Collagen alpha-1(XXVII) chain B

Overview
NameCollagen alpha-1(XXVII) chain B
Smed IDSMED30035878
Length (bp)9341
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Collagen alpha-1(XXVII) chain B (SMED30035878) t-SNE clustered cells

Violin plots show distribution of expression levels for Collagen alpha-1(XXVII) chain B (SMED30035878) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Collagen alpha-1(XXVII) chain B (SMED30035878) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Collagen alpha-1(XXVII) chain B (SMED30035878) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035878

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30035878h1SMcG0019141 Contig48518uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035878h1SMcG0019141 Contig48518newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035878h1SMcG0019141 Contig13423newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035878h1SMcG0019141 Contig13423uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30035878h1SMcG0019141 SMED_02049_V2_1rGPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Human
Match: COL1A2 (collagen type I alpha 2 chain [Source:HGNC Symbol;Acc:HGNC:2198])

HSP 1 Score: 154.451 bits (389), Expect = 1.926e-36
Identity = 79/237 (33.33%), Postives = 117/237 (49.37%), Query Frame = 1
Query: 8530 RDLLNDDALAVKYLGSDVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASDVTEYRSWFGE-ITGTFKFDYQIE-------ASQLMFLKLFSTNARQRITINCSRLSV-----VGNSEHPVILYSDHDEEVLRNGD-LFKYSVIRDGCKNSAEIIDSTELEMDT-EAIRLPIRDIA-LNTGSSKEQQQFGLDIGQVCF 9192
            +D   D  L       + +  P G++  PARTC+ L  ++P    G+Y+IDPN G   DA +V C     E+CI ++  +   K+W  S   +   W GE I    +F+Y +E       A+QL F++L +  A Q IT +C           GN +  VIL   +D E++  G+  F Y+V+ DGC         T +E  T +  RLP  DIA L+ G +   Q+F +DIG VCF
Sbjct: 1131 KDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGA--DQEFFVDIGPVCF 1365          

HSP 2 Score: 105.145 bits (261), Expect = 2.064e-21
Identity = 79/258 (30.62%), Postives = 130/258 (50.39%), Query Frame = -3
Query:  229 QNDQPKTEKISSIDPNDEDEDIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCI--EPEVV---NYKKTSYTKTISSWFSVLASLNKQISYKIP-------KEQLVFXXXXXXXXXXXXXXSCDQIALVSDDSITQDIRYNNSVQLFGDDNQILTVNNEDDLFQYKVVEDTCKDKSNN-GRAVIKVEXXXXXXXXXXXLNFKSIENSRPAMIGIEIGPVCF 963
            + DQP++    S+ P D + D    L  L++ ++ L  P GS+  PAR+C D++  +   S+G ++IDPN G   DAI V+C+F   ETCI  +PE +   N+ ++S  K    W     +   Q  Y +          QL F++L +  +SQ +T  C   ++   D  T +++   +V L G  N +  V   +  F Y V+ D C  K+N  G+ +I+ + ++P RLP  D+    I  +      ++IGPVCF
Sbjct: 1118 RADQPRS--APSLRPKDYEVDA--TLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKK-HVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYASQNITYHCKN-SIAYMDEETGNLK--KAVILQG-SNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFF-VDIGPVCF 1365          

HSP 3 Score: 80.1073 bits (196), Expect = 7.264e-14
Identity = 183/484 (37.81%), Postives = 229/484 (47.31%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGV---------------IGSLGSQGFPGARGPQGILGSPGPRGRTG---SKGSQGTIGIAGVPGTPGKDGKAGQVG---------IXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQ 7011
             GEPG  G TGP G    +GP G  G  G+ G  GK G  G RG +GPQG  G PG   T G PG  G  GH G+ G+ G+PG                        + G  G  G+ G++G PG  G RG PGE G  G  G  G  G  G  G  G  G  G  GP G  G  G  GE+G+ G+ GP GP+G  G  G PG+                G+ G+ G PG  G  G+   PGPRG  G   + G+ G  G+ G PG  G  G++G  G          PG +G  G+ GP G  G  G PG  G  G  G  G PG + + G  GP G RG  G +G  G  G+ G PG+ GL GP G PG+      PG+ GP+      G +GP G PGI G  G  GP G RGE G++G  G +GP G+               PGK+G+ G   + GA+G  GP G++G +GP G  G+Q
Sbjct:  117 AGEPGEPGQTGPAGA---RGPAGPPGKAGEDGHPGKPGRPGERGVVGPQGARGFPG---TPGLPGFKGIRGHNGLDGLKGQPG------------------------APGVKGEPGAPGENGTPGQTGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGEIGAVGNAGPAGPAGPRGEVGLPGLSGPVGPPGNPGANGLTGAKGAAGLPGVAGAPGL---PGPRGIPGPVGAAGATGARGLVGEPGPAGSKGESGNKGEPGSAGPQGPPGPSGEEGKRGPNGEAGSAGPPGPPGLRGSPGSRGLPGADGRAGVMGPPGSRGASGPAGVRGPNGDAGRPGEPGLMGPRGLPGS------PGNIGPA------GKEGPVGLPGIDGRPGPIGPAGARGEPGNIGFPGPKGPTGD---------------PGKNGDKGHAGLAGARGAPGPDGNNGAQGPPGPQGVQ 540          

HSP 4 Score: 77.7962 bits (190), Expect = 3.882e-13
Identity = 117/298 (39.26%), Postives = 146/298 (48.99%), Query Frame = 1
Query: 6211 GPSGSPGLRGNPGVIGSLGSQGFPGARGP---------------QGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
            GP G  G  G  G +G++G  GF G +GP               QG+LG+PG  G  GS+G +G  G+AG  G PG       +GI G  G  G PG VG  G+ G PG+ G+ G  G  G PG++ QPG +G   ERG PG                      IGP G +G  G  G  GP+G  GN+G  GP G  G AG  G  GP GP+G  GD G  GE+GP G     G++G NG  G+PG  G +G     G+ G  GP G +G  GP G  G  G PG++G  G  G  G
Sbjct:  820 GPRGDQGPVGRTGEVGAVGPPGFAGEKGPSGEAGTAGPPGTPGPQGLLGAPGILGLPGSRGERGLPGVAGAVGEPGP------LGIAGPPGARGPPGAVGSPGVNGAPGEAGRDGNPGNDGPPGRDGQPGHKG---ERGYPGN---------------------IGPVGAAGAPGPHGPVGPAGKHGNRGETGPSGPVGPAGAVGPRGPSGPQGIRGDKGEPGEKGPRGL---PGLKGHNGLQGLPGIAGHHGDQGAPGSVGPAGPRGPAGPSGPAGKDGRTGHPGTVGPAGIRGPQG 1084          

HSP 5 Score: 77.0258 bits (188), Expect = 6.169e-13
Identity = 197/547 (36.01%), Postives = 227/547 (41.50%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGR---------------RGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPG------------SDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDI---------------GPMGPSGSPGL---------------RGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGE------------QGPVGEVGNAGIRGVNGAPGIPGKDG---ENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMG 7068
            G PG  G  GP G  G  G  G+ G KG RG  G DG+ G  G  G +G  GAPG                RG VG+PGP G  G  G  G  G  G  G  G  G PG PG +G  G  G+ G  G  G  G+ G PG            ++G  GA G  G PG AG  G  G +G PG  G  G +G RG  G  G  G  GE G+KG+                G  GP+G  G                RG PG  G  G  G PG+RG  G  G  GP G  G  G  G +G  G+PG+PG  G AG+ G                                   G PG + +PGP GP G RG PG                      IG PG  G  G PG NG    KG+ G  G  G PG  G+NGA GP GP+G  G  G  G              GP GEVG  G RG++G  G+PG  G   E G     GA G  GPIGS G  GP G  G +G PG +G  G  G +GP G
Sbjct:  151 GRPGERGVVGPQGARGFPGTPGLPGFKGIRGHNGLDGLKGQPGAPGVKGEPGAPGENGTPGQTGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGEIGAVGNAGPAGPAGPRGEVGLPGLSGPVGPPGNPGANGLTGAKGAAGLPGVAGAPGLPGPRGIPGPVGAAGATGARGLVGEPGPAGSKGESGNKGEPGSAGPQGPPGPSGEEGKRGPNGEAGSAGPPGPPGLRGSPGSRGLPGADGRAGVMGPPGSRGASGPAGVRGPNGDAGRPGEPGLMGPRGLPGSPGNIGPAGKEG---------------------------------PVGLPGIDGRPGPIGPAGARGEPGN---------------------IGFPGPKGPTGDPGKNG---DKGHAGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPPGPPGFQGLPGPSGPAGEVGKPGERGLHGEFGLPGPAGPRGERGPPGESGAAGPTGPIGSRGPSGPPGPDGNKGEPGVVGAVGTAGPSGPSG 640          

HSP 6 Score: 67.0106 bits (162), Expect = 6.524e-10
Identity = 171/452 (37.83%), Postives = 198/452 (43.81%), Query Frame = 1
Query: 5977 GIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNG---------------------PSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDL------------------------GNTGEQGPVGEVGN---AGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGP 7188
            G +G  G+ G PG  G  GA G  G PGKAG DG  G  G PG+                           +G +GP G  G PG  G PG  G  G  G  G +G  G  G  G  G  G  G+ G  G  G+PG  G+ G  G  G  G +G  G  GP GPIG  G PG  G PGP G  G  G     GP GP GE G PG SG  G PGN G  G +G +G  G PG +G  GLPG  G                     P+G+KG  G+KG  G  G  G  G SG +G RG NG+                         G  G  GP G  G    AG+RG NG  G PG+ G  G   + G+ GNIGP   +G+ GP G+ GI G PG IG  G  G  G +G  G  G  G PG  G  G  G  G +G PG  G  G  GP
Sbjct:  112 GFQGPAGEPGEPGQTGPAGARGPAGPPGKAGEDGHPGKPGRPGE---------------------------RGVVGPQGARGFPGTPGLPGFKGIRGHNGLDGLKGQPGAPGVKGEPGAPGENGTPGQTGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGEIGAVGNAGPAGPAGPRGEVGLPGLSGPVGPPGNPGANGLTGAKGAAGLPGVAGAPGLPGPRGIPGPVGAAGATGARGLVGEPGPAGSKGESGNKGEPGSAGPQGPPGPSGEEGKRGPNGEAGSAGPPGPPGLRGSPGSRGLPGADGRAGVMGPPGSRGASGPAGVRGPNGDAGRPGEPGLMGPRGLPGSPGNIGP---AGKEGPVGLPGIDGRPGPIGPAGARGEPGNIGFPGPKGPTGDPGKNGDKGHAGLAGARGAPGPDGNNGAQGP 533          

HSP 7 Score: 63.929 bits (154), Expect = 5.535e-9
Identity = 86/217 (39.63%), Postives = 102/217 (47.00%), Query Frame = 1
Query: 6640 SGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGI---PGKDGENGKDAVDGAKG------NIGPIGSSGRRGPQGMTGIQGPPGSIGLK---------------GDIGSTGP---------MGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
             G QGP G PG  GQ G  G+ GP+G  G  G  G  GKPG  G+ G  GPQG RG  G  G  G +G  G  G  G++G  GAPG+   PG  GENG     GA+G       +G  G +G RG  G  G  GP G IG                 G +G+ GP         +G  G+ G  G PG  G  G  G KG  GLPG  G PG+ GP+
Sbjct:  111 QGFQGPAGEPGEPGQTGPAGARGPAGPPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGIRGHNGLDGLKGQPGAPGVKGEPGAPGENGTPGQTGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGEIGAVGNAGPAGPAGPRGEVGLPGLSGPVGPPGNPGANGLTGAKGAAGLPGVAGAPGLPGPR 327          

