methyl-CpG binding domain 2/3

Overview
Namemethyl-CpG binding domain 2/3 (AHB82104.1)
Smed IDSMED30035880
Length (bp)1080
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of methyl-CpG binding domain 2/3 (SMED30035880) t-SNE clustered cells

Violin plots show distribution of expression levels for methyl-CpG binding domain 2/3 (SMED30035880) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of methyl-CpG binding domain 2/3 (SMED30035880) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for methyl-CpG binding domain 2/3 (SMED30035880) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035880

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30035880SMESG000064034.1 SmedASXL_010939SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30035880SMESG000064034.1 SmedASXL_010939SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30035880SMESG000064035.1 SMESG000064034.1 SmedASXL_014758SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30035880SMESG000064035.1 SMESG000064034.1 SmedASXL_014758SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30035880SMESG000064034.1 SMESG000064035.1 dd_Smed_v4_3054_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
testisSMED30035880SMESG000064034.1 KF664582smed_ncbi_20200123PMID:24063805
Jaber-Hijazi et al., 2013
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
neoblastSMED30035880SMESG000064034.1 KF664582smed_ncbi_20200123PMID:24063805
Jaber-Hijazi et al., 2013
whole organism juvenile colorimetric in situ hybridization evidence
neoblastSMED30035880SMESG000064034.1 KF664582smed_ncbi_20200123PMID:24063805
Jaber-Hijazi et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30035880SMESG000064034.1 KF664582smed_ncbi_20200123PMID:24063805
Jaber-Hijazi et al., 2013
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
parenchymaSMED30035880SMESG000064034.1 KF664582smed_ncbi_20200123PMID:24063805
Jaber-Hijazi et al., 2013
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
parenchymaSMED30035880SMESG000064034.1 KF664582smed_ncbi_20200123PMID:24063805
Jaber-Hijazi et al., 2013
whole organism juvenile colorimetric in situ hybridization evidence
parenchymaSMED30035880SMESG000064034.1 KF664582smed_ncbi_20200123PMID:24063805
Jaber-Hijazi et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
testis primordiumSMED30035880SMESG000064034.1 KF664582smed_ncbi_20200123PMID:24063805
Jaber-Hijazi et al., 2013
whole organism juvenile colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Human
Match: MBD3 (methyl-CpG binding domain protein 3 [Source:HGNC Symbol;Acc:HGNC:6918])

HSP 1 Score: 141.354 bits (355), Expect = 7.343e-39
Identity = 84/233 (36.05%), Postives = 134/233 (57.51%), Query Frame = 1
Query:  217 SLPPGWKREEILKPTGLYAGKTDIYYTSPTGQKIRSKAEMQKILGGSYDVSNFDWHSGKFVNSRKRPSTNENDSTSCKLMKMIEEYQQCL-VRSGPSLFCKDKLPIIETT-RPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQE 909
            +LP GW+REE+ + +GL AG  D++Y SP+G+K RSK ++ + LGGS D+S FD+ +GK + S+   S       S   +K   +    L VR   S+F   K P+ + T  P +++ +D     D    P+Q+FW K+L+   AF+    E V++++LPK  Q  G PG  +  L  +I S ++ ST   +P+ GQ +  A++EKNP + +   QPL K  ++TD+ I +QE
Sbjct:   10 ALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMSKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIF---KQPVTKITNHPSNKVKSDPQKAVDQ---PRQLFWEKKLSGLNAFD-IAEELVKTMDLPKGLQGVG-PGCTDETLLSAIASALHTST---MPITGQLS--AAVEKNPGVWLNTTQPLCKAFMVTDEDIRKQE 229          
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Human
Match: MBD2 (methyl-CpG binding domain protein 2 [Source:HGNC Symbol;Acc:HGNC:6917])

HSP 1 Score: 140.198 bits (352), Expect = 2.489e-37
Identity = 81/233 (34.76%), Postives = 139/233 (59.66%), Query Frame = 1
Query:  217 SLPPGWKREEILKPTGLYAGKTDIYYTSPTGQKIRSKAEMQKILGGSYDVSNFDWHSGKFVNSRKRPSTNENDSTSCKLMKMIEEYQQCL-VRSGPSLFCKDKLPIIETT-RPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQE 909
            +LPPGWK+EE+++ +GL AGK+D+YY SP+G+K RSK ++ + LG + D+S+FD+ +GK + S+ + +     +      K   +    L +R   S+F   K P+ + T  P +++ +D    N   E P+Q+FW KRL    A +  T + ++++ELPK  Q  G PG ++  L  ++ S ++ S+    P+ GQ +  A++EKNP + +  +QPL K  ++TD+ I +QE
Sbjct:  154 ALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNTVDLSSFDFRTGKMMPSKLQKNKQRLRNDPLNQNKGKPDLNTTLPIRQTASIF---KQPVTKVTNHPSNKVKSDPQRMN---EQPRQLFWEKRLQGLSASD-VTEQIIKTMELPKGLQGVG-PGSNDETLLSAVASALHTSS---APITGQVS--AAVEKNPAVWLNTSQPLCKAFIVTDEDIRKQE 373          
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Human
Match: MBD3 (methyl-CpG binding domain protein 3 [Source:HGNC Symbol;Acc:HGNC:6918])

HSP 1 Score: 109.768 bits (273), Expect = 2.520e-27
Identity = 71/206 (34.47%), Postives = 114/206 (55.34%), Query Frame = 1
Query:  298 SPTGQKIRSKAEMQKILGGSYDVSNFDWHSGKFVNSRKRPSTNENDSTSCKLMKMIEEYQQCL-VRSGPSLFCKDKLPIIETT-RPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQE 909
            SP+G+K RSK ++ + LGGS D+S FD+ +GK + S+   S       S   +K   +    L VR   S+F   K P+ + T  P +++ +D     D    P+Q+FW K+L+   AF+    E V++++LPK  Q  G PG  +  L  +I S ++ ST   +P+ GQ +  A++EKNP + +   QPL K  ++TD+ I +QE
Sbjct:    5 SPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMSKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIF---KQPVTKITNHPSNKVKSDPQKAVDQ---PRQLFWEKKLSGLNAFD-IAEELVKTMDLPKGLQGVG-PGCTDETLLSAIASALHTST---MPITGQLS--AAVEKNPGVWLNTTQPLCKAFMVTDEDIRKQE 197          
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Human
Match: MBD3 (methyl-CpG binding domain protein 3 [Source:HGNC Symbol;Acc:HGNC:6918])

HSP 1 Score: 85.8853 bits (211), Expect = 8.871e-19
Identity = 60/186 (32.26%), Postives = 98/186 (52.69%), Query Frame = 1
Query:  358 YDVSNFDWHSGKFVNSRKRPSTNENDSTSCKLMKMIEEYQQCL-VRSGPSLFCKDKLPIIETT-RPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQE 909
             D+S FD+ +GK + S+   S       S   +K   +    L VR   S+F   K P+ + T  P +++ +D     D    P+Q+FW K+L+   AF+    E V++++LPK  Q  G PG  +  L  +I S ++ ST   +P+ GQ +  A++EKNP + +   QPL K  ++TD+ I +QE
Sbjct:    1 MDLSTFDFRTGKMLMSKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIF---KQPVTKITNHPSNKVKSDPQKAVDQ---PRQLFWEKKLSGLNAFD-IAEELVKTMDLPKGLQGVG-PGCTDETLLSAIASALHTST---MPITGQLS--AAVEKNPGVWLNTTQPLCKAFMVTDEDIRKQE 173          
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Human
Match: MBD3 (methyl-CpG binding domain protein 3 [Source:HGNC Symbol;Acc:HGNC:6918])

HSP 1 Score: 83.5741 bits (205), Expect = 2.186e-18
Identity = 59/185 (31.89%), Postives = 98/185 (52.97%), Query Frame = 1
Query:  358 YDVSNFDWHSGKFVNSRKRPSTNENDSTSCKLMKMIEEYQQCL-VRSGPSLFCKDKLPIIETT-RPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQ 906
             D+S FD+ +GK + S+   S       S   +K   +    L VR   S+F   K P+ + T  P +++ +D     D    P+Q+FW K+L+   AF+    E V++++LPK  Q  G PG  +  L  +I S ++ ST   +P+ GQ +  A++EKNP + +   QPL K  ++TD+ I+R+
Sbjct:    1 MDLSTFDFRTGKMLMSKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIF---KQPVTKITNHPSNKVKSDPQKAVDQ---PRQLFWEKKLSGLNAFD-IAEELVKTMDLPKGLQGVG-PGCTDETLLSAIASALHTST---MPITGQLS--AAVEKNPGVWLNTTQPLCKAFMVTDEDISRK 172          
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Fly
Match: MBD-like (gene:FBgn0027950 transcript:FBtr0082068)

HSP 1 Score: 65.0846 bits (157), Expect = 7.577e-12
Identity = 44/142 (30.99%), Postives = 76/142 (53.52%), Query Frame = 1
Query:  487 VRSGPSLFCKDKLPIIETTRPD-SRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQE 909
            +R   S+F K  + +I   + D ++  N+   G   +E PKQ+FW KRL    A + ++ E++  + LPK  +  G P ++   + QS+ + ++     N  V GQS+ KA + KN    +   QPL+  V+I++D I +QE
Sbjct:   77 IRQTASIF-KQPVTVIRNHKQDPAKAKNEPKHGT--REKPKQLFWEKRLERLRACH-DSGEELDDISLPKTIRTVG-PNVNEQTVLQSVATALHML---NAGVHGQSSTKADLTKNAMAFMNPEQPLMHAVIISEDDIRKQE 210          
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Fly
Match: MBD-like (gene:FBgn0027950 transcript:FBtr0082069)

