIAKLQVKCKEKSCDYVDELRKMEDHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFVHTKLLMDFVVNFNNEMEMLKANNNGLSPVNEL 120          
BLAST of TNF receptor associated factor-2 vs. TrEMBL
Match: A0A3B4AEN3 (TNF receptor-associated factor OS=Periophthalmus magnuspinnatus OX=409849 PE=3 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 8.932e-8
Identity = 38/126 (30.16%), Postives = 63/126 (50.00%), Query Frame = 1
Query:  166 YNFDIDPQLQINLKCLICKRLLVDACCGLCYCSYCRKCITPYL-SRNRKCPGNKPDCQIEQLSLEEIIDDSTANARISEIIVSCPADGCIYRDKLLTIYNHFRVCDKKSIPCPFNEMGCMKSDIKN 540
            Y+ + DP L+   +C IC   L +A    C   +C+ CI   +    +KCP +      E LS +++  D+ A   I  + V CP  GC ++ +L T+ NH  VC+  ++PCP  +    KS ++ 
Sbjct:   64 YDVEFDPPLESKYECPICLMALRNAVQTPCGHRFCKNCIEKSIRDTGQKCPVDN-----EMLSEDQLFPDNFAKREILSLTVRCPYPGCSHKMELRTLENHLSVCEFSTLPCPHCQRAVRKSFVEQ 184          
BLAST of TNF receptor associated factor-2 vs. TrEMBL
Match: A0A3B4AEF3 (TNF receptor-associated factor OS=Periophthalmus magnuspinnatus OX=409849 PE=3 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 1.244e-7
Identity = 38/126 (30.16%), Postives = 63/126 (50.00%), Query Frame = 1
Query:  166 YNFDIDPQLQINLKCLICKRLLVDACCGLCYCSYCRKCITPYL-SRNRKCPGNKPDCQIEQLSLEEIIDDSTANARISEIIVSCPADGCIYRDKLLTIYNHFRVCDKKSIPCPFNEMGCMKSDIKN 540
            Y+ + DP L+   +C IC   L +A    C   +C+ CI   +    +KCP +      E LS +++  D+ A   I  + V CP  GC ++ +L T+ NH  VC+  ++PCP  +    KS ++ 
Sbjct:   64 YDVEFDPPLESKYECPICLMALRNAVQTPCGHRFCKNCIEKSIRDTGQKCPVDN-----EMLSEDQLFPDNFAKREILSLTVRCPYPGCSHKMELRTLENHLSVCEFSTLPCPHCQRAVRKSFVEQ 184          
BLAST of TNF receptor associated factor-2 vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 51.2174 bits (121), Expect = 1.077e-6
Identity = 38/128 (29.69%), Postives = 61/128 (47.66%), Query Frame = 1
Query:  166 YNFDIDPQLQINLKCLICK---RLLVDACCGLCYCSYC-RKCITPYLSRNRKCPGNKPDCQIEQLSLEEIIDDSTANARISEIIVSCPADGCIYRDKLLTIYNHFRVCDKKSIPCPFNEMGCMKSDIK 537
            Y+ D DP L+   +C IC    R  V   CG  +C+ C RK I       +KCP +      E L+ +++  D+ A   I  + V C   GC+ + +L  + NH   C   ++PCP  +    KS+++
Sbjct:   56 YDVDFDPPLESKYECPICLMGLRSAVQTPCGHRFCNCCIRKSIR---DTGQKCPVDN-----EVLTEDQLFPDNFAKREILSLTVRCRNVGCMEKMELRHLENHIPHCKFATVPCPQCQESVWKSELE 175          
BLAST of TNF receptor associated factor-2 vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 51.2174 bits (121), Expect = 1.193e-6
Identity = 38/128 (29.69%), Postives = 61/128 (47.66%), Query Frame = 1
Query:  166 YNFDIDPQLQINLKCLICK---RLLVDACCGLCYCSYC-RKCITPYLSRNRKCPGNKPDCQIEQLSLEEIIDDSTANARISEIIVSCPADGCIYRDKLLTIYNHFRVCDKKSIPCPFNEMGCMKSDIK 537