HSP 8 Score: 63.1586 bits (152), Expect = 1.023e-8
Identity = 181/485 (37.32%), Postives = 209/485 (43.09%), Query Frame = 1
Query: 5662 GPTGPTGVPGM------------KGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGI---AGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGP---------RGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGD 7044
            GP G  G+PG+             G  G KG  G  G  G  G+ GPRG  GP G  GA G RG VG PGP G+ G  G +G  G  G QG PG  G  G  G  G  G  G  G  G++GS G  G PG+DG+ G     G PG  G  GP+GV+G  G                        + G  G+ G MGP G PG  GN G  G  G  G PG      I G PGP G  G++G  G IG     G  G PGK+G  G  G+                                     G    PGP G  G +GPPG  G  G  G  GPPG  G QG  GP G +G+ G PG  G  G  G  G  GP G+ G  G++GA+GP GP          G +   GN GE G VG VG AG  G +G PG  G  G  G     G  G  G IG+ GR G +G  G  G PG  G  GD
Sbjct:  280 GPRGEVGLPGLSGPVGPPGNPGANGLTGAKGAAGLPGVAGAPGLPGPRGIPGPVGAAGATGARGLVGEPGPAGSKGESGNKGEPGSAGPQGPPGPSGEEGKRGPNGEAGSAGPPGPPGLRGSPGSRGLPGADGRAGV---MGPPGSRGASGPAGVRGPNG------------------------DAGRPGEPGLMGPRGLPGSPGNIGPAGKEGPVGLPG------IDGRPGPIGPAGARGEPGNIGFPGPKGPTGDPGKNGDKGHAGLA------------------------------------GARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPPGPPGFQGLPGPSGPAGEVGKPGERGLHGEFGLPGPAGPRGERGPPGESGAAGPTGPIGSRGPSGPPGPD---GNKGEPGVVGAVGTAGPSGPSGLPGERGAAGIPGGKGEKGEPGLRGEIGNPGRDGARGAPGAVGAPGPAGATGD 692          

HSP 9 Score: 62.7734 bits (151), Expect = 1.470e-8
Identity = 182/533 (34.15%), Postives = 217/533 (40.71%), Query Frame = 1
Query: 5662 GPT----------------------GPTGV---------------PGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGV---------IGSLGSQGFPGARGPQGILGSPG------------PRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPV------GEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMG 7068
            GP                       GP G+                G +GP G  G+ GQ G  G  G  GP G  G  G  G PGR G  G  GP G  G PG  G+ G                         KG +G  G+ G  GQ G PG  G+ GAPGE+G PG+ G  G  G +G  G  G  G                    GS G +GP+GP+G  G  G PG          IG++G+ G  G  GP+G +G PG              G TG+KG+ G  G+AG PG PG  G  G VG  G  G  G  G                              +PGP G  GE G  G+ G  G  G  GP G+ G +GP G  G++G  G PG  G  G++G  G+ G  G  G  G  GASGP G RG NGD G  GE G +      G  GN G  G  G  G+PG DG  G     GA+G  G IG  G +GP G  G  G  G  GL G  G+ GP G
Sbjct:   66 GPPGPPGLGGNFAAQYDGKGVGLGPGPMGLMGPRGPPGAAGAPGPQGFQGPAGEPGEPGQTGPAGARGPAGPPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPG------------------------FKGIRGHNGLDGLKGQPGAPGVKGEPGAPGENGTPGQTGARGLPGERGRVGAPGPAGA------------------RGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGEIGAVGNAGPAGPAGPRGEVGLPGLSGPVGPPGNPGANGLTGAKGAAGLPGVAGAPGLPGPRGIPGPVGAAGATGARGLVG------------------------------EPGPAGSKGESGNKGEPGSAGPQGPPGPSGEEGKRGPNGEAGSAGPPGPPGLRGSPGSRGLPGADGRAGVMGPPGSRGASGPAGVRGPNGDAGRPGEPGLMGPRGLPGSPGNIGPAGKEGPVGLPGIDGRPGPIGPAGARGEPGNIGFPGPKGPTGDPGKNGDKGHAGLAGARGAPGPDG 526          

HSP 10 Score: 56.9954 bits (136), Expect = 8.076e-7
Identity = 113/299 (37.79%), Postives = 137/299 (45.82%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVP---------------GMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGA------------------------PGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVG 6420
            TG PG  G TGP G                 G++GP   +GD+G  GR G+ G +GP G  G +GP+G                         PG RG  G PG  G  G PG  GI+   G  G  G  G  G PG+ G  GE G  G  G  G  G+DG PG  G+RG PG  G  G AG  GP G  G  GK             G RG  G  G +G  G +GP GPSG  G+RG+ G  G  G +G PG +G  G+ G PG  G  G +G+ G++G AG  G  G  G AG+ G
Sbjct:  786 TGFPGAAGRTGPPGPSGISGPPGPPGPAGKEGLRGP---RGDQGPVGRTGEVGAVGPPGFAGEKGPSGEAGTAGPPGTPGPQGLLGAPGILGLPGSRGERGLPGVAGAVGEPGPLGIA---GPPGARGPPGAVGSPGVNGAPGEAGRDGNPGNDGPPGRDGQPGHKGERGYPGNIGPVGAAGAPGPHGPVGPAGKH------------GNRGETGPSGPVGPAGAVGPRGPSGPQGIRGDKGEPGEKGPRGLPGLKGHNGLQGLPGIAGHHGDQGAPGSVGPAGPRGPAGPSGPAGKDG 1066          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Human
Match: COL1A2 (collagen type I alpha 2 chain [Source:HGNC Symbol;Acc:HGNC:2198])

HSP 1 Score: 154.066 bits (388), Expect = 2.058e-36
Identity = 79/237 (33.33%), Postives = 117/237 (49.37%), Query Frame = 1
Query: 8530 RDLLNDDALAVKYLGSDVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASDVTEYRSWFGE-ITGTFKFDYQIE-------ASQLMFLKLFSTNARQRITINCSRLSV-----VGNSEHPVILYSDHDEEVLRNGD-LFKYSVIRDGCKNSAEIIDSTELEMDT-EAIRLPIRDIA-LNTGSSKEQQQFGLDIGQVCF 9192
            +D   D  L       + +  P G++  PARTC+ L  ++P    G+Y+IDPN G   DA +V C     E+CI ++  +   K+W  S   +   W GE I    +F+Y +E       A+QL F++L +  A Q IT +C           GN +  VIL   +D E++  G+  F Y+V+ DGC         T +E  T +  RLP  DIA L+ G +   Q+F +DIG VCF
Sbjct: 1129 KDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGA--DQEFFVDIGPVCF 1363          

HSP 2 Score: 105.145 bits (261), Expect = 1.912e-21
Identity = 79/258 (30.62%), Postives = 130/258 (50.39%), Query Frame = -3
Query:  229 QNDQPKTEKISSIDPNDEDEDIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCI--EPEVV---NYKKTSYTKTISSWFSVLASLNKQISYKIP-------KEQLVFXXXXXXXXXXXXXXSCDQIALVSDDSITQDIRYNNSVQLFGDDNQILTVNNEDDLFQYKVVEDTCKDKSNN-GRAVIKVEXXXXXXXXXXXLNFKSIENSRPAMIGIEIGPVCF 963
            + DQP++    S+ P D + D    L  L++ ++ L  P GS+  PAR+C D++  +   S+G ++IDPN G   DAI V+C+F   ETCI  +PE +   N+ ++S  K    W     +   Q  Y +          QL F++L +  +SQ +T  C   ++   D  T +++   +V L G  N +  V   +  F Y V+ D C  K+N  G+ +I+ + ++P RLP  D+    I  +      ++IGPVCF
Sbjct: 1116 RADQPRS--APSLRPKDYEVDA--TLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKK-HVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYASQNITYHCKN-SIAYMDEETGNLK--KAVILQG-SNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFF-VDIGPVCF 1363          

HSP 3 Score: 80.4925 bits (197), Expect = 5.687e-14
Identity = 183/484 (37.81%), Postives = 229/484 (47.31%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGV---------------IGSLGSQGFPGARGPQGILGSPGPRGRTG---SKGSQGTIGIAGVPGTPGKDGKAGQVG---------IXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQ 7011
             GEPG  G TGP G    +GP G  G  G+ G  GK G  G RG +GPQG  G PG   T G PG  G  GH G+ G+ G+PG                        + G  G  G+ G++G PG  G RG PGE G  G  G  G  G  G  G  G  G  G  GP G  G  G  GE+G+ G+ GP GP+G  G  G PG+                G+ G+ G PG  G  G+   PGPRG  G   + G+ G  G+ G PG  G  G++G  G          PG +G  G+ GP G  G  G PG  G  G  G  G PG + + G  GP G RG  G +G  G  G+ G PG+ GL GP G PG+      PG+ GP+      G +GP G PGI G  G  GP G RGE G++G  G +GP G+               PGK+G+ G   + GA+G  GP G++G +GP G  G+Q
Sbjct:  115 AGEPGEPGQTGPAGA---RGPAGPPGKAGEDGHPGKPGRPGERGVVGPQGARGFPG---TPGLPGFKGIRGHNGLDGLKGQPG------------------------APGVKGEPGAPGENGTPGQTGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGEIGAVGNAGPAGPAGPRGEVGLPGLSGPVGPPGNPGANGLTGAKGAAGLPGVAGAPGL---PGPRGIPGPVGAAGATGARGLVGEPGPAGSKGESGNKGEPGSAGPQGPPGPSGEEGKRGPNGEAGSAGPPGPPGLRGSPGSRGLPGADGRAGVMGPPGSRGASGPAGVRGPNGDAGRPGEPGLMGPRGLPGS------PGNIGPA------GKEGPVGLPGIDGRPGPIGPAGARGEPGNIGFPGPKGPTGD---------------PGKNGDKGHAGLAGARGAPGPDGNNGAQGPPGPQGVQ 538          

HSP 4 Score: 77.7962 bits (190), Expect = 3.391e-13
Identity = 117/298 (39.26%), Postives = 146/298 (48.99%), Query Frame = 1
Query: 6211 GPSGSPGLRGNPGVIGSLGSQGFPGARGP---------------QGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
            GP G  G  G  G +G++G  GF G +GP               QG+LG+PG  G  GS+G +G  G+AG  G PG       +GI G  G  G PG VG  G+ G PG+ G+ G  G  G PG++ QPG +G   ERG PG                      IGP G +G  G  G  GP+G  GN+G  GP G  G AG  G  GP GP+G  GD G  GE+GP G     G++G NG  G+PG  G +G     G+ G  GP G +G  GP G  G  G PG++G  G  G  G
Sbjct:  818 GPRGDQGPVGRTGEVGAVGPPGFAGEKGPSGEAGTAGPPGTPGPQGLLGAPGILGLPGSRGERGLPGVAGAVGEPGP------LGIAGPPGARGPPGAVGSPGVNGAPGEAGRDGNPGNDGPPGRDGQPGHKG---ERGYPGN---------------------IGPVGAAGAPGPHGPVGPAGKHGNRGETGPSGPVGPAGAVGPRGPSGPQGIRGDKGEPGEKGPRGL---PGLKGHNGLQGLPGIAGHHGDQGAPGSVGPAGPRGPAGPSGPAGKDGRTGHPGTVGPAGIRGPQG 1082          