HSP 1 Score: 64.6994 bits (156), Expect = 2.382e-11
Identity = 44/142 (30.99%), Postives = 76/142 (53.52%), Query Frame = 1
Query:  487 VRSGPSLFCKDKLPIIETTRPD-SRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQE 909
            +R   S+F K  + +I   + D ++  N+   G   +E PKQ+FW KRL    A + ++ E++  + LPK  +  G P ++   + QS+ + ++     N  V GQS+ KA + KN    +   QPL+  V+I++D I +QE
Sbjct:  190 IRQTASIF-KQPVTVIRNHKQDPAKAKNEPKHGT--REKPKQLFWEKRLERLRACH-DSGEELDDISLPKTIRTVG-PNVNEQTVLQSVATALHML---NAGVHGQSSTKADLTKNAMAFMNPEQPLMHAVIISEDDIRKQE 323          
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Fly
Match: MBD-like (gene:FBgn0027950 transcript:FBtr0334654)

HSP 1 Score: 64.6994 bits (156), Expect = 2.439e-11
Identity = 44/142 (30.99%), Postives = 76/142 (53.52%), Query Frame = 1
Query:  487 VRSGPSLFCKDKLPIIETTRPD-SRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQE 909
            +R   S+F K  + +I   + D ++  N+   G   +E PKQ+FW KRL    A + ++ E++  + LPK  +  G P ++   + QS+ + ++     N  V GQS+ KA + KN    +   QPL+  V+I++D I +QE
Sbjct:  191 IRQTASIF-KQPVTVIRNHKQDPAKAKNEPKHGT--REKPKQLFWEKRLERLRACH-DSGEELDDISLPKTIRTVG-PNVNEQTVLQSVATALHML---NAGVHGQSSTKADLTKNAMAFMNPEQPLMHAVIISEDDIRKQE 324          
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Zebrafish
Match: mbd3a (methyl-CpG binding domain protein 3a [Source:ZFIN;Acc:ZDB-GENE-030131-9077])

HSP 1 Score: 135.191 bits (339), Expect = 6.750e-37
Identity = 81/235 (34.47%), Postives = 133/235 (56.60%), Query Frame = 1
Query:  208 QTTSLPPGWKREEILKPTGLYAGKTDIYYTSPTGQKIRSKAEMQKILGGSYDVSNFDWHSGKFVNSRKRPSTNENDSTSCKLMKMIEEYQQCLVRSGPSLFCKDKLPIIETT-RPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQE 909
            + ++LP GWK EE+ + +GL AGK+D+YY SPTG+K RSK ++ + LG S D+S+FD+ +GK + S+   +     S   +     +      VR   S+F   K P+ + T  P +++  D        E P+Q+FW K+L+   AF+    E V++++LPK  Q  G PG  +  L  ++ S ++ S+    P+ GQ +  A++EKNP + +   QPL K  ++TD+ I +QE
Sbjct:    7 ECSALPNGWKMEEVTRKSGLSAGKSDVYYFSPTGKKFRSKPQLVRYLGKSMDLSSFDFRTGKMLMSKLNKNRQRIRSDHSQNKGKPDLNTSLPVRQTASIF---KQPVTKVTNHPSNKVKTDP---QKAVEQPRQLFWEKKLSGLNAFDI-AEELVKTMDLPKGLQGVG-PGYSDKTLLSALASALHTSS---APITGQLS--AAVEKNPGVWLNTTQPLCKSFMVTDEDIRKQE 228          
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Zebrafish
Match: mbd3a (methyl-CpG binding domain protein 3a [Source:ZFIN;Acc:ZDB-GENE-030131-9077])

HSP 1 Score: 135.191 bits (339), Expect = 6.750e-37
Identity = 81/235 (34.47%), Postives = 133/235 (56.60%), Query Frame = 1
Query:  208 QTTSLPPGWKREEILKPTGLYAGKTDIYYTSPTGQKIRSKAEMQKILGGSYDVSNFDWHSGKFVNSRKRPSTNENDSTSCKLMKMIEEYQQCLVRSGPSLFCKDKLPIIETT-RPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQE 909
            + ++LP GWK EE+ + +GL AGK+D+YY SPTG+K RSK ++ + LG S D+S+FD+ +GK + S+   +     S   +     +      VR   S+F   K P+ + T  P +++  D        E P+Q+FW K+L+   AF+    E V++++LPK  Q  G PG  +  L  ++ S ++ S+    P+ GQ +  A++EKNP + +   QPL K  ++TD+ I +QE
Sbjct:    7 ECSALPNGWKMEEVTRKSGLSAGKSDVYYFSPTGKKFRSKPQLVRYLGKSMDLSSFDFRTGKMLMSKLNKNRQRIRSDHSQNKGKPDLNTSLPVRQTASIF---KQPVTKVTNHPSNKVKTDP---QKAVEQPRQLFWEKKLSGLNAFDI-AEELVKTMDLPKGLQGVG-PGYSDKTLLSALASALHTSS---APITGQLS--AAVEKNPGVWLNTTQPLCKSFMVTDEDIRKQE 228          
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Zebrafish
Match: mbd3b (methyl-CpG binding domain protein 3b [Source:ZFIN;Acc:ZDB-GENE-030131-9792])

HSP 1 Score: 106.301 bits (264), Expect = 3.353e-26
Identity = 72/215 (33.49%), Postives = 115/215 (53.49%), Query Frame = 1
Query:  286 IYYTSPTGQKIRSKAEMQKILGGSYDVSNFDWHSGKFVNS-----RKRPSTNENDSTSCKLMKMIEEYQQCL-VRSGPSLFCKDKLPIIETT-RPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQE 909
            +Y   PTG+K RSK ++ + LG S D+S+FD+ +GK + S     R+RP  + N  +  K      +    L VR   S+F   K P+ + T  P +++  D     D    P+Q+FW K+L+   AF+    E V++++LPK  Q  G PG  +  L  +I S ++ S     P+ GQ +  A++EKNP + +   QPL K  ++TD+ I +QE
Sbjct:   24 LYSLCPTGKKFRSKPQLARSLGNSMDLSSFDFRTGKMLMSKLNKNRQRPRYDNNSQSKGK-----PDLNTSLPVRQTASIF---KQPVTKVTNHPSNKVKTDPQKAIDQ---PRQLFWEKKLSGLNAFDI-AEELVKTMDLPKGLQGVG-PGCTDKTLLSAIASALHTSA---APITGQLS--AAVEKNPGVWLNTAQPLCKAFIVTDEDIRKQE 220          
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Zebrafish
Match: mbd3b (methyl-CpG binding domain protein 3b [Source:ZFIN;Acc:ZDB-GENE-030131-9792])

HSP 1 Score: 106.301 bits (264), Expect = 3.601e-26
Identity = 72/215 (33.49%), Postives = 115/215 (53.49%), Query Frame = 1
Query:  286 IYYTSPTGQKIRSKAEMQKILGGSYDVSNFDWHSGKFVNS-----RKRPSTNENDSTSCKLMKMIEEYQQCL-VRSGPSLFCKDKLPIIETT-RPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQE 909
            +Y   PTG+K RSK ++ + LG S D+S+FD+ +GK + S     R+RP  + N  +  K      +    L VR   S+F   K P+ + T  P +++  D     D    P+Q+FW K+L+   AF+    E V++++LPK  Q  G PG  +  L  +I S ++ S     P+ GQ +  A++EKNP + +   QPL K  ++TD+ I +QE
Sbjct:   24 LYSLCPTGKKFRSKPQLARSLGNSMDLSSFDFRTGKMLMSKLNKNRQRPRYDNNSQSKGK-----PDLNTSLPVRQTASIF---KQPVTKVTNHPSNKVKTDPQKAIDQ---PRQLFWEKKLSGLNAFDI-AEELVKTMDLPKGLQGVG-PGCTDKTLLSAIASALHTSA---APITGQLS--AAVEKNPGVWLNTAQPLCKAFIVTDEDIRKQE 220          
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Zebrafish
Match: mbd3b (methyl-CpG binding domain protein 3b [Source:ZFIN;Acc:ZDB-GENE-030131-9792])

HSP 1 Score: 103.605 bits (257), Expect = 1.906e-25
Identity = 71/210 (33.81%), Postives = 113/210 (53.81%), Query Frame = 1
Query:  301 PTGQKIRSKAEMQKILGGSYDVSNFDWHSGKFVNS-----RKRPSTNENDSTSCKLMKMIEEYQQCL-VRSGPSLFCKDKLPIIETT-RPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQE 909
            PTG+K RSK ++ + LG S D+S+FD+ +GK + S     R+RP  + N  +  K      +    L VR   S+F   K P+ + T  P +++  D     D    P+Q+FW K+L+   AF+    E V++++LPK  Q  G PG  +  L  +I S ++ S     P+ GQ +  A++EKNP + +   QPL K  ++TD+ I +QE
Sbjct:    6 PTGKKFRSKPQLARSLGNSMDLSSFDFRTGKMLMSKLNKNRQRPRYDNNSQSKGK-----PDLNTSLPVRQTASIF---KQPVTKVTNHPSNKVKTDPQKAIDQ---PRQLFWEKKLSGLNAFDI-AEELVKTMDLPKGLQGVG-PGCTDKTLLSAIASALHTSA---APITGQLS--AAVEKNPGVWLNTAQPLCKAFIVTDEDIRKQE 197          
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Xenopus
Match: cerkl (ceramide kinase like [Source:Xenbase;Acc:XB-GENE-6035280])