            Y+ D DP L+   +C IC    R  V   CG  +C+ C RK I       +KCP +      E L+ +++  D+ A   I  + V C   GC+ + +L  + NH   C   ++PCP  +    KS+++
Sbjct:   56 YDVDFDPPLESKYECPICLMGLRSAVQTPCGHRFCNCCIRKSIR---DTGQKCPVDN-----EVLTEDQLFPDNFAKREILSLTVRCRNVGCMEKMELRHLENHIPHCKFATVPCPQCQESVWKSELE 175          
BLAST of TNF receptor associated factor-2 vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 51.2174 bits (121), Expect = 1.193e-6
Identity = 38/128 (29.69%), Postives = 61/128 (47.66%), Query Frame = 1
Query:  166 YNFDIDPQLQINLKCLICK---RLLVDACCGLCYCSYC-RKCITPYLSRNRKCPGNKPDCQIEQLSLEEIIDDSTANARISEIIVSCPADGCIYRDKLLTIYNHFRVCDKKSIPCPFNEMGCMKSDIK 537
            Y+ D DP L+   +C IC    R  V   CG  +C+ C RK I       +KCP +      E L+ +++  D+ A   I  + V C   GC+ + +L  + NH   C   ++PCP  +    KS+++
Sbjct:   56 YDVDFDPPLESKYECPICLMGLRSAVQTPCGHRFCNCCIRKSIR---DTGQKCPVDN-----EVLTEDQLFPDNFAKREILSLTVRCRNVGCMEKMELRHLENHIPHCKFATVPCPQCQESVWKSELE 175          
BLAST of TNF receptor associated factor-2 vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 49.6766 bits (117), Expect = 3.555e-6
Identity = 37/123 (30.08%), Postives = 55/123 (44.72%), Query Frame = 1
Query:  175 DIDPQLQINLKCLICKRLLVDACCGLCYCSYCRKCITPYLSRNR-----KC---PGNKPDCQIEQLSLEEIIDDSTANARISEIIVSCPADGCIYRDKLLTIYNHFRVCDKKSIPCPFNEMGC 519
            D+ P   ++  C  C  +L +A    C   YCR C+   L  N+     KC   PG++ D  +  L+L+    D+  N  I E+ V C   GC +R  L    +H   C+   IPC    +GC
Sbjct:   21 DLPP---VHFLCSSCNNVLNEAHQTQCGHRYCRACVMWLLRNNKDLICTKCKEDPGSESDSSM-MLTLDHFFSDNAINKEIQELRVHCVNQGCGWRSTLKDFEDHQSQCEYALIPC---NIGC 136          
BLAST of TNF receptor associated factor-2 vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 49.2914 bits (116), Expect = 3.870e-6
Identity = 37/123 (30.08%), Postives = 55/123 (44.72%), Query Frame = 1
Query:  175 DIDPQLQINLKCLICKRLLVDACCGLCYCSYCRKCITPYLSRNR-----KC---PGNKPDCQIEQLSLEEIIDDSTANARISEIIVSCPADGCIYRDKLLTIYNHFRVCDKKSIPCPFNEMGC 519
            D+ P   ++  C  C  +L +A    C   YCR C+   L  N+     KC   PG++ D  +  L+L+    D+  N  I E+ V C   GC +R  L    +H   C+   IPC    +GC
Sbjct:   21 DLPP---VHFLCSSCNNVLNEAHQTQCGHRYCRACVMWLLRNNKDLICTKCKEDPGSESDSSM-MLTLDHFFSDNAINKEIQELRVHCVNQGCGWRSTLKDFEDHQSQCEYALIPC---NIGC 136          
BLAST of TNF receptor associated factor-2 vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 48.9062 bits (115), Expect = 1.151e-6
Identity = 36/129 (27.91%), Postives = 54/129 (41.86%), Query Frame = 1
Query:  166 YNFDIDPQLQINLKCLICKRLLVDACCGLCYCSYCRKCITPYLSRNRKCPGNKPDCQIEQLSLEE--IIDDSTANARISEIIVSCPADGCIYRDKLLTIYNHFRVCDKKSIPCPFNEMGCMKSDIKNDE 546