HSP 5 Score: 77.411 bits (189), Expect = 4.710e-13
Identity = 197/547 (36.01%), Postives = 227/547 (41.50%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGR---------------RGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPG------------SDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDI---------------GPMGPSGSPGL---------------RGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGE------------QGPVGEVGNAGIRGVNGAPGIPGKDG---ENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMG 7068
            G PG  G  GP G  G  G  G+ G KG RG  G DG+ G  G  G +G  GAPG                RG VG+PGP G  G  G  G  G  G  G  G  G PG PG +G  G  G+ G  G  G  G+ G PG            ++G  GA G  G PG AG  G  G +G PG  G  G +G RG  G  G  G  GE G+KG+                G  GP+G  G                RG PG  G  G  G PG+RG  G  G  GP G  G  G  G +G  G+PG+PG  G AG+ G                                   G PG + +PGP GP G RG PG                      IG PG  G  G PG NG    KG+ G  G  G PG  G+NGA GP GP+G  G  G  G              GP GEVG  G RG++G  G+PG  G   E G     GA G  GPIGS G  GP G  G +G PG +G  G  G +GP G
Sbjct:  149 GRPGERGVVGPQGARGFPGTPGLPGFKGIRGHNGLDGLKGQPGAPGVKGEPGAPGENGTPGQTGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGEIGAVGNAGPAGPAGPRGEVGLPGLSGPVGPPGNPGANGLTGAKGAAGLPGVAGAPGLPGPRGIPGPVGAAGATGARGLVGEPGPAGSKGESGNKGEPGSAGPQGPPGPSGEEGKRGPNGEAGSAGPPGPPGLRGSPGSRGLPGADGRAGVMGPPGSRGASGPAGVRGPNGDAGRPGEPGLMGPRGLPGSPGNIGPAGKEG---------------------------------PVGLPGIDGRPGPIGPAGARGEPGN---------------------IGFPGPKGPTGDPGKNG---DKGHAGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPPGPPGFQGLPGPSGPAGEVGKPGERGLHGEFGLPGPAGPRGERGPPGESGAAGPTGPIGSRGPSGPPGPDGNKGEPGVVGAVGTAGPSGPSG 638          

HSP 6 Score: 67.3958 bits (163), Expect = 4.939e-10
Identity = 171/452 (37.83%), Postives = 198/452 (43.81%), Query Frame = 1
Query: 5977 GIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNG---------------------PSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDL------------------------GNTGEQGPVGEVGN---AGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGP 7188
            G +G  G+ G PG  G  GA G  G PGKAG DG  G  G PG+                           +G +GP G  G PG  G PG  G  G  G  G +G  G  G  G  G  G  G+ G  G  G+PG  G+ G  G  G  G +G  G  GP GPIG  G PG  G PGP G  G  G     GP GP GE G PG SG  G PGN G  G +G +G  G PG +G  GLPG  G                     P+G+KG  G+KG  G  G  G  G SG +G RG NG+                         G  G  GP G  G    AG+RG NG  G PG+ G  G   + G+ GNIGP   +G+ GP G+ GI G PG IG  G  G  G +G  G  G  G PG  G  G  G  G +G PG  G  G  GP
Sbjct:  110 GFQGPAGEPGEPGQTGPAGARGPAGPPGKAGEDGHPGKPGRPGE---------------------------RGVVGPQGARGFPGTPGLPGFKGIRGHNGLDGLKGQPGAPGVKGEPGAPGENGTPGQTGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGEIGAVGNAGPAGPAGPRGEVGLPGLSGPVGPPGNPGANGLTGAKGAAGLPGVAGAPGLPGPRGIPGPVGAAGATGARGLVGEPGPAGSKGESGNKGEPGSAGPQGPPGPSGEEGKRGPNGEAGSAGPPGPPGLRGSPGSRGLPGADGRAGVMGPPGSRGASGPAGVRGPNGDAGRPGEPGLMGPRGLPGSPGNIGP---AGKEGPVGLPGIDGRPGPIGPAGARGEPGNIGFPGPKGPTGDPGKNGDKGHAGLAGARGAPGPDGNNGAQGP 531          

HSP 7 Score: 64.3142 bits (155), Expect = 4.877e-9
Identity = 86/217 (39.63%), Postives = 102/217 (47.00%), Query Frame = 1
Query: 6640 SGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGI---PGKDGENGKDAVDGAKG------NIGPIGSSGRRGPQGMTGIQGPPGSIGLK---------------GDIGSTGP---------MGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
             G QGP G PG  GQ G  G+ GP+G  G  G  G  GKPG  G+ G  GPQG RG  G  G  G +G  G  G  G++G  GAPG+   PG  GENG     GA+G       +G  G +G RG  G  G  GP G IG                 G +G+ GP         +G  G+ G  G PG  G  G  G KG  GLPG  G PG+ GP+
Sbjct:  109 QGFQGPAGEPGEPGQTGPAGARGPAGPPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGIRGHNGLDGLKGQPGAPGVKGEPGAPGENGTPGQTGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGEIGAVGNAGPAGPAGPRGEVGLPGLSGPVGPPGNPGANGLTGAKGAAGLPGVAGAPGLPGPR 325          

HSP 8 Score: 63.5438 bits (153), Expect = 8.082e-9
Identity = 181/485 (37.32%), Postives = 209/485 (43.09%), Query Frame = 1
Query: 5662 GPTGPTGVPGM------------KGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGI---AGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGP---------RGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGD 7044
            GP G  G+PG+             G  G KG  G  G  G  G+ GPRG  GP G  GA G RG VG PGP G+ G  G +G  G  G QG PG  G  G  G  G  G  G  G  G++GS G  G PG+DG+ G     G PG  G  GP+GV+G  G                        + G  G+ G MGP G PG  GN G  G  G  G PG      I G PGP G  G++G  G IG     G  G PGK+G  G  G+                                     G    PGP G  G +GPPG  G  G  G  GPPG  G QG  GP G +G+ G PG  G  G  G  G  GP G+ G  G++GA+GP GP          G +   GN GE G VG VG AG  G +G PG  G  G  G     G  G  G IG+ GR G +G  G  G PG  G  GD
Sbjct:  278 GPRGEVGLPGLSGPVGPPGNPGANGLTGAKGAAGLPGVAGAPGLPGPRGIPGPVGAAGATGARGLVGEPGPAGSKGESGNKGEPGSAGPQGPPGPSGEEGKRGPNGEAGSAGPPGPPGLRGSPGSRGLPGADGRAGV---MGPPGSRGASGPAGVRGPNG------------------------DAGRPGEPGLMGPRGLPGSPGNIGPAGKEGPVGLPG------IDGRPGPIGPAGARGEPGNIGFPGPKGPTGDPGKNGDKGHAGLA------------------------------------GARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPPGPPGFQGLPGPSGPAGEVGKPGERGLHGEFGLPGPAGPRGERGPPGESGAAGPTGPIGSRGPSGPPGPD---GNKGEPGVVGAVGTAGPSGPSGLPGERGAAGIPGGKGEKGEPGLRGEIGNPGRDGARGAPGAVGAPGPAGATGD 690          

HSP 9 Score: 63.1586 bits (152), Expect = 1.190e-8
Identity = 182/533 (34.15%), Postives = 217/533 (40.71%), Query Frame = 1
Query: 5662 GPT----------------------GPTGV---------------PGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGV---------IGSLGSQGFPGARGPQGILGSPG------------PRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPV------GEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMG 7068
            GP                       GP G+                G +GP G  G+ GQ G  G  G  GP G  G  G  G PGR G  G  GP G  G PG  G+ G                         KG +G  G+ G  GQ G PG  G+ GAPGE+G PG+ G  G  G +G  G  G  G                    GS G +GP+GP+G  G  G PG          IG++G+ G  G  GP+G +G PG              G TG+KG+ G  G+AG PG PG  G  G VG  G  G  G  G                              +PGP G  GE G  G+ G  G  G  GP G+ G +GP G  G++G  G PG  G  G++G  G+ G  G  G  G  GASGP G RG NGD G  GE G +      G  GN G  G  G  G+PG DG  G     GA+G  G IG  G +GP G  G  G  G  GL G  G+ GP G
Sbjct:   64 GPPGPPGLGGNFAAQYDGKGVGLGPGPMGLMGPRGPPGAAGAPGPQGFQGPAGEPGEPGQTGPAGARGPAGPPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPG------------------------FKGIRGHNGLDGLKGQPGAPGVKGEPGAPGENGTPGQTGARGLPGERGRVGAPGPAGA------------------RGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGEIGAVGNAGPAGPAGPRGEVGLPGLSGPVGPPGNPGANGLTGAKGAAGLPGVAGAPGLPGPRGIPGPVGAAGATGARGLVG------------------------------EPGPAGSKGESGNKGEPGSAGPQGPPGPSGEEGKRGPNGEAGSAGPPGPPGLRGSPGSRGLPGADGRAGVMGPPGSRGASGPAGVRGPNGDAGRPGEPGLMGPRGLPGSPGNIGPAGKEGPVGLPGIDGRPGPIGPAGARGEPGNIGFPGPKGPTGDPGKNGDKGHAGLAGARGAPGPDG 524          

HSP 10 Score: 56.9954 bits (136), Expect = 6.997e-7
Identity = 113/299 (37.79%), Postives = 137/299 (45.82%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVP---------------GMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGA------------------------PGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVG 6420
            TG PG  G TGP G                 G++GP   +GD+G  GR G+ G +GP G  G +GP+G                         PG RG  G PG  G  G PG  GI+   G  G  G  G  G PG+ G  GE G  G  G  G  G+DG PG  G+RG PG  G  G AG  GP G  G  GK             G RG  G  G +G  G +GP GPSG  G+RG+ G  G  G +G PG +G  G+ G PG  G  G +G+ G++G AG  G  G  G AG+ G
Sbjct:  784 TGFPGAAGRTGPPGPSGISGPPGPPGPAGKEGLRGP---RGDQGPVGRTGEVGAVGPPGFAGEKGPSGEAGTAGPPGTPGPQGLLGAPGILGLPGSRGERGLPGVAGAVGEPGPLGIA---GPPGARGPPGAVGSPGVNGAPGEAGRDGNPGNDGPPGRDGQPGHKGERGYPGNIGPVGAAGAPGPHGPVGPAGKH------------GNRGETGPSGPVGPAGAVGPRGPSGPQGIRGDKGEPGEKGPRGLPGLKGHNGLQGLPGIAGHHGDQGAPGSVGPAGPRGPAGPSGPAGKDG 1064          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Human
Match: COL2A1 (collagen type II alpha 1 chain [Source:HGNC Symbol;Acc:HGNC:2200])

HSP 1 Score: 152.14 bits (383), Expect = 1.049e-35
Identity = 82/254 (32.28%), Postives = 123/254 (48.43%), Query Frame = 1
Query: 8512 PVRTVRRD-----LLNDDALAVKYLGS-----DVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASDVTEYRS-WFGE-ITGTFKFDY-------QIEASQLMFLKLFSTNARQRITINCSRL-----SVVGNSEHPVILYSDHDEEVLRNGD-LFKYSVIRDGCKNSAEIIDSTELEMDTEAI-RLPIRDIA-LNTGSSKEQQQFGLDIGQVCF 9192
            P++ +R D     L   DA     L S     + ++ P G++  PARTC+ L   +P  + G Y+IDPN G   DA +V C  +  E+C+     +   K+W +S   E +  WFGE I G F F Y            Q+ FL+L ST   Q IT +C           GN +  +++   +D E+   G+  F Y+ ++DGC         T +E  ++   RLPI DIA ++ G    +Q+FG+DIG VCF
Sbjct: 1166 PLQYMRADQAAGGLRQHDAEVDATLKSLNNQIESIRSPEGSRKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETGETCVYPNPANVPKKNWWSSKSKEKKHIWFGETINGGFHFSYGDDNLAPNTANVQMTFLRLLSTEGSQNITYHCKNSIAYLDEAAGNLKKALLIQGSNDVEIRAEGNSRFTYTALKDGCTKHTGKWGKTVIEYRSQKTSRLPIIDIAPMDIGGP--EQEFGVDIGPVCF 1417          