HSP 1 Score: 141.739 bits (356), Expect = 4.642e-39
Identity = 84/236 (35.59%), Postives = 136/236 (57.63%), Query Frame = 1
Query:  208 QTTSLPPGWKREEILKPTGLYAGKTDIYYTSPTGQKIRSKAEMQKILGGSYDVSNFDWHSGKFVNSRKRPSTNENDSTSCKLMKMIEEYQQCL-VRSGPSLFCKDKLPIIETT-RPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQE 909
            + ++LP GWK+EE+ + +GL AGK+D+YY SP+G+K RSK ++ + LG S D+S FD+ +GK + S+   +            K   +    L VR   S+F   K P+ + T  P +++ +D     D    P+Q+FW K+L+   AF+    E V+++ELPK  Q  G PG  +  L  +I S ++ ST   +P+ GQ +  A++EKNP + +  +QPL K  ++TD+ I +QE
Sbjct:    7 ECSALPQGWKKEEVTRRSGLSAGKSDVYYYSPSGKKFRSKPQLARYLGNSMDLSTFDFRTGKMLMSKINKNRQRMRYDGLNQSKGKPDLNTALPVRQTASIF---KQPVTKVTNHPTNKVKSDPQKAVDQ---PRQLFWEKKLSGLNAFD-IAEELVKTMELPKGLQGVG-PGCTDETLLSAIASALHTST---MPITGQLS--AAVEKNPGVWLNTSQPLCKAFMVTDEDIRKQE 229          
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Xenopus
Match: cfap58 (cilia and flagella associated protein 58 [Source:Xenbase;Acc:XB-GENE-5719803])

HSP 1 Score: 136.732 bits (343), Expect = 2.061e-37
Identity = 81/233 (34.76%), Postives = 136/233 (58.37%), Query Frame = 1
Query:  217 SLPPGWKREEILKPTGLYAGKTDIYYTSPTGQKIRSKAEMQKILGGSYDVSNFDWHSGKFVNSRKRPSTNENDSTSCKLMKMIEEYQQCL-VRSGPSLFCKDKLPIIETT-RPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQE 909
            +LPPGWK+EE+++ +GL AGK+D+YY SP G+K RSK ++ + LG S D+S+FD+ +GK + S+ + +     +      K   +    L +R   S+F   K P+ + T  P +++ +D        E P+Q+FW KRL +  + +  T + ++ +ELPK  Q  G PG +   L  +I S ++ S+    P+ GQ +  A++EKNP + +  +QPL K  ++TD+ I +QE
Sbjct:   10 ALPPGWKKEEVIRKSGLSAGKSDVYYYSPNGKKFRSKPQLARYLGNSVDLSSFDFRTGKMMPSKLQKNKQRLRNDPLNQNKSKPDLNTTLPIRQTASIF---KQPVTKVTNHPSNKVKSDP---QRVIEQPRQLFWEKRL-EGLSASDVTEQVIKPMELPKGLQGVG-PGNNEQTLLAAIASALHTSS---APITGQLS--AAVEKNPSVWLNTSQPLCKAFLVTDEDIRKQE 229          
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Xenopus
Match: cerkl (ceramide kinase like [Source:Xenbase;Acc:XB-GENE-6035280])

HSP 1 Score: 123.635 bits (309), Expect = 4.645e-32
Identity = 84/256 (32.81%), Postives = 137/256 (53.52%), Query Frame = 1
Query:  208 QTTSLPPGWKREEILKPTGLYAGKTDIYY--------------------TSPTGQKIRSKAEMQKILGGSYDVSNFDWHSGKFVNSRKRPSTNENDSTSCKLMKMIEEYQQCL-VRSGPSLFCKDKLPIIETT-RPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQE 909
            + ++LP GWK+EE+ + +GL AGK+D+YY                    T+P+G+K RSK ++ + LG S D+S FD+ +GK + S+   +            K   +    L VR   S+F   K P+ + T  P +++ +D     D    P+Q+FW K+L+   AF+    E V+++ELPK  Q  G PG  +  L  +I S ++ ST   +P+ GQ +  A++EKNP + +  +QPL K  ++TD+ I +QE
Sbjct:    7 ECSALPQGWKKEEVTRRSGLSAGKSDVYYYSSSPSRYNRSLRDRVGYLNTNPSGKKFRSKPQLARYLGNSMDLSTFDFRTGKMLMSKINKNRQRMRYDGLNQSKGKPDLNTALPVRQTASIF---KQPVTKVTNHPTNKVKSDPQKAVDQ---PRQLFWEKKLSGLNAFDI-AEELVKTMELPKGLQGVG-PGCTDETLLSAIASALHTST---MPITGQLS--AAVEKNPGVWLNTSQPLCKAFMVTDEDIRKQE 249          
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Xenopus
Match: cfap58 (cilia and flagella associated protein 58 [Source:Xenbase;Acc:XB-GENE-5719803])

HSP 1 Score: 94.3597 bits (233), Expect = 1.261e-21
Identity = 65/206 (31.55%), Postives = 112/206 (54.37%), Query Frame = 1
Query:  298 SPTGQKIRSKAEMQKILGGSYDVSNFDWHSGKFVNSRKRPSTNENDSTSCKLMKMIEEYQQCL-VRSGPSLFCKDKLPIIETT-RPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQE 909
            SP G+K RSK ++ + LG S D+S+FD+ +GK + S+ + +     +      K   +    L +R   S+F   K P+ + T  P +++ +D        E P+Q+FW KRL +  + +  T + ++ +ELPK  Q  G PG +   L  +I S ++ S+    P+ GQ +  A++EKNP + +  +QPL K  ++TD+ I +QE
Sbjct:   51 SPNGKKFRSKPQLARYLGNSVDLSSFDFRTGKMMPSKLQKNKQRLRNDPLNQNKSKPDLNTTLPIRQTASIF---KQPVTKVTNHPSNKVKSDP---QRVIEQPRQLFWEKRL-EGLSASDVTEQVIKPMELPKGLQGVG-PGNNEQTLLAAIASALHTSS---APITGQLS--AAVEKNPSVWLNTSQPLCKAFLVTDEDIRKQE 243          
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Xenopus
Match: ENSXETT00000040006.1 (methyl-CpG binding domain protein 1 [Source:NCBI gene;Acc:493208])

HSP 1 Score: 63.5438 bits (153), Expect = 2.026e-10
Identity = 30/64 (46.88%), Postives = 42/64 (65.62%), Query Frame = 1
Query:  220 LPPGWKREEILKPTGLYAGKTDIYYTSPTGQKIRSKAEMQK---ILGGSYDVSNFDWHSGKFVN 402
            L PGWKR   ++ +G+  G TD YY SPTG+KIRS+ E+ K    LG S D++ FD+ +G  V+
Sbjct:   11 LGPGWKRRIAVRKSGVSCGHTDTYYKSPTGEKIRSRIELAKYFNALGSSVDLTLFDFRNGVIVD 74          
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Mouse
Match: Mbd3 (methyl-CpG binding domain protein 3 [Source:MGI Symbol;Acc:MGI:1333812])

HSP 1 Score: 143.28 bits (360), Expect = 9.096e-40
Identity = 85/233 (36.48%), Postives = 134/233 (57.51%), Query Frame = 1
Query:  217 SLPPGWKREEILKPTGLYAGKTDIYYTSPTGQKIRSKAEMQKILGGSYDVSNFDWHSGKFVNSRKRPSTNENDSTSCKLMKMIEEYQQCL-VRSGPSLFCKDKLPIIETT-RPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQE 909
            +LP GW+REE+ + +GL AG  D++Y SP+G+K RSK ++ + LGGS D+S FD+ +GK + ++   S       S   +K   +    L VR   S+F   K P+ + T  P +++ +D     D    P+Q+FW K+L+   AF+    E VR+++LPK  Q  G PG  +  L  +I S ++ ST   +P+ GQ +  A++EKNP + +   QPL K  ++TDD I +QE
Sbjct:   10 ALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMNKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIF---KQPVTKITNHPSNKVKSDPQKAVDQ---PRQLFWEKKLSGLSAFD-IAEELVRTMDLPKGLQGVG-PGCTDETLLSAIASALHTST---LPITGQLS--AAVEKNPGVWLNTAQPLCKAFMVTDDDIRKQE 229          
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Mouse
Match: Mbd2 (methyl-CpG binding domain protein 2 [Source:MGI Symbol;Acc:MGI:1333813])

HSP 1 Score: 140.198 bits (352), Expect = 1.914e-37
Identity = 81/233 (34.76%), Postives = 139/233 (59.66%), Query Frame = 1
Query:  217 SLPPGWKREEILKPTGLYAGKTDIYYTSPTGQKIRSKAEMQKILGGSYDVSNFDWHSGKFVNSRKRPSTNENDSTSCKLMKMIEEYQQCL-VRSGPSLFCKDKLPIIE-TTRPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQE 909
            +LPPGWK+EE+++ +GL AGK+D+YY SP+G+K RSK ++ + LG + D+S+FD+ +GK + S+ + +     +      K   +    L +R   S+F   K P+ + T  P +++ +D    N   E P+Q+FW KRL    A +  T + ++++ELPK  Q  G PG ++  L  ++ S ++ S+    P+ GQ +  A++EKNP + +  +QPL K  ++TD+ I +QE
Sbjct:  157 ALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNAVDLSSFDFRTGKMMPSKLQKNKQRLRNDPLNQNKGKPDLNTTLPIRQTASIF---KQPVTKFTNHPSNKVKSDPQRMN---EQPRQLFWEKRLQGLSASD-VTEQIIKTMELPKGLQGVG-PGSNDETLLSAVASALHTSS---APITGQVS--AAVEKNPAVWLNTSQPLCKAFIVTDEDIRKQE 376          
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Mouse
Match: Mbd3 (methyl-CpG binding domain protein 3 [Source:MGI Symbol;Acc:MGI:1333812])