            Y  D +P L+   +C IC   L +     C   +CR CI  +  R R      P C ++   L E  +  D+ A   I  + V CP   C +R +L  +  H   C+   +PC   EM   + D+   E
Sbjct:   51 YEADFEPPLESKYECPICLMALREPVQTPCGHRFCRACIL-HSMRLRDA---GPKCPVDNAVLHEGQLFPDNFAKREILSLTVRCPNKPCGHRGELRALQEHQLRCEYAQVPCVRCEMPVCRRDLAKHE 175          
BLAST of TNF receptor associated factor-2 vs. Ensembl Medaka
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:101161132])

HSP 1 Score: 48.521 bits (114), Expect = 8.113e-6
Identity = 34/131 (25.95%), Postives = 56/131 (42.75%), Query Frame = 1
Query:  109 N*SMSMNEKFEDMWKMLGKYNFDIDPQLQINLKCLICKRLLVDACCGLCYCSYCRKCITPYL-SRNRKCPGNKPDCQIEQLSLEEIIDDSTANARISEIIVSCPADGCIYRDKLLTIYNHFRVCDKKSIPC 498
            N + SM          L  Y+ + DP L+   +C IC   L +A    C   +C+ CI   +    ++CP +      E LS +++  D+ A   I  + V CP   C  + +L  +  H   C   ++PC
Sbjct:   45 NPTASMGSSSLQAAAPLQGYDVEFDPPLESKYECPICLMALRNAIQTRCGHRFCKSCIEKSIRDTGQRCPVDN-----EMLSEDQLFPDNFAKREILSLTVRCPNSDCGEKMELRHLEKHLAQCQFATVPC 170          
BLAST of TNF receptor associated factor-2 vs. Planmine SMEST
Match: SMESG000020851.1 (SMESG000020851.1)

HSP 1 Score: 563.918 bits (1452), Expect = 0.000e+0
Identity = 276/277 (99.64%), Postives = 276/277 (99.64%), Query Frame = 1
Query:  118 MSMNEKFEDMWKMLGKYNFDIDPQLQINLKCLICKRLLVDACCGLCYCSYCRKCITPYLSRNRKCPGNKPDCQIEQLSLEEIIDDSTANARISEIIVSCPADGCIYRDKLLTIYNHFRVCDKKSIPCPFNEMGCMKSDIKNDEISVHLRNEIYDHSQLLIDWIRNMKNEMTTLIVLKQQETAQNELKKLEKTIEDKIEEAFNYEEEQQRNEELFRDLKDQLNIITNNTGELERKIMSIKSNNERDLSFLFESRKKLGEEINQLMNDADRHSSEVQLA 948
            MSMNEKFEDMWKMLGKYNFDIDPQLQINLKCLICKRLLVDACCGLCYCSYCRKCITPYLSRNRKCPGNKPDCQIEQLSLEEIIDDS ANARISEIIVSCPADGCIYRDKLLTIYNHFRVCDKKSIPCPFNEMGCMKSDIKNDEISVHLRNEIYDHSQLLIDWIRNMKNEMTTLIVLKQQETAQNELKKLEKTIEDKIEEAFNYEEEQQRNEELFRDLKDQLNIITNNTGELERKIMSIKSNNERDLSFLFESRKKLGEEINQLMNDADRHSSEVQLA
Sbjct:    1 MSMNEKFEDMWKMLGKYNFDIDPQLQINLKCLICKRLLVDACCGLCYCSYCRKCITPYLSRNRKCPGNKPDCQIEQLSLEEIIDDSAANARISEIIVSCPADGCIYRDKLLTIYNHFRVCDKKSIPCPFNEMGCMKSDIKNDEISVHLRNEIYDHSQLLIDWIRNMKNEMTTLIVLKQQETAQNELKKLEKTIEDKIEEAFNYEEEQQRNEELFRDLKDQLNIITNNTGELERKIMSIKSNNERDLSFLFESRKKLGEEINQLMNDADRHSSEVQLA 277          
BLAST of TNF receptor associated factor-2 vs. Planmine SMEST
Match: SMESG000020851.1 (SMESG000020851.1)

HSP 1 Score: 559.296 bits (1440), Expect = 0.000e+0
Identity = 274/275 (99.64%), Postives = 274/275 (99.64%), Query Frame = 1
Query:  124 MNEKFEDMWKMLGKYNFDIDPQLQINLKCLICKRLLVDACCGLCYCSYCRKCITPYLSRNRKCPGNKPDCQIEQLSLEEIIDDSTANARISEIIVSCPADGCIYRDKLLTIYNHFRVCDKKSIPCPFNEMGCMKSDIKNDEISVHLRNEIYDHSQLLIDWIRNMKNEMTTLIVLKQQETAQNELKKLEKTIEDKIEEAFNYEEEQQRNEELFRDLKDQLNIITNNTGELERKIMSIKSNNERDLSFLFESRKKLGEEINQLMNDADRHSSEVQLA 948