HSP 2 Score: 95.5153 bits (236), Expect = 1.765e-18
Identity = 64/270 (23.70%), Postives = 110/270 (40.74%), Query Frame = -3
Query:  229 EDEDIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCIEPEVVNYKKTSYTKTISS-----WFSVLASLNKQISY-------KIPKEQLVFXXXXXXXXXXXXXXSCDQIALVSDDSITQDIRYN--NSVQLF----GDDNQILTVNNEDDL---------FQYKVVEDTC-KDKSNNGRAVIKVEXXXXXXXXXXXLNFKSIENSRPAMI--------------GIEIGPVCF 912
             D ++   L  L++ ++++  P GS+  PAR+C D++  +    +G ++IDPN G   DA+ V CN +  ETC+ P   N  K ++  + S      WF    +     SY            Q+ F                  + L+S +  +Q+I Y+  NS+       G+  + L +   +D+         F Y  ++D C K     G+ VI+               ++S + SR  +I              G++IGPVCF
Sbjct: 1182 HDAEVDATLKSLNNQIESIRSPEGSRKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETGETCVYPNPANVPKKNWWSSKSKEKKHIWFGETINGGFHFSYGDDNLAPNTANVQMTF------------------LRLLSTEG-SQNITYHCKNSIAYLDEAAGNLKKALLIQGSNDVEIRAEGNSRFTYTALKDGCTKHTGKWGKTVIE---------------YRSQKTSRLPIIDIAPMDIGGPEQEFGVDIGPVCF 1417          

HSP 3 Score: 94.7449 bits (234), Expect = 2.536e-18
Identity = 232/584 (39.73%), Postives = 267/584 (45.72%), Query Frame = 1
Query: 5752 GILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXX---------------XXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQG---------------------------ILGSPGPRGRTGSKGSQGTIGIAGVPGT---PGKDGKAGQVGIXXXXXXXXXXXXXXX------XXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSG---------------------------QRGLPGSNGPSGTKGNKGSKGPYGKPG------------------IAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGI---------QGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGP 7188
            G  GP G  GP+G  G  G  GT GSPGP G +G+PG  GI G  G+ G PG+ G PG PG RGP G +G+ G LG KG  G+ G  G  G++G  GE G  G  G  GP+G +G  G  G PG  G  GP G RG                +G  GE G  G  GP G +G PG  G PG+ G+ G  G PG  GPQG                           ++G PGP+G  G  G  G  G+ G PG    PGKDG+ G  G PG  GP G  G  G        GLPG PG  G+ G  G  G PG+   PG  GP GERG PG+ G  G           GLQGP G PG  G                           +RG  G  GP G +G+ G KGP G PG                    G+ G  GP GP G  G  G  GE+G  G  G AG  G  GA G PG  GE G+    G  G  GP G SG  GPQG TG+         QGPPG+ G  G  G  GP G  G PG PG PG  G  GP+G +GD G PG  G PG+ GP
Sbjct:  306 GEAGPTGARGPEGAQGPRGEPGTPGSPGPAGASGNPGTDGIPGAKGSAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGQTGEPGIAGFKGEQGPKGEPGPAGPQGAPGPAGEEGKRGARGEPGGVGPIGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLAGPKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMGFPGPKGANGEPGKAGEKGLPGAPGLRGLPGKDGETGAAGPPGPAGPAGERGEQGAPGPSGFQGLPGPPGPPGEGGKPGDQGVPGEAGAPGLVGPRGERGFPGERGSPGA---------QGLQGPRGLPGTPGTDGPKGASGPAGPPGAQGPPGLQGMPGERGAAGIAGPKGDRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPAGSAGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGEQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARGDSGPPGRAGEPGLQGP 880          

HSP 4 Score: 88.5817 bits (218), Expect = 1.800e-16
Identity = 214/604 (35.43%), Postives = 260/604 (43.05%), Query Frame = 1
Query: 5641 TGEPGING------------PTGPTGVPGMKGPLGVKGDK------------------GQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGP------------------SGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAG------------VPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNG------------PSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGK---------------DGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            TGEPGI G            P GP G PG  G  G +G +                  G RG  G+DG+ GP+G  G +GP+G  G +G  G PG  G  G PG +G++GRPG+ G  G  GP G PG  G  G  G QG  G  G +G   +PG  G  G PG+ G+ G  G  G  G+ G  G+TG  G  G  GP G         E G +G  GP G                    G PG  G PG++G  G +GFPG RG  G  G  GPRG  G+ G+ G  G +G            + G PG+ G AG  G  G                                   G   + GP+G  G+ G  G +G  G PG  G  G+ G  GP GP G++G RG PG  G            P G  G  G+KG  G+ G  GD GA GPQGP G  G  G TG  GP G  G  G  G  G PG  G+                G +GKD   GA+G+ GP G +G        G+QGP G  G KG+ G  GP G  G PG  G  G  G  G  G +G++G PG PG  G  G Q
Sbjct:  386 TGEPGIAGFKGEQGPKGEPGPAGPQGAPGPAGEEGKRGARGEPGGVGPIGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLAGPKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMG---FPGPKGANGEPGKAGEKGLPGAPGLRGLPGKDGETGAAGPPGPAGPAG---------ERGEQGAPGPSGFQGLPGPPGPPGEGGKPGDQGVPGEAGAPGLVGPRGERGFPGERGSPGAQGLQGPRGLPGTPGTDGPKGASGPAGPPGAQGPPGLQGMPGERGAAGIAGPKGDR---------------------------------GDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPAGSAGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGEQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARGDSGPPGRAGE------PGLQGPAGPPGEKGEPGDDGPSGAEGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQ 938          

HSP 5 Score: 79.337 bits (194), Expect = 1.159e-13
Identity = 173/529 (32.70%), Postives = 202/529 (38.19%), Query Frame = 1
Query: 5671 GPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRG---NLGPQGPTGA------------------PGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGD---PGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIG---PMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRT---------------------GSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGP------------------YGKPGIAGDNGASGPQG---------------------------------PRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIG 6960
            G  G PG+ GP G +G  G+RG  G  G+ GPRG     G  GP GA                  PG RG  G  GP G+ G  G +G  G           G  G  GL GP G  G  G  G KG +G  G  GS G RGAPGE G+   PG AG  GP G  G PG  G  G                  E G KGD G   P GPSG+PG +G  GV G  G++G   A+GP G  G PG  GR                      G KG++G  G  G  G PG  G AG                                        PG+  +PG  GP G  GPPG  G             +G +G +G PG  G+RG PG  GPSG  G +G+ G                    G+PG  G  GA GP G                                 P G+ GD G  G QGP+G  G AG RG+ G  G  G  GE G+    G KG+ G
Sbjct:  618 GEAGAPGLVGPRGERGFPGERGSPGAQGLQGPRGLPGTPGTDGPKGASGPAGPPGAQGPPGLQGMPGERGAAGIAGPKGDRGDVGEKGPEG---------APGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPAGSAGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGEQG------------------EAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARG---AQGPPGATGFPGAAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARGDSGPPGRAGEPGLQGPAG---------------------------------------PPGEKGEPGDDGPSGAEGPPGPQGL------------AGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPPGPVGPPGLTGPAGEPGREGSPGADGPPGRDGAAGVKGDRGETGAVGAPGAPGPPGSPGPAGPTGKQGDRGEAGAQGPMGPSGPAGARGIQGPQGPRGDKGEAGEPGERGLKGHRG 1065          

HSP 6 Score: 72.7886 bits (177), Expect = 1.303e-11
Identity = 209/564 (37.06%), Postives = 243/564 (43.09%), Query Frame = 1
Query: 5662 GPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGIL------------GPRGNLGPQGPT---------------------GAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAP---------------GEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXEL---GSKGDIGPMGPSGSPGLRGNPGVIGSL------------GSQGFPGAR---------------GPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGP------------------YGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQ---GPPGSIGLKGDIGST 7056
            GP G  G PG  G  G+ G  G RG  GKDG              G RG  G  GP+                     G PG  G  G  GP G  G PG +G                              S G  G++G  G  G PG+DG +GA                G  G+ G AGI GP G +GD G+ G  G  G+ G RG  G  G  G     G KG++GP GP+GS G RG PG  G              G+ G PGA+               GPQG  G+PGP+G TG  G +G  G  G PG  G  G AG+VG PG NG PG PGP GP G  G  G  G  GP G  G PG     GP GP GE+G PG  G  G  G  GP G +G +G +G PG  G+RG PG  GPSG  G +G+ G                    G+PG  G  GA GP G  G  G  G+ GE G VG  G  G  G  G  G  GK G+ G+    G  G  GP G+ G +GPQG  G +   G PG  GLKG  G T
Sbjct:  537 GPKGANGEPGKAGEKGLPGAPGLRGLPGKDGETGAAGPPGPAGPAGERGEQGAPGPSGFQGLPGPPGPPGEGGKPGDQGVPGEAGAPGLVGPRGERGFPGERG------------------------------SPGAQGLQGPRGLPGTPGTDGPKGASGPAGPPGAQGPPGLQGMPGERGAAGIAGPKGDRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPAGSAGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGEQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARGDSGPPGRAGEPGLQ---GPAGPPGEKGEPGDDGPSGAEGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPPGPVGPPGLTGPAGEPGREGSPGADGPPGRDGAAGVKGDRGETGAVGAPGAPGPPGSPGPAGPTGKQGDRGEAGAQGPMGPSGPAGARGIQGPQGPRGDKGEAGEPGERGLKGHRGFT 1067          

HSP 7 Score: 67.3958 bits (163), Expect = 5.291e-10
Identity = 190/550 (34.55%), Postives = 223/550 (40.55%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGG------------LGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXX------------XXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVI------------GSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNG---------------------PSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGV---------NGAPGIPGKDGENGKDAVDGAK------------GNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGST 7056
            TG PG  GP G  G  G  G  G  G  G +G  G+ G++   G  GP+G  G PG+ G  G PG  G  G PG  G +G  G  G  G  G  G  G  GP G +G  G              G+ G  G  G  G  G+RG PGE G PG  G+ GP G+ G PG  G  G SG  GP G             RG  GI G  G +GD+G  GP G+PG  G  G+             G  G  G PG  G  G  G+PG RG TG  G  G  G  G  G PG  G+ G+ G                                      G    PGPQGP G  GP G +G  G           G +G  GPPG +   G PG+ G                       G KG +G  GP G+ G  G  G +GP G +GE GD G +G +GP G  G AG RG+          G PG+PG  GE GK    GA             G  GP G  GR G  G  G  G  G+ G+KGD G T
Sbjct:  494 TGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVM---GFPGPKGANGEPGKAGEKGLPGAPGLRGLPGKDGETGAAGPPGPAGPAGERGEQGAPGPSGFQGLPGPPGPPGEGGKPGDQGVPGEAGAPGLVGPRGERGFPGERGSPGAQGLQGPRGLPGTPGTDGPKGASGPAGPPGAQGPPGLQGMPGERGAAGIAGPKGDRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPAGSAGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGEQGEAGQK------------------------------------GDAGAPGPQGPSGAPGPQGPTGVTGP---------KGARGAQGPPGAT---GFPGAAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARGDSGPPGRAGEPGLQGPAGPPGEKGEPGDDGPSGAEGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPPGPVGPPGLTGPAGEPGREGSPGADGPPGRDGAAGVKGDRGET 992          