HSP 1 Score: 111.694 bits (278), Expect = 3.463e-28
Identity = 72/206 (34.95%), Postives = 114/206 (55.34%), Query Frame = 1
Query:  298 SPTGQKIRSKAEMQKILGGSYDVSNFDWHSGKFVNSRKRPSTNENDSTSCKLMKMIEEYQQCL-VRSGPSLFCKDKLPIIETT-RPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQE 909
            SP+G+K RSK ++ + LGGS D+S FD+ +GK + ++   S       S   +K   +    L VR   S+F   K P+ + T  P +++ +D     D    P+Q+FW K+L+   AF+    E VR+++LPK  Q  G PG  +  L  +I S ++ ST   +P+ GQ +  A++EKNP + +   QPL K  ++TDD I +QE
Sbjct:   13 SPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMNKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIF---KQPVTKITNHPSNKVKSDPQKAVDQ---PRQLFWEKKLSGLSAFD-IAEELVRTMDLPKGLQGVG-PGCTDETLLSAIASALHTST---LPITGQLS--AAVEKNPGVWLNTAQPLCKAFMVTDDDIRKQE 205          
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Mouse
Match: Mbd3 (methyl-CpG binding domain protein 3 [Source:MGI Symbol;Acc:MGI:1333812])

HSP 1 Score: 111.694 bits (278), Expect = 3.493e-28
Identity = 72/206 (34.95%), Postives = 114/206 (55.34%), Query Frame = 1
Query:  298 SPTGQKIRSKAEMQKILGGSYDVSNFDWHSGKFVNSRKRPSTNENDSTSCKLMKMIEEYQQCL-VRSGPSLFCKDKLPIIETT-RPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQE 909
            SP+G+K RSK ++ + LGGS D+S FD+ +GK + ++   S       S   +K   +    L VR   S+F   K P+ + T  P +++ +D     D    P+Q+FW K+L+   AF+    E VR+++LPK  Q  G PG  +  L  +I S ++ ST   +P+ GQ +  A++EKNP + +   QPL K  ++TDD I +QE
Sbjct:    5 SPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMNKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIF---KQPVTKITNHPSNKVKSDPQKAVDQ---PRQLFWEKKLSGLSAFD-IAEELVRTMDLPKGLQGVG-PGCTDETLLSAIASALHTST---LPITGQLS--AAVEKNPGVWLNTAQPLCKAFMVTDDDIRKQE 197          
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Mouse
Match: Mbd3 (methyl-CpG binding domain protein 3 [Source:MGI Symbol;Acc:MGI:1333812])

HSP 1 Score: 102.449 bits (254), Expect = 1.382e-24
Identity = 72/234 (30.77%), Postives = 117/234 (50.00%), Query Frame = 1
Query:  298 SPTGQKIRSKAEMQKILGGSYDVSNFDWHSGKFVNSRKRPSTNENDSTSCKLMKMIEEY--------------QQCL---------------VRSGPSLFCKDKLPIIETT-RPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQE 909
            SP+G+K RSK ++ + LGGS D+S FD+ +GK + ++   S       S   +K + ++               +C                VR   S+F   K P+ + T  P +++ +D     D    P+Q+FW K+L+   AF+    E VR+++LPK  Q  G PG  +  L  +I S ++ ST   +P+ GQ +  A++EKNP + +   QPL K  ++TDD I +QE
Sbjct:    5 SPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMNKMNKSRQRVRYDSSNQVKALAKHLPGPSNPPWTPVGAARCRVFSPQGKPDLNTALPVRQTASIF---KQPVTKITNHPSNKVKSDPQKAVDQ---PRQLFWEKKLSGLSAFD-IAEELVRTMDLPKGLQGVG-PGCTDETLLSAIASALHTST---LPITGQLS--AAVEKNPGVWLNTAQPLCKAFMVTDDDIRKQE 225          
BLAST of methyl-CpG binding domain 2/3 vs. UniProt/SwissProt
Match: sp|Q9Z2D8|MBD3_MOUSE (Methyl-CpG-binding domain protein 3 OS=Mus musculus OX=10090 GN=Mbd3 PE=1 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 6.363e-39
Identity = 85/233 (36.48%), Postives = 134/233 (57.51%), Query Frame = 1
Query:  217 SLPPGWKREEILKPTGLYAGKTDIYYTSPTGQKIRSKAEMQKILGGSYDVSNFDWHSGKFVNSRKRPSTNENDSTSCKLMKMIEEYQQCL-VRSGPSLFCKDKLPIIETT-RPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQE 909
            +LP GW+REE+ + +GL AG  D++Y SP+G+K RSK ++ + LGGS D+S FD+ +GK + ++   S       S   +K   +    L VR   S+F   K P+ + T  P +++ +D     D    P+Q+FW K+L+   AF+    E VR+++LPK  Q  G PG  +  L  +I S ++ ST   +P+ GQ +  A++EKNP + +   QPL K  ++TDD I +QE
Sbjct:   10 ALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMNKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIF---KQPVTKITNHPSNKVKSDPQKAVDQ---PRQLFWEKKLSGLSAFD-IAEELVRTMDLPKGLQGVG-PGCTDETLLSAIASALHTST---LPITGQLS--AAVEKNPGVWLNTAQPLCKAFMVTDDDIRKQE 229          
BLAST of methyl-CpG binding domain 2/3 vs. UniProt/SwissProt
Match: sp|O95983|MBD3_HUMAN (Methyl-CpG-binding domain protein 3 OS=Homo sapiens OX=9606 GN=MBD3 PE=1 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 3.526e-38
Identity = 84/233 (36.05%), Postives = 134/233 (57.51%), Query Frame = 1
Query:  217 SLPPGWKREEILKPTGLYAGKTDIYYTSPTGQKIRSKAEMQKILGGSYDVSNFDWHSGKFVNSRKRPSTNENDSTSCKLMKMIEEYQQCL-VRSGPSLFCKDKLPIIETT-RPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQE 909
            +LP GW+REE+ + +GL AG  D++Y SP+G+K RSK ++ + LGGS D+S FD+ +GK + S+   S       S   +K   +    L VR   S+F   K P+ + T  P +++ +D     D    P+Q+FW K+L+   AF+    E V++++LPK  Q  G PG  +  L  +I S ++ ST   +P+ GQ +  A++EKNP + +   QPL K  ++TD+ I +QE
Sbjct:   10 ALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMSKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIF---KQPVTKITNHPSNKVKSDPQKAVDQ---PRQLFWEKKLSGLNAFD-IAEELVKTMDLPKGLQGVG-PGCTDETLLSAIASALHTST---MPITGQLS--AAVEKNPGVWLNTTQPLCKAFMVTDEDIRKQE 229          
BLAST of methyl-CpG binding domain 2/3 vs. UniProt/SwissProt
Match: sp|Q9UBB5|MBD2_HUMAN (Methyl-CpG-binding domain protein 2 OS=Homo sapiens OX=9606 GN=MBD2 PE=1 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 1.195e-36
Identity = 81/233 (34.76%), Postives = 139/233 (59.66%), Query Frame = 1
Query:  217 SLPPGWKREEILKPTGLYAGKTDIYYTSPTGQKIRSKAEMQKILGGSYDVSNFDWHSGKFVNSRKRPSTNENDSTSCKLMKMIEEYQQCL-VRSGPSLFCKDKLPIIETT-RPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQE 909
            +LPPGWK+EE+++ +GL AGK+D+YY SP+G+K RSK ++ + LG + D+S+FD+ +GK + S+ + +     +      K   +    L +R   S+F   K P+ + T  P +++ +D    N   E P+Q+FW KRL    A +  T + ++++ELPK  Q  G PG ++  L  ++ S ++ S+    P+ GQ +  A++EKNP + +  +QPL K  ++TD+ I +QE
Sbjct:  154 ALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNTVDLSSFDFRTGKMMPSKLQKNKQRLRNDPLNQNKGKPDLNTTLPIRQTASIF---KQPVTKVTNHPSNKVKSDPQRMN---EQPRQLFWEKRLQGLSASD-VTEQIIKTMELPKGLQGVG-PGSNDETLLSAVASALHTSS---APITGQVS--AAVEKNPAVWLNTSQPLCKAFIVTDEDIRKQE 373          
BLAST of methyl-CpG binding domain 2/3 vs. UniProt/SwissProt
Match: sp|Q9Z2E1|MBD2_MOUSE (Methyl-CpG-binding domain protein 2 OS=Mus musculus OX=10090 GN=Mbd2 PE=2 SV=2)

HSP 1 Score: 140.198 bits (352), Expect = 1.339e-36
Identity = 81/233 (34.76%), Postives = 139/233 (59.66%), Query Frame = 1
Query:  217 SLPPGWKREEILKPTGLYAGKTDIYYTSPTGQKIRSKAEMQKILGGSYDVSNFDWHSGKFVNSRKRPSTNENDSTSCKLMKMIEEYQQCL-VRSGPSLFCKDKLPIIE-TTRPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQE 909
            +LPPGWK+EE+++ +GL AGK+D+YY SP+G+K RSK ++ + LG + D+S+FD+ +GK + S+ + +     +      K   +    L +R   S+F   K P+ + T  P +++ +D    N   E P+Q+FW KRL    A +  T + ++++ELPK  Q  G PG ++  L  ++ S ++ S+    P+ GQ +  A++EKNP + +  +QPL K  ++TD+ I +QE
Sbjct:  157 ALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNAVDLSSFDFRTGKMMPSKLQKNKQRLRNDPLNQNKGKPDLNTTLPIRQTASIF---KQPVTKFTNHPSNKVKSDPQRMN---EQPRQLFWEKRLQGLSASD-VTEQIIKTMELPKGLQGVG-PGSNDETLLSAVASALHTSS---APITGQVS--AAVEKNPAVWLNTSQPLCKAFIVTDEDIRKQE 376          
BLAST of methyl-CpG binding domain 2/3 vs. UniProt/SwissProt
Match: sp|Q9Z2E2|MBD1_MOUSE (Methyl-CpG-binding domain protein 1 OS=Mus musculus OX=10090 GN=Mbd1 PE=1 SV=2)