            MNEKFEDMWKMLGKYNFDIDPQLQINLKCLICKRLLVDACCGLCYCSYCRKCITPYLSRNRKCPGNKPDCQIEQLSLEEIIDDS ANARISEIIVSCPADGCIYRDKLLTIYNHFRVCDKKSIPCPFNEMGCMKSDIKNDEISVHLRNEIYDHSQLLIDWIRNMKNEMTTLIVLKQQETAQNELKKLEKTIEDKIEEAFNYEEEQQRNEELFRDLKDQLNIITNNTGELERKIMSIKSNNERDLSFLFESRKKLGEEINQLMNDADRHSSEVQLA
Sbjct:    1 MNEKFEDMWKMLGKYNFDIDPQLQINLKCLICKRLLVDACCGLCYCSYCRKCITPYLSRNRKCPGNKPDCQIEQLSLEEIIDDSAANARISEIIVSCPADGCIYRDKLLTIYNHFRVCDKKSIPCPFNEMGCMKSDIKNDEISVHLRNEIYDHSQLLIDWIRNMKNEMTTLIVLKQQETAQNELKKLEKTIEDKIEEAFNYEEEQQRNEELFRDLKDQLNIITNNTGELERKIMSIKSNNERDLSFLFESRKKLGEEINQLMNDADRHSSEVQLA 275          
BLAST of TNF receptor associated factor-2 vs. Planmine SMEST
Match: SMESG000012339.1 (SMESG000012339.1)

HSP 1 Score: 165.236 bits (417), Expect = 1.074e-46
Identity = 90/244 (36.89%), Postives = 141/244 (57.79%), Query Frame = 1
Query:  145 MWKMLGKYNFDIDPQLQINLKCLICKRLLVDACCGLCYCSYCRKCITPYLSRNRK-CPGNKPDCQIEQLSL-EEIIDDSTANARISEIIVSCPADGCIYRDKLLTIYNHFRVCDKKSIPCPFNEMGCMKSDIKNDEISVHLRNEIYDHSQLLIDWIRNMKNEMTTLIVLKQQETAQNELKKLEKTIEDKIEEAFNYEEEQQRNEELFRDLKDQLNIITNNTGEL----ERKIMSIKSNNERDLS 858
            MWKM+ +Y FDIDPQL I +KC+IC  LL DAC G C C YC+KCI  YL+ + K CPGN  DC+  +L +   I+ D++AN ++S++IV CP +GC ++  L+ + NH + CDK    CP+ E+GC  + +  DE+  HL+ EI  H+ LL+ WI +  +     I   Q+     E+  +  TI D + +      E  +  +  ++  ++L+ IT     L     +++MS+K  NE+ +S
Sbjct:    1 MWKMMEQYQFDIDPQLSIYVKCIICNNLLNDACQGPCGCLYCKKCIDKYLANSMKFCPGNHKDCKSSKLDIFSNIVKDNSANNKVSKLIVICPGEGCNFQSTLIEMSNHLQNCDKLPFWCPYAEIGCTTNTMLTDELVDHLQTEIVAHNNLLVKWITSASDNSHQPIAGDQETPIGKEMNNVFLTISDVLSKKQVLINEMLKKLKDLKEKINELSKITKPIKALIDRNNKEMMSMKDANEKYIS 244          
BLAST of TNF receptor associated factor-2 vs. Planmine SMEST
Match: SMESG000012339.1 (SMESG000012339.1)

HSP 1 Score: 165.236 bits (417), Expect = 1.255e-46
Identity = 90/244 (36.89%), Postives = 141/244 (57.79%), Query Frame = 1
Query:  145 MWKMLGKYNFDIDPQLQINLKCLICKRLLVDACCGLCYCSYCRKCITPYLSRNRK-CPGNKPDCQIEQLSL-EEIIDDSTANARISEIIVSCPADGCIYRDKLLTIYNHFRVCDKKSIPCPFNEMGCMKSDIKNDEISVHLRNEIYDHSQLLIDWIRNMKNEMTTLIVLKQQETAQNELKKLEKTIEDKIEEAFNYEEEQQRNEELFRDLKDQLNIITNNTGEL----ERKIMSIKSNNERDLS 858
            MWKM+ +Y FDIDPQL I +KC+IC  LL DAC G C C YC+KCI  YL+ + K CPGN  DC+  +L +   I+ D++AN ++S++IV CP +GC ++  L+ + NH + CDK    CP+ E+GC  + +  DE+  HL+ EI  H+ LL+ WI +  +     I   Q+     E+  +  TI D + +      E  +  +  ++  ++L+ IT     L     +++MS+K  NE+ +S
Sbjct:    7 MWKMMEQYQFDIDPQLSIYVKCIICNNLLNDACQGPCGCLYCKKCIDKYLANSMKFCPGNHKDCKSSKLDIFSNIVKDNSANNKVSKLIVICPGEGCNFQSTLIEMSNHLQNCDKLPFWCPYAEIGCTTNTMLTDELVDHLQTEIVAHNNLLVKWITSASDNSHQPIAGDQETPIGKEMNNVFLTISDVLSKKQVLINEMLKKLKDLKEKINELSKITKPIKALIDRNNKEMMSMKDANEKYIS 250          