HSP 8 Score: 60.077 bits (144), Expect = 9.680e-8
Identity = 195/545 (35.78%), Postives = 235/545 (43.12%), Query Frame = 1
Query: 5677 TGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNL------GPQGPTGAPGRRGTV------GSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAG------DNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAP---GIPGKDGENGKDAVDGAKGNIGPIGSSGRRGP---------------------QGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIG 7185
             G PG  G  G  G +G RG  G  G+ G +G+       G +G  GAPG +G        GSPGP+G  G PG +G +G  G  G  G  G PG  G  GP G  G  G  G  G+ G+ G  G+ G  GA G  G+PG  G  GP+G  G+PG  G PG  G  G  G  G  G  G  G  G  G  GP G  G  G PG+ G  G QG  G  GP G  G+PGP G  G +G++G  G  G  G PG+ G  G  G                                     PG++   GP+G  GERGP                  SGL GP G  G+ G+ G PG  G  G  G  G  GP GK G +G        G  GPQG RG+ G +G  G +G  GE G AG +G+ GAP   G+PGKDGE G     G  G  G  G  G  GP                     QG+ G  G PG +G +G+ G  G  G                PG +G +G +GLPG PGT G  G
Sbjct:  188 AGKPGKAGERGPPGPQGARGFPGTPGLPGVKGHRGYPGLDGAKGEAGAPGVKGESGSPGENGSPGPMGPRGLPGERGRTGPAGAAGARGNDGQPGPAGPPGPVGPAGGPGFPGAPGAKGEAGPTGARGPEGAQGPRGEPGTPGSPGPAGASGNPGTDGIPGAKGSAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGQTGEPGIAGFKGEQGPKGEPGPAGPQGAPGPAGEEGKRGARGEPGGVGPIGPPGERGAPGNRGF------------------------------------PGQDGLAGPKGAPGERGP------------------SGLAGPKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMGFPGPKGANGEPGKAGEKGLPGAPGLRGLPGKDGETGAAGPPGPAGPAGERGEQGAPGPSGFQGLPGPPGPPGEGGKPGDQGVPGEAGAPGLVGPRGERGFPGERG---------------SPGAQGLQGPRGLPGTPGTDGPKG 663          

HSP 9 Score: 53.5286 bits (127), Expect = 8.580e-6
Identity = 230/621 (37.04%), Postives = 263/621 (42.35%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGP---------------------------------------------TGAPGRR---GTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNS------------------GQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGE------------------QGPVGEVGNAGIR---------GVNGAPGIPGKDGENG---------KDAVDGAKGNI---GPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            G PG++G  G  G PG+KG  G  G+ G  G MG  G+ G RG  GP G                                               GA G R   GT GSPGP G +G+PG  GI G  G+ G PG+ G PG PG RGP G +G+ G LG KG  G+ G  G  G++G  GE G  G  G  GP+G +G  G  G PG  G  GP G                       G+PG RG PG  G  G +G PG RGP G+ G  G  G  G  G  G  G  G+ G PG  G  G+VG  G  G  GRPGP GP G  G PG  G PGP G  G PGK  + G  G  G RG PGK G+ G  G  GP G +G +G  G PG S                  G +G+PG  G  G  G +G +   G PG  G  GA G QGPRG  G  G  G                   QG  GE G AGI          G  G  G PGKDG  G             +G KG +   GP GS+G RG  G  G  GPPG  G  G  G+ G  G              G  G  G KGD G PG  G  G  GPQ
Sbjct:  222 GYPGLDGAKGEAGAPGVKGESGSPGENGSPGPMGPRGLPGERGRTGPAGAAGARGNDGQPGPAGPPGPVGPAGGPGFPGAPGAKGEAGPTGARGPEGAQGPRGEPGTPGSPGPAGASGNPGTDGIPGAKGSAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGQTGEPGIAGFKGEQGPKGEPGPAGPQGAPGPAGEEGKRGARGEPGGVGPIGPPGE---------------------RGAPGNRGFPGQDGLAGPKGAPGERGPSGLAGPKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMGFPGPKGANGEPGKAGEKGLPGAPGLRGLPGKDGETGAAGPPGPAGPAGERGEQGAPGPSGFQGLPGPPGPPGEGGKPGDQGVPGEAGAPGLVGPRGER---GFPGERGSPGAQGLQGPRGLPGTPGTDGPKGASGPAGPPGAQGPPGLQGMPGERGAAGIAGPKGDRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPAGSAGARGAPGERGETGPPGPAGFAGPPGADGQPG------------AKGEQGEAGQKGDAGAPGPQGPSGAPGPQ 806          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Human
Match: COL2A1 (collagen type II alpha 1 chain [Source:HGNC Symbol;Acc:HGNC:2200])

HSP 1 Score: 149.058 bits (375), Expect = 7.698e-35
Identity = 82/254 (32.28%), Postives = 123/254 (48.43%), Query Frame = 1
Query: 8512 PVRTVRRD-----LLNDDALAVKYLGS-----DVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASDVTEYRS-WFGE-ITGTFKFDY-------QIEASQLMFLKLFSTNARQRITINCSRL-----SVVGNSEHPVILYSDHDEEVLRNGD-LFKYSVIRDGCKNSAEIIDSTELEMDTEAI-RLPIRDIA-LNTGSSKEQQQFGLDIGQVCF 9192
            P++ +R D     L   DA     L S     + ++ P G++  PARTC+ L   +P  + G Y+IDPN G   DA +V C  +  E+C+     +   K+W +S   E +  WFGE I G F F Y            Q+ FL+L ST   Q IT +C           GN +  +++   +D E+   G+  F Y+ ++DGC         T +E  ++   RLPI DIA ++ G    +Q+FG+DIG VCF
Sbjct: 1235 PLQYMRADQAAGGLRQHDAEVDATLKSLNNQIESIRSPEGSRKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETGETCVYPNPANVPKKNWWSSKSKEKKHIWFGETINGGFHFSYGDDNLAPNTANVQMTFLRLLSTEGSQNITYHCKNSIAYLDEAAGNLKKALLIQGSNDVEIRAEGNSRFTYTALKDGCTKHTGKWGKTVIEYRSQKTSRLPIIDIAPMDIGGP--EQEFGVDIGPVCF 1486          

HSP 2 Score: 97.4413 bits (241), Expect = 3.726e-19
Identity = 232/584 (39.73%), Postives = 267/584 (45.72%), Query Frame = 1
Query: 5752 GILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXX---------------XXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQG---------------------------ILGSPGPRGRTGSKGSQGTIGIAGVPGT---PGKDGKAGQVGIXXXXXXXXXXXXXXX------XXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSG---------------------------QRGLPGSNGPSGTKGNKGSKGPYGKPG------------------IAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGI---------QGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGP 7188
            G  GP G  GP+G  G  G  GT GSPGP G +G+PG  GI G  G+ G PG+ G PG PG RGP G +G+ G LG KG  G+ G  G  G++G  GE G  G  G  GP+G +G  G  G PG  G  GP G RG                +G  GE G  G  GP G +G PG  G PG+ G+ G  G PG  GPQG                           ++G PGP+G  G  G  G  G+ G PG    PGKDG+ G  G PG  GP G  G  G        GLPG PG  G+ G  G  G PG+   PG  GP GERG PG+ G  G           GLQGP G PG  G                           +RG  G  GP G +G+ G KGP G PG                    G+ G  GP GP G  G  G  GE+G  G  G AG  G  GA G PG  GE G+    G  G  GP G SG  GPQG TG+         QGPPG+ G  G  G  GP G  G PG PG PG  G  GP+G +GD G PG  G PG+ GP
Sbjct:  375 GEAGPTGARGPEGAQGPRGEPGTPGSPGPAGASGNPGTDGIPGAKGSAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGQTGEPGIAGFKGEQGPKGEPGPAGPQGAPGPAGEEGKRGARGEPGGVGPIGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLAGPKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMGFPGPKGANGEPGKAGEKGLPGAPGLRGLPGKDGETGAAGPPGPAGPAGERGEQGAPGPSGFQGLPGPPGPPGEGGKPGDQGVPGEAGAPGLVGPRGERGFPGERGSPGA---------QGLQGPRGLPGTPGTDGPKGASGPAGPPGAQGPPGLQGMPGERGAAGIAGPKGDRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPAGSAGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGEQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARGDSGPPGRAGEPGLQGP 949          

HSP 3 Score: 93.2041 bits (230), Expect = 7.987e-18
Identity = 64/270 (23.70%), Postives = 110/270 (40.74%), Query Frame = -3
Query:  229 EDEDIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCIEPEVVNYKKTSYTKTISS-----WFSVLASLNKQISY-------KIPKEQLVFXXXXXXXXXXXXXXSCDQIALVSDDSITQDIRYN--NSVQLF----GDDNQILTVNNEDDL---------FQYKVVEDTC-KDKSNNGRAVIKVEXXXXXXXXXXXLNFKSIENSRPAMI--------------GIEIGPVCF 912
             D ++   L  L++ ++++  P GS+  PAR+C D++  +    +G ++IDPN G   DA+ V CN +  ETC+ P   N  K ++  + S      WF    +     SY            Q+ F                  + L+S +  +Q+I Y+  NS+       G+  + L +   +D+         F Y  ++D C K     G+ VI+               ++S + SR  +I              G++IGPVCF
Sbjct: 1251 HDAEVDATLKSLNNQIESIRSPEGSRKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETGETCVYPNPANVPKKNWWSSKSKEKKHIWFGETINGGFHFSYGDDNLAPNTANVQMTF------------------LRLLSTEG-SQNITYHCKNSIAYLDEAAGNLKKALLIQGSNDVEIRAEGNSRFTYTALKDGCTKHTGKWGKTVIE---------------YRSQKTSRLPIIDIAPMDIGGPEQEFGVDIGPVCF 1486          

HSP 4 Score: 91.2781 bits (225), Expect = 2.921e-17
Identity = 214/604 (35.43%), Postives = 260/604 (43.05%), Query Frame = 1
Query: 5641 TGEPGING------------PTGPTGVPGMKGPLGVKGDK------------------GQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGP------------------SGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAG------------VPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNG------------PSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGK---------------DGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            TGEPGI G            P GP G PG  G  G +G +                  G RG  G+DG+ GP+G  G +GP+G  G +G  G PG  G  G PG +G++GRPG+ G  G  GP G PG  G  G  G QG  G  G +G   +PG  G  G PG+ G+ G  G  G  G+ G  G+TG  G  G  GP G         E G +G  GP G                    G PG  G PG++G  G +GFPG RG  G  G  GPRG  G+ G+ G  G +G            + G PG+ G AG  G  G                                   G   + GP+G  G+ G  G +G  G PG  G  G+ G  GP GP G++G RG PG  G            P G  G  G+KG  G+ G  GD GA GPQGP G  G  G TG  GP G  G  G  G  G PG  G+                G +GKD   GA+G+ GP G +G        G+QGP G  G KG+ G  GP G  G PG  G  G  G  G  G +G++G PG PG  G  G Q
Sbjct:  455 TGEPGIAGFKGEQGPKGEPGPAGPQGAPGPAGEEGKRGARGEPGGVGPIGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLAGPKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMG---FPGPKGANGEPGKAGEKGLPGAPGLRGLPGKDGETGAAGPPGPAGPAG---------ERGEQGAPGPSGFQGLPGPPGPPGEGGKPGDQGVPGEAGAPGLVGPRGERGFPGERGSPGAQGLQGPRGLPGTPGTDGPKGASGPAGPPGAQGPPGLQGMPGERGAAGIAGPKGDR---------------------------------GDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPAGSAGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGEQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARGDSGPPGRAGE------PGLQGPAGPPGEKGEPGDDGPSGAEGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQ 1007          