HSP 1 Score: 69.707 bits (169), Expect = 1.175e-11
Identity = 29/62 (46.77%), Postives = 42/62 (67.74%), Query Frame = 1
Query:  217 SLPPGWKREEILKPTGLYAGKTDIYYTSPTGQKIRSKAEMQKILGGSYDVSNFDWHSGKFVN 402
            +L PGWKR E  + +G   G++DIYY SPTG+KIRSK E+ + LG + D++ FD+  G   +
Sbjct:   10 ALGPGWKRRESFRKSGASFGRSDIYYQSPTGEKIRSKVELTRYLGPACDLTLFDFRQGTLCH 71          
BLAST of methyl-CpG binding domain 2/3 vs. TrEMBL
Match: V5UX13 (Methyl-CpG binding domain 2/3 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 578.941 bits (1491), Expect = 0.000e+0
Identity = 297/298 (99.66%), Postives = 298/298 (100.00%), Query Frame = 1
Query:   97 MSKQSFPSNTNLNSKKANSNATQPTRTSVFNATAVNHQTTSLPPGWKREEILKPTGLYAGKTDIYYTSPTGQKIRSKAEMQKILGGSYDVSNFDWHSGKFVNSRKRPSTNENDSTSCKLMKMIEEYQQCLVRSGPSLFCKDKLPIIETTRPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQEAXXXXXXXXXXXXXXXXXPKLSVDEAA 990
            MSKQSFPSNTNLNSKKANSNATQPTRTSVFNATA+NHQTTSLPPGWKREEILKPTGLYAGKTDIYYTSPTGQKIRSKAEMQKILGGSYDVSNFDWHSGKFVNSRKRPSTNENDSTSCKLMKMIEEYQQCLVRSGPSLFCKDKLPIIETTRPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQEAKVKELRRKLELVRRTLLPKLSVDEAA
Sbjct:    1 MSKQSFPSNTNLNSKKANSNATQPTRTSVFNATAINHQTTSLPPGWKREEILKPTGLYAGKTDIYYTSPTGQKIRSKAEMQKILGGSYDVSNFDWHSGKFVNSRKRPSTNENDSTSCKLMKMIEEYQQCLVRSGPSLFCKDKLPIIETTRPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQEAKVKELRRKLELVRRTLLPKLSVDEAA 298          
BLAST of methyl-CpG binding domain 2/3 vs. TrEMBL
Match: A0A183B4Y8 (MBD domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS14273 PE=4 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 2.157e-54
Identity = 110/276 (39.86%), Postives = 158/276 (57.25%), Query Frame = 1
Query:   97 MSKQSFPSNTNLNSKKANSNATQPTRTSVFNATAVNHQTT---SLPPGWKREEILKPTGLYAGKTDIYYTSPTGQKIRSKAEMQKILGGSYDVSNFDWHSGKFVNSRKRPSTNEN--DSTSCKLMKMIEEYQQCLVRSGPSLFCKDKLPIIETTRPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQE 909
            M  Q+   ++NL   K N+  T     S  N    N Q +   +LPPGWKREE ++PTGL  GKTDIYY SP GQK+R+K E++  LG  YD+S FDW SGKF+N+  +  + E+  + +S K+   +E       R  P    K   PI+  + P  +    A   N  QE P+Q+FW KRLAD+ A +P TNE  + + LP+  Q+AG PG    QL  S+++ I   T    P++GQ    ++IEKNPC+ + + QP++K  ++TD+ I RQE
Sbjct:    1 MQTQNVQIHSNLAQAKRNTYLTYSKNQSFTNNITSNGQQSVQVTLPPGWKREEAMRPTGLGTGKTDIYYVSPQGQKVRTKQELKVHLGEKYDLSLFDWRSGKFINNPPKSRSPEDGLEPSSAKI-PHLEHSSPLQRRFSPPDTLK---PIVIRSHPTCK---RADVKNITQEPPRQLFWEKRLADHVAVDPETNEAFKPLSLPRVIQSAGVPGYQTPQLIYSLLNAIATKTS---PIIGQEQASSAIEKNPCVAVNSLQPMIKTYIVTDEDIRRQE 266          
BLAST of methyl-CpG binding domain 2/3 vs. TrEMBL
Match: Q5DC71 (Methyl-CpG-binding domain protein 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_005268 PE=2 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 2.635e-54
Identity = 97/238 (40.76%), Postives = 143/238 (60.08%), Query Frame = 1
Query:  220 LPPGWKREEILKPTGLYAGKTDIYYTSPTGQKIRSKAEMQKILGGSYDVSNFDWHSGKF-----VNSRKRPSTNENDSTSCKLMKMIEEYQQCLVRSGPSLFCKDKLPIIETTRPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCI--YNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQEA 912
            LPPGWKREE ++P GL  GK+D+YY SP  Q +R+K EMQ ILG  YD+++FDW  GKF       S++      + S + K+ ++  +Y   + R   S    +  P+I  + P+ +  +     N N E+P Q+FW KRLAD+ A NP+T E  + + LPK  Q+AG PG    QL QS++  +   +S  N+ P++GQ    ++IEKNPC++I   QP++K  ++TDD I RQEA
Sbjct:   46 LPPGWKREECMRPNGLGTGKSDVYYISPQNQVVRNKQEMQTILGDKYDIASFDWRIGKFNMNNNNKSKRLEEVTADTSAAAKVPRLDNQYNLPVRRCLFSSTTNEIKPVIVRSHPECKRTDVK---NTNHEIPHQLFWEKRLADHMAINPDTGEPFKPISLPKGMQSAGVPGYQPTQLIQSLIHALSSSSSNNNSSPIIGQEQQPSAIEKNPCVIINHLQPMIKTFIVTDDDIRRQEA 280          
BLAST of methyl-CpG binding domain 2/3 vs. TrEMBL
Match: C1L5J0 (Methyl-CpG-binding domain protein 2 OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 7.363e-54
Identity = 97/238 (40.76%), Postives = 142/238 (59.66%), Query Frame = 1
Query:  220 LPPGWKREEILKPTGLYAGKTDIYYTSPTGQKIRSKAEMQKILGGSYDVSNFDWHSGKF-----VNSRKRPSTNENDSTSCKLMKMIEEYQQCLVRSGPSLFCKDKLPIIETTRPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCI--YNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQEA 912
            LPPGWKREE ++P GL  GK+D+YY SP  Q +R+K EMQ ILG  YD+++FDW  GKF       S++      + S + K+ ++   Y   + R   S    +  P+I  + P+ +  +     N N E+P Q+FW KRLAD+ A NP+T E  + + LPK  Q+AG PG    QL QS++  +   +S  N+ P++GQ    ++IEKNPC++I   QP++K  ++TDD I RQEA
Sbjct:   46 LPPGWKREECMRPNGLGTGKSDVYYISPQNQVVRNKQEMQTILGDKYDIASFDWRIGKFNMNNNNKSKRLEEVTADTSAAAKVPRLDNPYNLPVRRCLFSSTTNEIKPVIVRSHPECKRTDVK---NTNHEIPHQLFWEKRLADHMAINPDTGEPFKPISLPKGMQSAGVPGYQPTQLIQSLIHALSSSSSNNNSSPIIGQEQQPSAIEKNPCVIINHLQPMIKTFIVTDDDIRRQEA 280          
BLAST of methyl-CpG binding domain 2/3 vs. TrEMBL
Match: C4Q592 (Methyl-CpG binding domain protein OS=Schistosoma mansoni OX=6183 GN=MBD PE=2 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 4.473e-51
Identity = 99/247 (40.08%), Postives = 138/247 (55.87%), Query Frame = 1
Query:  214 TSLPPGWKREEILKPTGLYAGKTDIYYTSPTGQKIRSKAEMQKILGGSYDVSNFDWHSGKFVNS------------RKRPSTNENDSTSCKLMKMIEEYQQCLV--RSGPSLFCKDKLPIIETTRPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQEA 912
            +SLP GW+REE ++P GL  GK+D+YY SP  Q +R+K EMQ ILG  YD+  FDW  GKF  S            R    T +  S S    K+     QC +  R  P     D  P+I  + P+ +  +     N NQE P Q+FW KRLAD+ A +P+T E  + + LPK  Q+AG PG    QL  S++  + +S+    P++GQ    ++IEKNPC++I   QP++K  ++TDD I RQEA
Sbjct:   45 SSLPTGWRREECMRPNGLGTGKSDVYYISPQNQIVRNKQEMQTILGDKYDIGLFDWRMGKFAVSNNNINNNANKSKRLEEPTADTSSASSPTAKVPRVDNQCSLPMRRCPFPITNDIKPVIVRSHPECKRTDVK---NTNQETPHQLFWEKRLADHVAIDPDTGESFKPISLPKGIQSAGVPGYQPAQLVHSLIHALSSSSSKISPIIGQEQQPSAIEKNPCVVINHLQPMIKTFIVTDDDIRRQEA 288          
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Cavefish
Match: ENSAMXT00000030741.1 (methyl-CpG-binding domain protein 2-like [Source:NCBI gene;Acc:103022882])