BLAST of TNF receptor associated factor-2 vs. Planmine SMEST
Match: SMESG000068193.1 (SMESG000068193.1)

HSP 1 Score: 157.147 bits (396), Expect = 1.301e-43
Identity = 76/165 (46.06%), Postives = 111/165 (67.27%), Query Frame = 1
Query:  136 FEDMWKMLGKYNFDIDPQLQINLKCLICKRLLVDACCGLCYCSYCRKCITPYLSRN-RKCPGNKPDCQIEQLSLE-EIIDDSTANARISEIIVSCPADGCIYRDKLLTIYNHFRVCDKKSIPCPFNEMGCMKSDIKNDEISVHLRNEIYDHSQLLIDWIRNMKNE 624
            F ++W +L KY+F ID  L  +LKC+IC +LL+DA   LC C+YC+ CI  YL    ++CPG+  DC++  L L+  II  ++ N +I ++IVSCP +GC +  +L  + +H R+CD +SI CP+ E+GC +S I  D IS HL  E + HSQLLI++I N+KNE
Sbjct:    4 FNEIWNLLEKYSFKIDSHLLQHLKCIICGKLLIDAHESLCGCNYCQNCIESYLENGPKQCPGDSVDCKLTLLELQVNIIRSNSTNRKIVKLIVSCPFNGCNFTGELWELKDHIRICDNRSIYCPYKEIGCSQSQIPIDNISNHLTVEQFQHSQLLINFILNLKNE 168          
The following BLAST results are available for this feature:
BLAST of TNF receptor associated factor-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor associated factor-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor associated factor-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZID87.915e-2935.90TNF receptor associated factor-2 (Fragment) OS=Sch... [more]
T1E1012.926e-2729.00TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
A0A0F7GWW39.079e-1335.51TNF receptor associated factor 4 (Fragment) OS=Sch... [more]
A0A3B4AEN38.932e-830.16TNF receptor-associated factor OS=Periophthalmus m... [more]
A0A3B4AEF31.244e-730.16TNF receptor-associated factor OS=Periophthalmus m... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf61.077e-629.69TNF receptor associated factor 6 [Source:NCBI gene... [more]
traf61.193e-629.69TNF receptor associated factor 6 [Source:NCBI gene... [more]
traf61.193e-629.69TNF receptor associated factor 6 [Source:NCBI gene... [more]
traf13.555e-630.08TNF receptor-associated factor 1-like [Source:NCBI... [more]
traf13.870e-630.08TNF receptor-associated factor 1-like [Source:NCBI... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
traf61.151e-627.91TNF receptor-associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
traf68.113e-625.95TNF receptor associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020851.10.000e+099.64SMESG000020851.1[more]
SMESG000020851.10.000e+099.64SMESG000020851.1[more]
SMESG000012339.11.074e-4636.89SMESG000012339.1[more]
SMESG000012339.11.255e-4636.89SMESG000012339.1[more]