HSP 5 Score: 75.8702 bits (185), Expect = 1.305e-12
Identity = 196/517 (37.91%), Postives = 222/517 (42.94%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGP---------TGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGD---PGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIG---PMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRT---------------------GSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSG------LQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQ---GPPGSIGLKGDIGST 7056
             G PG+ GP G  G PG +G  G +G +G RG  G  G  GP+G  GP GP          G PG RG  G  GP G+ G  G +G  G PG  G  G+ GP G PG  G           G KG +G  G  GS G RGAPGE G+   PG AG  GP G  G PG  G  G                  E G KGD G   P GPSG+PG +G  GV G  G++G   A+GP G  G PG  GR                      G KG++G  G  G  G PG  G AG                                        PG+  +PG  GP G  GPPG  G  G  G VG PGQ G      L GP G PG  G  G  G  GP G  G  G  GP G+PG  G  GA GP G  G  G  G+ GE G VG  G  G  G  G  G  GK G+ G+    G  G  GP G+ G +GPQG  G +   G PG  GLKG  G T
Sbjct:  689 AGAPGLVGPRGERGFPGERGSPGAQGLQGPRGLPGTPGTDGPKGASGPAGPPGAQGPPGLQGMPGERGAAGIAGPKGDRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGAN---------GEKGEVGPPGPAGSAGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGEQG------------------EAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARG---AQGPPGATGFPGAAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARGDSGPPGRAGEPGLQGPAG---------------------------------------PPGEKGEPGDDGPSGAEGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPPGPVGPPGLTGPAGEPGREGSPGADGPPGRDGAAGVKGDRGETGAVGAPGAPGPPGSPGPAGPTGKQGDRGEAGAQGPMGPSGPAGARGIQGPQGPRGDKGEAGEPGERGLKGHRGFT 1136          

HSP 6 Score: 75.8702 bits (185), Expect = 1.694e-12
Identity = 182/499 (36.47%), Postives = 213/499 (42.69%), Query Frame = 1
Query: 5671 GPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRG---NLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAP------------GEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGS---LGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGP------------------YGKPGIAGDNGASGPQG---------------------------------PRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIG 6960
            G  G PG+ GP G +G  G+RG  G  G+ GPRG     G  GP GA G  G  G+ GP G  G PG +G +G                          G +G  G  G  G +G PG DG RG              GE G+ G  G  G +G +G PG                        E G  G  GP G +G PG  G PG  G     G +G  GA GPQG  G+PGP+G TG  G +G  G  G PG  G  G AG+VG PG NG PG PGP GP G  G  G  G  GP G  G PG     GP GP GE+G PG  G  G  G  GP G +G +G +G PG  G+RG PG  GPSG  G +G+ G                    G+PG  G  GA GP G                                 P G+ GD G  G QGP+G  G AG RG+ G  G  G  GE G+    G KG+ G
Sbjct:  687 GEAGAPGLVGPRGERGFPGERGSPGAQGLQGPRGLPGTPGTDGPKGASGPAGPPGAQGPPGLQGMPGERGAAG------------------------IAGPKGDRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPAGSAGARGAPG------------------------ERGETGPPGPAGFAGPPGADGQPGAKGEQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARGDSGPPGRAGEPGLQ---GPAGPPGEKGEPGDDGPSGAEGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPPGPVGPPGLTGPAGEPGREGSPGADGPPGRDGAAGVKGDRGETGAVGAPGAPGPPGSPGPAGPTGKQGDRGEAGAQGPMGPSGPAGARGIQGPQGPRGDKGEAGEPGERGLKGHRG 1134          

HSP 7 Score: 69.3218 bits (168), Expect = 1.291e-10
Identity = 195/550 (35.45%), Postives = 227/550 (41.27%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGIS------------GRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXX------------XXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVI------------GSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNG---------------------PSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGV---------NGAPGIPGKDGENGKDAVDGAK------------GNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGST 7056
            TG PG  GP G  G  G  G  G  G  G +G  G+ G++   G  GP+G  G PG+ G  G PG  G  G PG  G +            G  G QG PG  G  GLPG  GP GE G  G  G+ G  G  G  G  G+RG PGE G PG  G+ GP G+ G PG  G  G SG  GP G             RG  GI G  G +GD+G  GP G+PG  G  G+             G  G  G PG  G  G  G+PG RG TG  G  G  G  G  G PG  G+ G+ G                                      G    PGPQGP G  GP G +G  G           G +G  GPPG +   G PG+ G                       G KG +G  GP G+ G  G  G +GP G +GE GD G +G +GP G  G AG RG+          G PG+PG  GE GK    GA             G  GP G  GR G  G  G  G  G+ G+KGD G T
Sbjct:  563 TGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVM---GFPGPKGANGEPGKAGEKGLPGAPGLRGLPGKDGETGAAGPPGPAGPAGERGEQGAPGPSGFQGLPGPPGPPGEGGKPGDQGVPGEAGAPGLVGPRGERGFPGERGSPGAQGLQGPRGLPGTPGTDGPKGASGPAGPPGAQGPPGLQGMPGERGAAGIAGPKGDRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPAGSAGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGEQGEAGQK------------------------------------GDAGAPGPQGPSGAPGPQGPTGVTGP---------KGARGAQGPPGAT---GFPGAAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARGDSGPPGRAGEPGLQGPAGPPGEKGEPGDDGPSGAEGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPPGPVGPPGLTGPAGEPGREGSPGADGPPGRDGAAGVKGDRGET 1061          

HSP 8 Score: 62.7734 bits (151), Expect = 1.562e-8
Identity = 195/545 (35.78%), Postives = 235/545 (43.12%), Query Frame = 1
Query: 5677 TGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNL------GPQGPTGAPGRRGTV------GSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAG------DNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAP---GIPGKDGENGKDAVDGAKGNIGPIGSSGRRGP---------------------QGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIG 7185
             G PG  G  G  G +G RG  G  G+ G +G+       G +G  GAPG +G        GSPGP+G  G PG +G +G  G  G  G  G PG  G  GP G  G  G  G  G+ G+ G  G+ G  GA G  G+PG  G  GP+G  G+PG  G PG  G  G  G  G  G  G  G  G  G  GP G  G  G PG+ G  G QG  G  GP G  G+PGP G  G +G++G  G  G  G PG+ G  G  G                                     PG++   GP+G  GERGP                  SGL GP G  G+ G+ G PG  G  G  G  G  GP GK G +G        G  GPQG RG+ G +G  G +G  GE G AG +G+ GAP   G+PGKDGE G     G  G  G  G  G  GP                     QG+ G  G PG +G +G+ G  G  G                PG +G +G +GLPG PGT G  G
Sbjct:  257 AGKPGKAGERGPPGPQGARGFPGTPGLPGVKGHRGYPGLDGAKGEAGAPGVKGESGSPGENGSPGPMGPRGLPGERGRTGPAGAAGARGNDGQPGPAGPPGPVGPAGGPGFPGAPGAKGEAGPTGARGPEGAQGPRGEPGTPGSPGPAGASGNPGTDGIPGAKGSAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGQTGEPGIAGFKGEQGPKGEPGPAGPQGAPGPAGEEGKRGARGEPGGVGPIGPPGERGAPGNRGF------------------------------------PGQDGLAGPKGAPGERGP------------------SGLAGPKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMGFPGPKGANGEPGKAGEKGLPGAPGLRGLPGKDGETGAAGPPGPAGPAGERGEQGAPGPSGFQGLPGPPGPPGEGGKPGDQGVPGEAGAPGLVGPRGERGFPGERG---------------SPGAQGLQGPRGLPGTPGTDGPKG 732          

HSP 9 Score: 56.6102 bits (135), Expect = 1.140e-6
Identity = 225/618 (36.41%), Postives = 263/618 (42.56%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGP---------------------------------------------TGAPGRR---GTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNS------------------------GQRGLPGSNGPSGTK---------GNKGSKGPYGKPGIAGDNGASGPQ------------------GPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNI---GPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            G PG++G  G  G PG+KG  G  G+ G  G MG  G+ G RG  GP G                                               GA G R   GT GSPGP G +G+PG  GI G  G+ G PG+ G PG PG RGP G +G+ G LG KG  G+ G  G  G++G  GE G  G  G  GP+G +G  G  G PG  G  GP G                       G+PG RG PG  G  G +G PG RGP G+ G  G  G  G  G  G  G  G+ G PG  G  G+VG  G  G  GRPGP GP G  G PG  G PGP G  G PGK  + G  G  G RG PGK G+ G  G  GP G +G +G  G PG S                        G+ G PG  GP G +         G +G +GP G PG  G +G  G                    G RG  G  G  G++G VGE G  G  G +G  G+ G  G  G    +G KG +   GP GS+G RG  G  G  GPPG  G  G  G+ G  G              G  G  G KGD G PG  G  G  GPQ
Sbjct:  291 GYPGLDGAKGEAGAPGVKGESGSPGENGSPGPMGPRGLPGERGRTGPAGAAGARGNDGQPGPAGPPGPVGPAGGPGFPGAPGAKGEAGPTGARGPEGAQGPRGEPGTPGSPGPAGASGNPGTDGIPGAKGSAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGQTGEPGIAGFKGEQGPKGEPGPAGPQGAPGPAGEEGKRGARGEPGGVGPIGPPGE---------------------RGAPGNRGFPGQDGLAGPKGAPGERGPSGLAGPKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMGFPGPKGANGEPGKAGEKGLPGAPGLRGLPGKDGETGAAGPPGPAGPAGERGEQGAPGPSGFQGLPGPPGPPGEGGKPGDQGVPGEAGAPGLVGPRGERGFPGERGSPGAQGLQGPRGLPGTPGTDGPKGASGPAGPPGAQGPPGLQGMPGERGAAGIAGPKGDRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPAGSAGARGAPGERGETGPPGPAGFAGPPGADGQPG------------AKGEQGEAGQKGDAGAPGPQGPSGAPGPQ 875          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Human
Match: COL3A1 (collagen type III alpha 1 chain [Source:HGNC Symbol;Acc:HGNC:2201])

HSP 1 Score: 140.969 bits (354), Expect = 2.119e-32
Identity = 75/222 (33.78%), Postives = 109/222 (49.10%), Query Frame = 1
Query: 8578 DVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASDVTEYRS-WFGE-ITGTFKFDY-------QIEASQLMFLKLFSTNARQRITINCSRL-----SVVGNSEHPVILYSDHDEEVLRNGD-LFKYSVIRDGCKNSAEIIDSTELEMDT-EAIRLPIRDIA-LNTGSSKEQQQFGLDIGQVCF 9192
            + +  P G++  PAR C+ L   +P L+ G Y++DPN G   DA +V C  +  E+CI +   +   KHW      E +  WFGE + G F+F Y        +    L FL+L S+ A Q IT +C           GN +  + L   ++ E    G+  F Y+V+ DGC         T  E  T +A+RLPI DIA  + G     Q+FG+D+G VCF
Sbjct: 1246 ESLISPDGSRKNPARNCRDLKFCHPELKSGEYWVDPNQGCKLDAIKVFCNMETGETCISANPLNVPRKHWWTDSSAEKKHVWFGESMDGGFQFSYGNPELPEDVLDVHLAFLRLLSSRASQNITYHCKNSIAYMDQASGNVKKALKLMGSNEGEFKAEGNSKFTYTVLEDGCTKHTGEWSKTVFEYRTRKAVRLPIVDIAPYDIGGP--DQEFGVDVGPVCF 1465          

HSP 2 Score: 90.5077 bits (223), Expect = 5.464e-17
Identity = 66/260 (25.38%), Postives = 122/260 (46.92%), Query Frame = -3
Query:  229 FQNDQPKTEKISSIDPNDEDEDIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCIEPEVVNYKKTSYTKTISS-----WFSVLASLNKQISY---KIPKE----QLVFXXXXXXXXXXXXXXSC-DQIALVSDDSITQDIRYNNSVQLFGDDNQILTVNNEDDLFQYKVVEDTCKDKSNNGRAVIKVEXXXXXXXXXXXLNFKSIENSRPAM-IGIEIGPVCF 966
            +  D+P   KI++       ++I  +L  ++  +++L  P GS+  PAR+C D++  +    +G +++DPN G   DAI V CN +  ETCI    +N  +  +    S+     WF        Q SY   ++P++     L FL+L S  +SQ +T  C + IA +  D  + +++   +++L G +         +  F Y V+ED C   +      +  E    + + +  ++    +   P    G+++GPVCF
Sbjct: 1219 YYGDEPMDFKINT-------DEIMTSLKSVNGQIESLISPDGSRKNPARNCRDLKFCHPELKSGEYWVDPNQGCKLDAIKVFCNMETGETCISANPLNVPRKHWWTDSSAEKKHVWFGESMDGGFQFSYGNPELPEDVLDVHLAFLRLLSSRASQNITYHCKNSIAYM--DQASGNVK--KALKLMGSNEGEFKAEG-NSKFTYTVLEDGCTKHTGEWSKTV-FEYRTRKAVRLPIVDIAPYDIGGPDQEFGVDVGPVCF 1465          