HSP 1 Score: 137.502 bits (345), Expect = 5.694e-38
Identity = 83/233 (35.62%), Postives = 131/233 (56.22%), Query Frame = 1
Query:  217 SLPPGWKREEILKPTGLYAGKTDIYYTSPTGQKIRSKAEMQKILGGSYDVSNFDWHSGKFVNSRKRPSTNENDSTSCKLMKMIEEYQQCL-VRSGPSLFCKDKLPIIETT-RPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQE 909
            +LPPGWK+EE+++ +GL AGK+D+YY SPTG+K RSK ++ + LG + D+  FD+ +GK + S+ + +     S +  L K   +    L +R   S+F   K P+ +    P +++  D        E P+Q+FW KRL    + +  T E +R++ELPK  Q+ G P   +  L  +I S ++ S+    P+ GQ++  A  EKNP + +   QPL K   +TDD I  QE
Sbjct:   12 ALPPGWKKEEVIRKSGLSAGKSDVYYYSPTGKKFRSKPQLSRYLGNTVDLGCFDFRTGKMMPSKLQKNKQRLRSENLSLSKGKPDLNTALPIRQTASIF---KQPVTKIVNHPSNKVKTDL---QRATEQPRQLFWEKRLKGLRSSD-VTEEVLRTMELPKGLQSVG-PDASDETLLSAIASALHLSSG---PITGQTSTAA--EKNPAIWLNTFQPLCKAFTVTDDDIKEQE 231          
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Cavefish
Match: MBD3 (methyl-CpG binding domain protein 3 [Source:NCBI gene;Acc:103030820])

HSP 1 Score: 132.109 bits (331), Expect = 9.382e-36
Identity = 82/248 (33.06%), Postives = 138/248 (55.65%), Query Frame = 1
Query:  208 QTTSLPPGWKREEILKPTGLYAGKTDIYYTSPTGQKIRSKAEMQKILGGSYDVSNFDWHSGKFVNSRKRPSTNENDSTSCKLMKMIEEYQQCL-------------VRSGPSLFCKDKLPIIETT-RPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQE 909
            + ++LP GWK EE+ + +G+ AGK+D+YY SP+G+K RSK ++ + LG S D+S+FD+ +GK + S+     N+N        K    Y+Q +             VR   S+F   K P+ + T  P +++ +D        E+PKQ+FW K+L+   A++    E +++++LPK  Q  G PG  +  L  +I S ++ ++    P+ GQ +  A++EKNP + +   QPL K   +TD+ I +QE
Sbjct:    7 ECSALPNGWKMEEVTRKSGISAGKSDVYYFSPSGKKFRSKPQLVRYLGNSMDLSSFDFRTGKMIMSK----LNKN--------KQRLRYEQSVQNRGKPDLNTSLPVRQTASIF---KQPVTKVTNHPSNKVKSDP---QKAVELPKQLFWEKKLSGLNAYDI-AEELMKNLDLPKGLQGVG-PGYTDKTLLSAIASALHTTS---APITGQLS--AAVEKNPGVWLNTTQPLCKAFTVTDEDIRKQE 229          
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000463.1 (pep scaffold:Pmarinus_7.0:GL477935:20172:42036:1 gene:ENSPMAG00000000415.1 transcript:ENSPMAT00000000463.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.4413 bits (241), Expect = 5.872e-24
Identity = 66/212 (31.13%), Postives = 113/212 (53.30%), Query Frame = 1
Query:  286 IYYTSPTGQKIRSKAEMQKILGGSYDVSNFDWHSGKFVNSR----KRPSTNENDSTSCKLMKMIEEYQQCLVRSGPSLFCKDKLPIIETT-RPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQ 906
             YY SPTG+K RSK ++ + +G   D+  FD+ +G+ + S+    K+   NE  ++S   M +        +R   S+F   K PI + T  P +++ +D        +VPKQ+FW KRL    + +    E +R++ELP+  Q  G P I  + L  +I S +++S+    P+ GQ +   ++E+NP + +   QPL K  V+T+D + +Q
Sbjct:    1 FYYCSPTGKKFRSKPQLSRAVGHVVDLGCFDFRTGRMMPSKVQKNKQKLRNEMLNSSKGKMDLNTSLP---IRQTASIF---KQPITKVTNHPTNKVKHDP---QRIMDVPKQVFWEKRL-QGLSASDIAEEVMRAIELPRLLQGVG-PNITGDALLSTITSALHHSSG---PITGQLS--TAVERNPAVWLNTGQPLCKPFVVTEDDVRQQ 196          
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Sea Lamprey
Match: mbd2 (methyl-CpG binding domain protein 2 [Source:NCBI gene;Acc:337105])

HSP 1 Score: 79.7221 bits (195), Expect = 1.691e-17
Identity = 59/205 (28.78%), Postives = 102/205 (49.76%), Query Frame = 1
Query:  301 PTGQKIRSKAEMQKILGGSYDVSNFDWHSGKFVNSRKRPSTNENDSTSCKLMKMIEEYQQCL-VRSGPSLFCKDKLPIIETT-RPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQE 909
            P  +K R K ++ + LG   D+S+FD+ +GK +  + + +     +      K   +    L +R   S+F   K P+ +      S++  D     D  +  +Q+FW KRL   ++ +  T E ++S++LPK  Q  G PG     L  S+ S ++ S+ +   + GQ +  A +EKNP + +  +QPL K   +TDD I +QE
Sbjct:    1 PNVKKFRGKPQLARYLGTGADISSFDYRTGKLIPGKLQKNKIRLRNDQIGQGKGKPDLNTSLPIRQTASIF---KQPVTKVVNHSSSKVKADPHRAIDQPK--QQLFWEKRL-QGWSASDITEEILKSMDLPKGIQGVG-PGWSAETLLSSLASALHTSSSS---ITGQMS--AGVEKNPAIWLNTSQPLCKAFTVTDDDIRKQE 193          
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008619.1 (pep scaffold:Pmarinus_7.0:GL477432:7634:9441:-1 gene:ENSPMAG00000007809.1 transcript:ENSPMAT00000008619.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 44.669 bits (104), Expect = 3.338e-6
Identity = 21/49 (42.86%), Postives = 29/49 (59.18%), Query Frame = 1
Query:  205 HQTTSLPPGWKREEILKPTGLYAGKTDIYYTSPTGQKIRSKAEMQKILG 351
            H   SLP GW R+   + +G  AGK D+Y  SP G++ RS AE++   G
Sbjct:   14 HDDPSLPAGWLRKLKQRKSGRSAGKYDVYIFSPEGKQFRSHAELRVYFG 62          
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Nematostella
Match: EDO34622 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNU1])

HSP 1 Score: 73.559 bits (179), Expect = 2.629e-15
Identity = 72/242 (29.75%), Postives = 108/242 (44.63%), Query Frame = 1
Query:  217 SLPPGWKREEILKPTGLYAGKTDIYYTS------PT--GQKI---RSKAEMQKILGGSYDVSNFDWHSGKFVNSRKRPSTNENDSTSCKLMKMIEEYQQCLVRSGPSLFCKDKLPIIETTRPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQE 909
            SLP GW RE +L+ +G+ AG++D+YY S      PT  GQ I   RS+    + L G+                   P++    ST     + +  Y     +       K K+  I+T                ++E PKQ+FW KR+    A N     K+ +  L K F+  G PG+D   L  ++V+ I+  TK++I   GQS    ++EK+P + I  +QP     VITD  I  QE
Sbjct:   12 SLPKGWLREIVLRKSGVSAGRSDVYYYSDSSGMGPTALGQTILPRRSQPNFSRDLNGAI------------------PNSPVRQSTKSFSKQPVSYYPGRQAK-------KQKVEPIKT--------------KIDKEKPKQLFWEKRIQGLTAVNAEDERKLDAFNLGKTFRVIG-PGMDEKALVHALVTNIH--TKSSIK--GQSMSLVALEKHPEIWINVDQPPCAPFVITDADIKAQE 209          
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Medaka
Match: ENSORLT00000037808.1 (methyl-CpG-binding domain protein 2-like [Source:NCBI gene;Acc:101168266])

HSP 1 Score: 128.642 bits (322), Expect = 1.320e-34
Identity = 77/230 (33.48%), Postives = 133/230 (57.83%), Query Frame = 1
Query:  217 SLPPGWKREEILKPTGLYAGKTDIYYTSPTGQKIRSKAEMQKILGGSYDVSNFDWHSGKFVNSRKRPSTNENDSTSCKLMKMIE-EYQQCL-VRSGPSLFCKDKLPIIE-TTRPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDII 897
            +LPPGWK+EE+++ +GL AGK+D+YY SPTG+K RSK ++ + LG + D++ FD+ +GK +  + + +       +  L K  + +    L +R   S+F   K P+ + T+ P +++  D        E P+Q+FW KRL    + +    + +R++ELPK  Q  G P   ++ L  +I S ++ S+    P+ GQ++  A+ EKNP + + A+QPL +   +TD+ I
Sbjct:   11 ALPPGWKKEEVIRKSGLSAGKSDVYYYSPTGKKFRSKPQLARYLGNTVDLACFDFRTGKMMPGKLQKNKQRLRHETLSLAKGGKPDLNTALPIRQTASIF---KQPVTKVTSHPGNKVKTDL---QRAVEQPRQLFWEKRLKGLRSSD-VAEQVLRTMELPKGLQGVG-PDPSDDTLLSAIASALHMSS---APITGQTS--AAAEKNPAIWLNASQPLCRNFTVTDEQI 227          
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Medaka
Match: mbd3a (methyl-CpG-binding domain protein 3 [Source:NCBI gene;Acc:101172482])