SMESG000068193.11.301e-4346.06SMESG000068193.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035887 ID=SMED30035887|Name=TNF receptor associated factor-2|organism=Schmidtea mediterranea sexual|type=transcript|length=1102bp
GGTTTGTTTATAAAACACTTAAATTAAAAAAAAATTATTTTGTGATTTTA
TATTTTCATTACTTCTTAACTTTATCTCCAATTCTTTAATATCAGTTTCT
ATTTTGGAAATTAATCAATGTCTATGAATGAAAAATTTGAAGATATGTGG
AAAATGTTAGGAAAATATAACTTTGATATTGATCCACAGTTGCAAATTAA
TTTAAAATGCTTAATTTGTAAACGTTTACTAGTCGATGCATGTTGTGGAC
TCTGTTATTGTTCTTATTGTCGAAAATGCATAACTCCTTATTTAAGTAGA
AATAGGAAGTGTCCTGGCAATAAACCTGATTGCCAAATTGAACAACTTTC
ACTTGAAGAAATTATTGACGATAGTACAGCCAATGCTAGAATTTCAGAAA
TAATAGTGTCTTGTCCAGCAGATGGTTGTATTTATCGTGATAAGCTATTA
ACAATTTATAATCATTTTCGAGTTTGTGACAAAAAATCTATTCCTTGTCC
TTTTAATGAAATGGGTTGTATGAAGTCTGATATAAAAAATGATGAAATTT
CAGTTCATTTGCGAAATGAAATCTACGATCACAGTCAATTATTAATTGAT
TGGATTAGGAACATGAAAAATGAAATGACAACGTTGATAGTTTTAAAGCA
ACAAGAAACTGCTCAAAACGAATTAAAGAAATTAGAGAAGACAATTGAAG
ATAAAATTGAGGAAGCATTTAATTATGAGGAGGAACAACAACGAAATGAG
GAATTGTTTCGTGATTTGAAAGACCAACTAAATATTATCACTAACAATAC
GGGAGAATTAGAGCGAAAAATAATGTCTATAAAAAGCAACAATGAAAGGG
ATTTGTCTTTTTTGTTTGAATCGAGGAAAAAGTTGGGAGAGGAAATCAAT
CAATTGATGAATGATGCCGATCGGCATAGCAGTGAGGTACAATTGGCATA
AAAACATTTGCATTTTTACAGATTAACTGTTTTATTTAATTGAAATATCT
GATTGTCGTTAAAACGATGGAACATTTGGAAATCCTATACACTTAACTCC
TATTTTATTCTAATTCAATTGGTAATTTTATTGACAATTGAGCATTGTAA
TC
back to top

protein sequence of SMED30035887-orf-1

>SMED30035887-orf-1 ID=SMED30035887-orf-1|Name=SMED30035887-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=278bp
MSMNEKFEDMWKMLGKYNFDIDPQLQINLKCLICKRLLVDACCGLCYCSY
CRKCITPYLSRNRKCPGNKPDCQIEQLSLEEIIDDSTANARISEIIVSCP
ADGCIYRDKLLTIYNHFRVCDKKSIPCPFNEMGCMKSDIKNDEISVHLRN
EIYDHSQLLIDWIRNMKNEMTTLIVLKQQETAQNELKKLEKTIEDKIEEA
FNYEEEQQRNEELFRDLKDQLNIITNNTGELERKIMSIKSNNERDLSFLF
ESRKKLGEEINQLMNDADRHSSEVQLA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000204ovary
PLANA:0000208testis
Vocabulary: INTERPRO
TermDefinition
IPR043211TNF_rcpt-assoc_TRAF
IPR013083Znf_RING/FYVE/PHD
Vocabulary: molecular function
TermDefinition
GO:0004842ubiquitin-protein transferase activity
GO:0008270zinc ion binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006955immune response
GO:0007165signal transduction
GO:0016567protein ubiquitination
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 179..234
NoneNo IPR availableCOILSCoilCoilcoord: 253..273
NoneNo IPR availablePANTHERPTHR10131:SF129TNF RECEPTOR-ASSOCIATED FACTOR 6coord: 114..221
coord: 14..110
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 29..77
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 12..132
e-value: 2.7E-10
score: 42.2
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 114..221
coord: 14..110