HSP 3 Score: 77.0258 bits (188), Expect = 7.521e-13
Identity = 141/355 (39.72%), Postives = 165/355 (46.48%), Query Frame = 1
Query: 6013 GSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIG---PMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMG 7068
            G  G+ G PGE G PG  GI GP+G+ G PG  G+ G  GR G +G  G  G+ GE G  G+ G   PMGP G+PG RG PG+ G+ G++G  GARG  G  G PGP G  G  GS G  G  G  G+PG +G                                           PG+  +PGPQG                         +G QGP GPPG +G  G  G  GP+G  G  G  G  G PG AG NGA G +G  GE G  G  GE GP GE G AGI GV GA G  GKDG  G+   +G  G  G  G+ G RGP G  GI G  G  G +G  G  GP G
Sbjct:  231 GESGRPGRPGERGLPGPPGIKGPAGIPGFPGMKGHRGFDGRNGEKGETGAPGLKGENGLPGENGAPGPMGPRGAPGERGRPGLPGAAGARGNDGARGSDGQPGPPGPPGTAGFPGSPGAKGEVGPAGSPGSNG------------------------------------------APGQRGEPGPQG------------------------HAGAQGPPGPPGINGSPGGKGEMGPAGIPGAPGLMGARGPPGPAGANGAPGLRGGAGEPGKNGAKGEPGPRGERGEAGIPGVPGAKGEDGKDGSPGEPGANGLPGAAGERGAPGFRGPAGPNGIPGEKGPAGERGAPGPAGPRG 519          

HSP 4 Score: 69.707 bits (169), Expect = 1.244e-10
Identity = 136/381 (35.70%), Postives = 163/381 (42.78%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGA 6783
            +G PG  G  G  G PG+KGP G+ G  G +G  G DG  G +G  G  G  G  G  G  G+PGP+G  G PG +G  G PG  G  G  G  G  G  GP G  G+ G  G  G+ G+ G  GS G  GAPG+ G+PG  G                       G +GP G  GI G  G KG++GP G  G+PGL G  G  G  G+ G PG RG  G  G  G +G  G +G +G  GI GVPG  G+DGK G  G                                     PG N  P   G  GERG P                  G +GP GP       G+PG  GP+G +G  G  GP G  G  G +G 
Sbjct:  233 SGRPGRPGERGLPGPPGIKGPAGIPGFPGMKGHRGFDGRNGEKGETGAPGLKGENGLPGENGAPGPMGPRGAPGERGRPGLPGAAGARGNDGARGSDGQPGPPGPPGTAGFPGSPGAKGEVGPAGSPGSNGAPGQRGEPGPQG---------------------HAGAQGPPGPPGINGSPGGKGEMGPAGIPGAPGLMGARGPPGPAGANGAPGLRGGAGEPGKNGAKGEPGPRGERGEAGIPGVPGAKGEDGKDGSPG------------------------------------EPGANGLP---GAAGERGAP------------------GFRGPAGP------NGIPGEKGPAGERGAPGPAGPRGAAGEPGRDGV 529          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Celegans
Match: col-135 (COLlagen [Source:UniProtKB/TrEMBL;Acc:G3MU58])

HSP 1 Score: 124.405 bits (311), Expect = 2.613e-28
Identity = 170/473 (35.94%), Postives = 200/473 (42.28%), Query Frame = 1
Query: 5668 TGPTGVPGMKGPLGVKGDKGQRGR---MGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRG---ENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMG 7068
             G  G PG KG  G KG+KG  G     G  G  G  GN GP+G  GA G +G  G+PG  G+ G  G +G  G PG                        S+G  G KG  G DG  G  G  G PG  GD G+ G DG  G  G PG                           SKGD    G  G+ G  G PG  G  G +G  G +G +G  G+PG +G  G KG+ G  G  G PG+ G  G+ G  G  G  G  G                             G N  PG +G  GE+G  G  G DG PG  G  G+ GL GP G   + G  G PG+ G  G KG  G+KG  G PG  GD GA G +G  G   + GD G  G  GP G+ G  G  G  G  G  G DG  G D   G+KG+ G  G  G +G +G  G  G  G  G KGDIG  G  G
Sbjct:  153 KGEKGSPGQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPG------------------------SKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTPG---------------------------SKGD---KGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGDKGADGAKGADGTPGSKGDKGEKGLDGPKGDKGADG---------------------------AKGANGTPGAKGDKGEKGTDGAKGADGTPGAKGDKGEKGLDGPKG---DKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGDKGLDGPKGDKGADGTPGSKGDKGEKGDIGQPGQKG 541          

HSP 2 Score: 116.316 bits (290), Expect = 8.900e-26
Identity = 165/486 (33.95%), Postives = 210/486 (43.21%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSG---------TKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGR 7071
             G+ G  G  G  G  G KG  G  G KG +G  G DG  G  G  G +G  GA G +G  G+PG  G+ G  G+ G  G  G  G                     + G  G KG  G DG  G+DG    PG  GD G+ G+DGP G KG  G                   +G  G  G+KGD G  G  G+ G  G PG  G  G +G  G +G +G  G+PG +G  G KG+ G  G  G PG+ G  G  G  G  G                                 TPG+    G +G  G +G  G  G  G  G+ G  G  G +G  G PG+ G +G  G +GP G         +KG+KG KG  G+PG  GD G  G  G  G+ G  G  G++G  G+ G  G +G +G PG  G+DG+ G+    G KG  G IG  G++G +G  G  G PG  G  G  G  G  G+
Sbjct:  231 KGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADG---------------------TPGAKGDKGDKGADGAKGADG---TPGSKGDKGEKGLDGPKGDKGADG------------------AKGANGTPGAKGDKGEKGTDGAKGADGTPGAKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADG---------------------------------TPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGDKGLDGPKGDKGADGTPGSKGDKGEKGDIGQPGQKGDKGEKGQDGQPGQKGQDGQPGQKGDKGDKGQ-GEKGQDGQPGQKGQDGQPGQ---KGDKGEKGDIGQPGQKGDKGDKGQDGQPGQKGQDGQPGQKGQDGQ 637          

HSP 3 Score: 115.546 bits (288), Expect = 1.569e-25
Identity = 183/540 (33.89%), Postives = 218/540 (40.37%), Query Frame = 1
Query: 5653 GINGPTGPTGVPGMKGPLGVKGDKGQRGR-----MGKDGILGPRGNLGPQGPTGAPG------------------RRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPG------SDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIG 7185
            G+ G  G  G PG KG  G KGDKG  G       G  G  GP G  G  G  GAPG                   +G  GSPG  G+ G  G +G +G                           S G  G KG  G DG PG      +DG +GA G  G  G  G DG  G  G+PG                           SKGD G  G  GS G +G+ G  G+ GS+G    +G +G  G+ G  G  GSKG +G  G  G  GTPG+ G  G+ G+                                           GP+G  G  G PG  GD G  G        G +G  G PG+ G +G  G +GP G KG  G+KG  G PG  GD G  G  G +G +G  G  G++G  G  G  G +G +G PG  G  GE G    DGAKG  G  GS G +G  G  G  G PG  G KG+ G  GP G  G  G PG  G  G  G +G KG  G PG+ G  G  G
Sbjct:   77 GVPGTNGKDGTPGDKGDTGDKGDKGDTGAPGVGVKGDPGAQGPPGEKGKDGDKGAPGAKGSKGDDGKKGDKGSSGEKGEKGSPGQKGDKGEKGEKGSNG---------------------------SPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPG---------------------------SKGDTGDKGEKGSDGAKGDKGANGTPGSKGD---KGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLD------------------------------------------GPKGDKGADGTPGAKGDKGDKGA------DGAKGADGTPGSKGDKGEKGLDGPKGDKGADGAKGANGTPGAKGDKGEKGTDGAKGADGTPGAKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKG---ADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGDKG 508          

HSP 4 Score: 105.531 bits (262), Expect = 2.445e-22
Identity = 188/488 (38.52%), Postives = 233/488 (47.75%), Query Frame = 1
Query: 5779 GPQGPTGAPGRRGTVGSPGPVGNAGHPGV--------QGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKR---GAPGEHGDPGKAGID---GPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQR---GLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            G  G  G PG +G  G  G  G+ G PGV        QG  G  G  G+ G  G  G  G  G +G+KGS G  G KGS GQ G  G  G++   G+PG  GD G+ G D   GP G KG  G  G  G  G +G +G  G +G  G  GSKGD G  G  GS G +G+ G  G+ GS+G    +G +G  G+ G  G  GSKG +G  G  G  GTPG+ G  G+ G+                               G  G  G +  PG +G  G++G  G  G DG PG+ G  G+ GL GP G  G  G +   G PG+ G  G KG  G+KG  G PG  GD G  G  GP+G+ G  G  G +G  GE G  G +G +G PG  G  G +G    DG  G  G  G  G  GP+G  G  G PG+ G KG+ G+ G  G     G PG  G  G  G +G KGDKG  G PG+ G  G +
Sbjct:   80 GTNGKDGTPGDKGDTGDKGDKGDTGAPGVGVKGDPGAQGPPGEKGKDGDKGAPGAKGSKGDDGKKGDKGSSGEKGEKGSPGQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGD---KGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGL------------------------------DGPKGDKGADGTPGAKGDKGDKGADGAKGADGTPGSKGDKGEKGLDGPKGDKGADGAKGANGTPGAKGDKGEKGTDGAKGADGTPGAKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKG---ADGTPGSKGDKGDKGLDGPKGDKGADGTPGSKGDKGEK 531          

HSP 5 Score: 98.5969 bits (244), Expect = 3.543e-20
Identity = 143/389 (36.76%), Postives = 175/389 (44.99%), Query Frame = 1
Query: 5998 QDGYPGSDGKRGAPGEHGDPGKAGIDGPS-----GVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIG---------------------PMGPSGSPGLRGNPGVIGSLGSQGFPGA---RGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRR---GPQGMTGIQGPPGSIGLKGDIGSTGPMG 7068
            +DG PG++GK G PG+ GD G  G  G +     GVKGDPG                   +G  GE G  GD G                       G  GSPG +G+ G  G  GS G PG+   +G +G  G+PGP+G  G+ G++G  G  G  G  G DG  G  G                 G  G  G  G+ G  G  G  G N  PG +G  GE+G  G  G DG PG+ G  G  G +G  G PG  G +G  G +GP G KG  G+ G  G  G  G +GA G  G  G  GD G  G  GP G+ G  G +G NG PG  G  GE G D   GA G  G  G  G +   GP+G  G  G PG+ G KG+ G+ G  G
Sbjct:   75 KDGVPGTNGKDGTPGDKGDTGDKGDKGDTGAPGVGVKGDPG------------------AQGPPGEKGKDGDKGAPGAKGSKGDDGKKGDKGSSGEKGEKGSPGQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADG---------------NPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGDKGADGAKGADGTPGSKGDKGEKGLDGPKGDKGADGAKGANGTPGAKGDKGEKGTDGAKGADGTPGAKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKG 430          