HSP 1 Score: 127.487 bits (319), Expect = 5.315e-34
Identity = 84/246 (34.15%), Postives = 133/246 (54.07%), Query Frame = 1
Query:  214 TSLPPGWKREEILKPTGLYAGKTDIYY-------TSPTGQKIRSKAEMQKILGGSYDVSNFDWHSGKFVNS-----RKRPSTNENDSTSCKLMKMIEEYQQCL-VRSGPSLFCKDKLPIIETT-RPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQE 909
            ++LP GWK EE+ + +GL AGK+D+YY         P+G+K RSK ++ + LG   D+S+FD+ +GK + S     R+R   + N+    K      +    L VR   S+F   K P+ + T  P +++  D     D    P+Q+FW K+L+   A++    E VR++ELPK  Q  G PG  +  L  +I S ++ S     P+ GQ +  A++EKNP + +   QPL K  ++TD+ I +QE
Sbjct:    9 SALPKGWKMEEVTRKSGLSAGKSDVYYFRLGWGRGCPSGKKFRSKPQLARYLGNQMDLSSFDFRTGKMLMSKLNKNRQRLRYDNNNQNKGK-----PDLNTSLPVRQTASIF---KQPVTKVTNHPSNKVKTDPQKAVDQ---PRQLFWEKKLSGLNAYDI-AEELVRTMELPKGLQGVG-PGCTDKTLLSAIASALHTSA---APITGQLS--AAVEKNPGVWLNTAQPLCKAFIVTDEDIRKQE 236          
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Medaka
Match: ENSORLT00000040966.1 (methyl-CpG-binding domain protein 2-like [Source:NCBI gene;Acc:101168266])

HSP 1 Score: 127.872 bits (320), Expect = 3.774e-33
Identity = 77/230 (33.48%), Postives = 133/230 (57.83%), Query Frame = 1
Query:  217 SLPPGWKREEILKPTGLYAGKTDIYYTSPTGQKIRSKAEMQKILGGSYDVSNFDWHSGKFVNSRKRPSTNENDSTSCKLMKMIE-EYQQCL-VRSGPSLFCKDKLPIIE-TTRPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDII 897
            +LPPGWK+EE+++ +GL AGK+D+YY SPTG+K RSK ++ + LG + D++ FD+ +GK +  + + +       +  L K  + +    L +R   S+F   K P+ + T+ P +++  D        E P+Q+FW KRL    + +    + +R++ELPK  Q  G P   ++ L  +I S ++ S+    P+ GQ++  A+ EKNP + + A+QPL +   +TD+ I
Sbjct:   11 ALPPGWKKEEVIRKSGLSAGKSDVYYYSPTGKKFRSKPQLARYLGNTVDLACFDFRTGKMMPGKLQKNKQRLRHETLSLAKGGKPDLNTALPIRQTASIF---KQPVTKVTSHPGNKVKTDLQRA---VEQPRQLFWEKRLKGLRSSD-VAEQVLRTMELPKGLQGVG-PDPSDDTLLSAIASALHMSS---APITGQTS--AAAEKNPAIWLNASQPLCRNFTVTDEQI 227          
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Medaka
Match: mbd3a (methyl-CpG-binding domain protein 3 [Source:NCBI gene;Acc:101172482])

HSP 1 Score: 98.9821 bits (245), Expect = 5.742e-23
Identity = 70/213 (32.86%), Postives = 112/213 (52.58%), Query Frame = 1
Query:  292 YTSPTGQKIRSKAEMQKILGGSYDVSNFDWHSGKFVNS-----RKRPSTNENDSTSCKLMKMIEEYQQCL-VRSGPSLFCKDKLPIIETT-RPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQE 909
              SP+G+K RSK ++ + LG   D+S+FD+ +GK + S     R+R   + N+    K      +    L VR   S+F   K P+ + T  P +++  D     D    P+Q+FW K+L+   A++    E VR++ELPK  Q  G PG  +  L  +I S ++ S     P+ GQ +  A++EKNP + +   QPL K  ++TD+ I +QE
Sbjct:  111 LVSPSGKKFRSKPQLARYLGNQMDLSSFDFRTGKMLMSKLNKNRQRLRYDNNNQNKGK-----PDLNTSLPVRQTASIF---KQPVTKVTNHPSNKVKTDPQKAVDQ---PRQLFWEKKLSGLNAYDI-AEELVRTMELPKGLQGVG-PGCTDKTLLSAIASALHTSAA---PITGQLS--AAVEKNPGVWLNTAQPLCKAFIVTDEDIRKQE 305          
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Medaka
Match: ENSORLT00000036860.1 (methyl-CpG-binding domain protein 2-like [Source:NCBI gene;Acc:101168266])

HSP 1 Score: 95.9005 bits (237), Expect = 2.755e-22
Identity = 56/167 (33.53%), Postives = 96/167 (57.49%), Query Frame = 1
Query:  217 SLPPGWKREEILKPTGLYAGKTDIYYTSPTGQKIRSKAEMQKILGGSYDVSNFDWHSGKFVNSRKRPSTNENDSTSCKLMKMIE-EYQQCL-VRSGPSLFCKDKLPIIE-TTRPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNA 708
            +LPPGWK+EE+++ +GL AGK+D+YY SPTG+K RSK ++ + LG + D++ FD+ +GK +  + + +       +  L K  + +    L +R   S+F   K P+ + T+ P +++  D        E P+Q+FW KRL    + +    + +R++ELPK  Q  
Sbjct:   11 ALPPGWKKEEVIRKSGLSAGKSDVYYYSPTGKKFRSKPQLARYLGNTVDLACFDFRTGKMMPGKLQKNKQRLRHETLSLAKGGKPDLNTALPIRQTASIF---KQPVTKVTSHPGNKVKTDL---QRAVEQPRQLFWEKRLKGLRSSD-VAEQVLRTMELPKGLQGG 170          
BLAST of methyl-CpG binding domain 2/3 vs. Planmine SMEST
Match: SMESG000064034.1 (SMESG000064034.1)

HSP 1 Score: 579.711 bits (1493), Expect = 0.000e+0
Identity = 298/298 (100.00%), Postives = 298/298 (100.00%), Query Frame = 1
Query:   97 MSKQSFPSNTNLNSKKANSNATQPTRTSVFNATAVNHQTTSLPPGWKREEILKPTGLYAGKTDIYYTSPTGQKIRSKAEMQKILGGSYDVSNFDWHSGKFVNSRKRPSTNENDSTSCKLMKMIEEYQQCLVRSGPSLFCKDKLPIIETTRPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQEAXXXXXXXXXXXXXXXXXPKLSVDEAA 990
            MSKQSFPSNTNLNSKKANSNATQPTRTSVFNATAVNHQTTSLPPGWKREEILKPTGLYAGKTDIYYTSPTGQKIRSKAEMQKILGGSYDVSNFDWHSGKFVNSRKRPSTNENDSTSCKLMKMIEEYQQCLVRSGPSLFCKDKLPIIETTRPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQEAKVKELRRKLELVRRTLLPKLSVDEAA
Sbjct:    1 MSKQSFPSNTNLNSKKANSNATQPTRTSVFNATAVNHQTTSLPPGWKREEILKPTGLYAGKTDIYYTSPTGQKIRSKAEMQKILGGSYDVSNFDWHSGKFVNSRKRPSTNENDSTSCKLMKMIEEYQQCLVRSGPSLFCKDKLPIIETTRPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQEAKVKELRRKLELVRRTLLPKLSVDEAA 298          
BLAST of methyl-CpG binding domain 2/3 vs. Planmine SMEST
Match: SMESG000064034.1 (SMESG000064034.1)

HSP 1 Score: 546.199 bits (1406), Expect = 0.000e+0
Identity = 281/281 (100.00%), Postives = 281/281 (100.00%), Query Frame = 1
Query:  148 NSNATQPTRTSVFNATAVNHQTTSLPPGWKREEILKPTGLYAGKTDIYYTSPTGQKIRSKAEMQKILGGSYDVSNFDWHSGKFVNSRKRPSTNENDSTSCKLMKMIEEYQQCLVRSGPSLFCKDKLPIIETTRPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQEAXXXXXXXXXXXXXXXXXPKLSVDEAA 990
            NSNATQPTRTSVFNATAVNHQTTSLPPGWKREEILKPTGLYAGKTDIYYTSPTGQKIRSKAEMQKILGGSYDVSNFDWHSGKFVNSRKRPSTNENDSTSCKLMKMIEEYQQCLVRSGPSLFCKDKLPIIETTRPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQEAKVKELRRKLELVRRTLLPKLSVDEAA
Sbjct:    3 NSNATQPTRTSVFNATAVNHQTTSLPPGWKREEILKPTGLYAGKTDIYYTSPTGQKIRSKAEMQKILGGSYDVSNFDWHSGKFVNSRKRPSTNENDSTSCKLMKMIEEYQQCLVRSGPSLFCKDKLPIIETTRPDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKQVVITDDIINRQEAKVKELRRKLELVRRTLLPKLSVDEAA 283          
The following BLAST results are available for this feature:
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MBD37.343e-3936.05methyl-CpG binding domain protein 3 [Source:HGNC S... [more]
MBD22.489e-3734.76methyl-CpG binding domain protein 2 [Source:HGNC S... [more]
MBD32.520e-2734.47methyl-CpG binding domain protein 3 [Source:HGNC S... [more]
MBD38.871e-1932.26methyl-CpG binding domain protein 3 [Source:HGNC S... [more]
MBD32.186e-1831.89methyl-CpG binding domain protein 3 [Source:HGNC S... [more]
back to top
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
MBD-like7.577e-1230.99gene:FBgn0027950 transcript:FBtr0082068[more]
MBD-like2.382e-1130.99gene:FBgn0027950 transcript:FBtr0082069[more]
MBD-like2.439e-1130.99gene:FBgn0027950 transcript:FBtr0334654[more]
back to top
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mbd3a6.750e-3734.47methyl-CpG binding domain protein 3a [Source:ZFIN;... [more]
mbd3a6.750e-3734.47methyl-CpG binding domain protein 3a [Source:ZFIN;... [more]
mbd3b3.353e-2633.49methyl-CpG binding domain protein 3b [Source:ZFIN;... [more]
mbd3b3.601e-2633.49methyl-CpG binding domain protein 3b [Source:ZFIN;... [more]
mbd3b1.906e-2533.81methyl-CpG binding domain protein 3b [Source:ZFIN;... [more]
back to top
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cerkl4.642e-3935.59ceramide kinase like [Source:Xenbase;Acc:XB-GENE-6... [more]
cfap582.061e-3734.76cilia and flagella associated protein 58 [Source:X... [more]
cerkl4.645e-3232.81ceramide kinase like [Source:Xenbase;Acc:XB-GENE-6... [more]
cfap581.261e-2131.55cilia and flagella associated protein 58 [Source:X... [more]
ENSXETT00000040006.12.026e-1046.88methyl-CpG binding domain protein 1 [Source:NCBI g... [more]
back to top
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mbd39.096e-4036.48methyl-CpG binding domain protein 3 [Source:MGI Sy... [more]
Mbd21.914e-3734.76methyl-CpG binding domain protein 2 [Source:MGI Sy... [more]
Mbd33.463e-2834.95methyl-CpG binding domain protein 3 [Source:MGI Sy... [more]
Mbd33.493e-2834.95methyl-CpG binding domain protein 3 [Source:MGI Sy... [more]
Mbd31.382e-2430.77methyl-CpG binding domain protein 3 [Source:MGI Sy... [more]
back to top
BLAST of methyl-CpG binding domain 2/3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Z2D8|MBD3_MOUSE6.363e-3936.48Methyl-CpG-binding domain protein 3 OS=Mus musculu... [more]
sp|O95983|MBD3_HUMAN3.526e-3836.05Methyl-CpG-binding domain protein 3 OS=Homo sapien... [more]
sp|Q9UBB5|MBD2_HUMAN1.195e-3634.76Methyl-CpG-binding domain protein 2 OS=Homo sapien... [more]
sp|Q9Z2E1|MBD2_MOUSE1.339e-3634.76Methyl-CpG-binding domain protein 2 OS=Mus musculu... [more]
sp|Q9Z2E2|MBD1_MOUSE1.175e-1146.77Methyl-CpG-binding domain protein 1 OS=Mus musculu... [more]
back to top
BLAST of methyl-CpG binding domain 2/3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V5UX130.000e+099.66Methyl-CpG binding domain 2/3 OS=Schmidtea mediter... [more]
A0A183B4Y82.157e-5439.86MBD domain-containing protein OS=Echinostoma capro... [more]
Q5DC712.635e-5440.76Methyl-CpG-binding domain protein 2 OS=Schistosoma... [more]
C1L5J07.363e-5440.76Methyl-CpG-binding domain protein 2 OS=Schistosoma... [more]
C4Q5924.473e-5140.08Methyl-CpG binding domain protein OS=Schistosoma m... [more]
back to top
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSAMXT00000030741.15.694e-3835.62methyl-CpG-binding domain protein 2-like [Source:N... [more]
MBD39.382e-3633.06methyl-CpG binding domain protein 3 [Source:NCBI g... [more]
back to top
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000000463.15.872e-2431.13pep scaffold:Pmarinus_7.0:GL477935:20172:42036:1 g... [more]
mbd21.691e-1728.78methyl-CpG binding domain protein 2 [Source:NCBI g... [more]
ENSPMAT00000008619.13.338e-642.86pep scaffold:Pmarinus_7.0:GL477432:7634:9441:-1 ge... [more]
back to top
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO346222.629e-1529.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of methyl-CpG binding domain 2/3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000037808.11.320e-3433.48methyl-CpG-binding domain protein 2-like [Source:N... [more]
mbd3a5.315e-3434.15methyl-CpG-binding domain protein 3 [Source:NCBI g... [more]
ENSORLT00000040966.13.774e-3333.48methyl-CpG-binding domain protein 2-like [Source:N... [more]
mbd3a5.742e-2332.86methyl-CpG-binding domain protein 3 [Source:NCBI g... [more]
ENSORLT00000036860.12.755e-2233.53methyl-CpG-binding domain protein 2-like [Source:N... [more]
back to top
BLAST of methyl-CpG binding domain 2/3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000064034.10.000e+0100.00SMESG000064034.1[more]
SMESG000064034.10.000e+0100.00SMESG000064034.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30035880
GenBankAHB82104.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035880 ID=SMED30035880|Name=methyl-CpG binding domain 2/3|organism=Schmidtea mediterranea sexual|type=transcript|length=1080bp
CTTTGTTTTAATTTACCAATTAAAAGAAGTTTTGACATTTTTTGTAATAA
TTAATCTTGAGTTCTTTTTAAAATTCAATTTTTGAAATAATCTAAAATGA
GTAAGCAATCATTTCCTTCAAATACCAATCTTAATTCCAAAAAAGCTAAT
TCAAATGCCACTCAGCCTACAAGAACCTCAGTTTTTAATGCAACAGCTGT
AAATCATCAAACAACATCTCTTCCTCCTGGTTGGAAACGCGAAGAAATTT
TAAAACCTACTGGTCTTTATGCAGGGAAAACAGATATATACTATACTAGT
CCGACAGGTCAAAAAATTAGATCTAAAGCTGAGATGCAAAAGATACTTGG
AGGAAGTTATGATGTTTCAAATTTTGATTGGCATTCAGGAAAGTTTGTTA
ATTCCCGTAAAAGGCCTAGCACCAACGAAAATGATAGCACTAGTTGCAAA
TTAATGAAAATGATTGAAGAATATCAACAATGCTTAGTTAGAAGCGGTCC
TAGCTTATTCTGTAAAGATAAGCTGCCAATCATTGAAACTACTCGTCCAG
ACAGTAGGATAAATAATGATGCAGTTGGAGGAAATGATAATCAAGAAGTA
CCCAAACAAATTTTCTGGCATAAAAGGCTCGCCGATAATTATGCCTTTAA
TCCAAATACCAATGAAAAAGTCCGTTCCGTGGAATTGCCCAAAGAATTTC
AGAATGCTGGGTTCCCAGGGATCGACAATAACCAATTGTTTCAGAGCATT
GTCTCGTGTATATACAACTCAACTAAAAACAATATTCCCGTGCTCGGTCA
AAGTAACCATAAAGCGAGTATTGAGAAAAATCCCTGCCTACTTATCACAG
CCAATCAGCCATTGGTCAAACAAGTAGTCATCACCGATGATATCATTAAT
CGACAAGAGGCCAAAGTGAAAGAATTGCGACGGAAATTAGAACTGGTGCG
ACGAACGCTTCTGCCAAAATTGAGCGTAGATGAAGCAGCCTAAACAAATG
AGATTTTGTGTAACATCAAGAAATCGATAATAAAAATGATAGCAGCTTGT
ATTTGTTTAATAAATGTTTTTAAATCATAA
back to top

protein sequence of SMED30035880-orf-1

>SMED30035880-orf-1 ID=SMED30035880-orf-1|Name=SMED30035880-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=299bp
MSKQSFPSNTNLNSKKANSNATQPTRTSVFNATAVNHQTTSLPPGWKREE
ILKPTGLYAGKTDIYYTSPTGQKIRSKAEMQKILGGSYDVSNFDWHSGKF
VNSRKRPSTNENDSTSCKLMKMIEEYQQCLVRSGPSLFCKDKLPIIETTR
PDSRINNDAVGGNDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKE
FQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLI
TANQPLVKQVVITDDIINRQEAKVKELRRKLELVRRTLLPKLSVDEAA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0008327methyl-CpG binding
GO:0003677DNA binding
Vocabulary: cellular component
TermDefinition
GO:0016581NuRD complex
GO:0042025host cell nucleus
GO:0005634nucleus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR037965MBD3
IPR001739Methyl_CpG_DNA-bd
IPR025884MeCpG-bd_2/3_C_dom
IPR016177DNA-bd_dom_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 267..287
NoneNo IPR availableGENE3DG3DSA:3.30.890.10coord: 35..106
e-value: 3.7E-24
score: 86.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..30
NoneNo IPR availablePANTHERPTHR12396METHYL-CPG BINDING PROTEIN, MBDcoord: 38..283
NoneNo IPR availableCDDcd01396MeCP2_MBDcoord: 42..100
e-value: 4.6846E-19
score: 77.7981
IPR001739Methyl-CpG DNA bindingSMARTSM00391TAM_2coord: 35..107
e-value: 1.5E-9
score: 47.7
IPR001739Methyl-CpG DNA bindingPFAMPF01429MBDcoord: 36..98
e-value: 5.6E-14
score: 51.6
IPR001739Methyl-CpG DNA bindingPROSITEPS50982MBDcoord: 32..100
score: 15.968
IPR025884Methyl-CpG binding protein 2/3, C-terminal domainPFAMPF14048MBD_Ccoord: 189..283
e-value: 2.4E-23
score: 82.6
IPR037965Methyl-CpG-binding domain protein 3PANTHERPTHR12396:SF12METHYL-CPG-BINDING DOMAIN PROTEIN 3coord: 38..283
IPR016177DNA-binding domain superfamilySUPERFAMILYSSF54171DNA-binding domaincoord: 17..107