HSP 6 Score: 59.3066 bits (142), Expect = 4.913e-8
Identity = 74/211 (35.07%), Postives = 90/211 (42.65%), Query Frame = 1
Query: 6682 QRGLPGSNGPSGT------KGNKGSKGPYGKP--GIAGDNGASGPQGPRGENGDLG---------------------NTGEQGP---VGEVGNAGIRGVNGAPGIPGKDGENGKD---------AVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            + G+PG+NG  GT       G+KG KG  G P  G+ GD GA GP G +G++GD G                       GE+G     G+ G  G +G NG+PG  G  GE G D           DGAKG  G  GS G +G  G  G  G PGS G  GD G  G                      +G KGDKG  G PG+ G  G +
Sbjct:   75 KDGVPGTNGKDGTPGDKGDTGDKGDKGDTGAPGVGVKGDPGAQGPPGEKGKDGDKGAPGAKGSKGDDGKKGDKGSSGEKGEKGSPGQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKG---------------------SDGAKGDKGANGTPGSKGDKGEK 264          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Celegans
Match: col-135 (COLlagen [Source:UniProtKB/TrEMBL;Acc:G3MU58])

HSP 1 Score: 112.079 bits (279), Expect = 1.158e-24
Identity = 168/471 (35.67%), Postives = 208/471 (44.16%), Query Frame = 1
Query: 5668 TGPTGVPGMKGPLGVKGDKGQRGR---MGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGR 7071
             G  G PG KG  G KG+KG  G     G  G  G  GN GP+G  GA G +G  G+PG  G+ G  G +G  G PG                        S+G  G KG  G DG  G  G  G PG  GD G+ G DG  G  G PG        G +G  G +G  G  G+ G KG+ G  GP G  G  G PG  G  G +G  GA+G  G  GS G +G  G+KG+ GT G  G  G  G DG  G  G                                        +  PG +G  GE+G  G  G DG PG+ G  G  GL GP         +G  G++G  G+KG+KG KG  G+PG  GD G  G  G  G+ G  G  G++G  G+ G  G +G +G PG  G+DG+ G+    G KG  G IG  G++G +G  G  G PG  G  G  G  G  G+
Sbjct:  153 KGEKGSPGQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPG------------------------SKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTPG------SKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGA---------------------------------------DGTPGAKGDKGEKGADGAKGADGTPGSKGDKGDKGLDGP---------KGDKGADGTPGSKGDKGEKGDIGQPGQKGDKGEKGQDGQPGQKGQDGQPGQKGDKGDKGQ-GEKGQDGQPGQKGQDGQPGQ---KGDKGEKGDIGQPGQKGDKGDKGQDGQPGQKGQDGQPGQKGQDGQ 541          

HSP 2 Score: 106.301 bits (264), Expect = 7.728e-23
Identity = 158/447 (35.35%), Postives = 205/447 (45.86%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGA---------PGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGS---------KGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGK 6927
             G PG  G  G  G  G  G  G KGDKG++G  G  G  G +G  G +G  G PG +G  GS G  G  G+PG +G +G  G +G  G +G  G  G  G +G+KG +G  G KG+   DG PGS G +GA         PG+ GD G+ G+DGP G KG  G                    G  G+ G KG  G  G  G+PG +G+ G  G+ G+ G PG +G +G  G  GP+G  G+         KG +G  G  G  GTPG  G  G  G+ G  G  G  G                        TPG     G +G +G+ G  G                 G +G  G PG  GQ G PG  G  G KG +G KG  G+PG  G +G  G +G +GE GD+G  G++G  G+ G  G  G  G  G PG+ G++G+
Sbjct:  156 KGSPGQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGA---DGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADG------------------TPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGDKGLDGPKGDKGADG------------------------TPGSKGDKGEKGDIGQPGQKG---------------DKGEKGQDGQPGQKGQDGQPGQKGDKGDKG-QGEKGQDGQPGQKGQDGQPGQKGDKGEKGDIGQPGQKGDKGDKGQDGQPGQKGQDGQPGQKGQDGQ 541          

HSP 3 Score: 96.6709 bits (239), Expect = 9.469e-20
Identity = 167/481 (34.72%), Postives = 202/481 (42.00%), Query Frame = 1
Query: 5752 GILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGA---PGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIG 7185
            G  G  G  G +G TG  G +G  G+PG VG  G PG QG  G  G  G+ G  G  G  G  G +G+KGS G  G KGS GQ G  G  G++G+   PG  GD G+ G DG  G KGD                              KG  G  G  G+PG +G+ G  G+ G+ G PG++G  G  G  G  G  G KG+ GT G  G  G  G DG  G  G                                    TPG     G  G  G  G PG+ G              G +G  GP G+ G  G PG+ G  G KG  G+KG  G PG  GD GA G +G  G  G  G+ GE+G  G  G+ G  G  GA G  G+ G +G    DG  G+ G  G  G  GP+G  G  G PGS G KG+ G  G  G+                  +G KG+KG  G PG  G  G
Sbjct:   80 GTNGKDGTPGDKGDTGDKGDKGDTGAPG-VGVKGDPGAQGPPGEKGKDGDKGAPGAKGSKGDDGKKGDKGSSGEKGEKGSPGQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGD------------------------------KGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADG------------------------------------TPGSKGDKGADGAKGADGTPGQKG------------DKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGDKGLDGPKGDKGADGTPGSKGDKGEKGDIGQPGQ------------------KGDKGEKGQDGQPGQKGQDG 463          

HSP 4 Score: 96.2857 bits (238), Expect = 1.367e-19
Identity = 159/501 (31.74%), Postives = 195/501 (38.92%), Query Frame = 1
Query: 5653 GINGPTGPTGVPGMKGPLGVKGDKGQRGR-----MGKDGILGPRGNLGPQGPTGAPG------------------RRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPG------SDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMG 7068
            G+ G  G  G PG KG  G KGDKG  G       G  G  GP G  G  G  GAPG                   +G  GSPG  G+ G  G +G +G                           S G  G KG  G DG PG      +DG +GA G  G  G  G DG  G  G+PG                           SKGD G  G  GS G +G+ G  G+ GS+G    +G +G  G+ G  G  GSKG +G  G  G  GTPG+ G  G+ G+ G  G                                G +  PG +G  GE+G                    G +G  G PG+ G +G  G+ G  GT G KG KG  G  G  GD GA G  G +G+ G+ G  G +G  G  G+ G +G  G  G  G  G +G     G KG  G IG  G++G +G  G  G PG  G  G  G  G  G
Sbjct:   77 GVPGTNGKDGTPGDKGDTGDKGDKGDTGAPGVGVKGDPGAQGPPGEKGKDGDKGAPGAKGSKGDDGKKGDKGSSGEKGEKGSPGQKGDKGEKGEKGSNG---------------------------SPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPG---------------------------SKGDTGDKGEKGSDGAKGDKGANGTPGSKGD---KGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKG------------------------------DKGADGTPGAKGDKGEKGA------------------DGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGDKGLDGPKGDKGADGTPGSKGDKGEKGDIGQPGQKGDKGEKGQDGQPGQKGQDGQPGQKGDKG 472          

HSP 5 Score: 76.6406 bits (187), Expect = 1.718e-13
Identity = 76/185 (41.08%), Postives = 98/185 (52.97%), Query Frame = 1
Query: 6637 QSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            + G +G  G PG+ G +G  G++G  G KG+KG+ G  G  G  G  G  G  G +G +G+ G+ G+ G  GE G+ G +G  GA G PG  G+ G+   DGAKG  G  GS G +G  G  G  G PG  G KG+ G  GP G  G  G PG  G  G  G +G KG  G PG+ G  G  G +
Sbjct:  167 EKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAK 351          

HSP 6 Score: 58.5362 bits (140), Expect = 7.726e-8
Identity = 74/211 (35.07%), Postives = 90/211 (42.65%), Query Frame = 1
Query: 6682 QRGLPGSNGPSGT------KGNKGSKGPYGKP--GIAGDNGASGPQGPRGENGDLG---------------------NTGEQGP---VGEVGNAGIRGVNGAPGIPGKDGENGKD---------AVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            + G+PG+NG  GT       G+KG KG  G P  G+ GD GA GP G +G++GD G                       GE+G     G+ G  G +G NG+PG  G  GE G D           DGAKG  G  GS G +G  G  G  G PGS G  GD G  G                      +G KGDKG  G PG+ G  G +
Sbjct:   75 KDGVPGTNGKDGTPGDKGDTGDKGDKGDTGAPGVGVKGDPGAQGPPGEKGKDGDKGAPGAKGSKGDDGKKGDKGSSGEKGEKGSPGQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKG---------------------SDGAKGDKGANGTPGSKGDKGEK 264          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Celegans
Match: emb-9 (Collagen alpha-1(IV) chain [Source:UniProtKB/Swiss-Prot;Acc:P17139])

HSP 1 Score: 103.219 bits (256), Expect = 2.967e-21
Identity = 188/521 (36.08%), Postives = 228/521 (43.76%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDG---------YPGSDGKRGAPGEHGDPGKAGIDG--------PSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXEL----------GSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSN---GPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGI-----PGKDGENGKDAVDGAKGNIGPIGSSGRR----------GPQGMTGIQGPPGSIGLKGDIGSTGPMGR 7071
            G PG +GP G  G PGM G  G  GD G +G  G  G+ G  G+ G QG  G PG +G  G PG  G  G PG+ G++G P  Q                 EG   SQG  G+KG  G+ G         YPG  G +G PG +G PG  G+ G         SGVKG+ G  G PG  G+ G          +  L          G KG  GP+GP G  GL G PG  G  G +G  G  G +G  G  G  G  G KGSQG  G+ G PG PG  G AG+ G                                  PG PG     GP+GPLGE                   G++G  G  G  G  G +GLPG +   GP G +G  G+ G  G+PGI G  G +  +G RGE+G  G  GE G  GE G+ G  G +G PG      PG DG++G+D   G  G+IG  G SG +          GP GMTG+ G PG  G  G  G  GP G 
Sbjct:   61 GAPGQDGPEGAPGAPGMFGAEGDFGDMGSKGARGDRGLPGSPGHPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGLAG-PPGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGY---------------------------------PGRPGFEGDCGPEGPLGE-----------------GTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYT-EKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYDIQGPPGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPGTGVNKVGPPGMTGLPGEPGMPGRIGVDGYPGPPGN 529          

HSP 2 Score: 80.8777 bits (198), Expect = 1.953e-14
Identity = 159/447 (35.57%), Postives = 193/447 (43.18%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGG--LGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAG---------------IDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIG-----PPGNSGQRGLPGSNGPSGTKGNKGSKGPYGK---PGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPG 6906
             GE G  G  G  G+PG++G  G  G KG+ G  G+ G  G  G LG  G  G PG  G  G  G  G  G PG++G SG+PG  G PG  G PG  G  G +G  G+ G    G  G  GQDGYPG DG  GAPG +G+PG  G               + G  G +G PG                          G +G  G  G  G PG+ G PG+ G  G  G+PGA                G+ GS G  G  G+PG PG+ G++G  G                                     PG   QPG +GP G+ G PG+ G DG+PG  G   + GL GP+      PPG  G+ G PG  G  G  G+ G  GP GK   PG  G +G  GP G  G  G  G+ G QG  G  GN G+ G  G PG PG
Sbjct: 1160 EGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLD------------------------GKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGA---------------PGAPGSNGYPGERGLPGVPGQQGRSGDNGY------------------------------------PGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPG---REGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPGPPGLSGMPGHGGDQGFQGAAGRTGNPGLPGTPGYPGSPG 1528          

HSP 3 Score: 79.337 bits (194), Expect = 5.727e-14
Identity = 185/543 (34.07%), Postives = 221/543 (40.70%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGI---LGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDA-----------VDGAKGNIGPIGSSGRRGPQG------------MTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
             G PG+ G  GP G PG+KG  G  GD GQRG+ GKDG+    G +G+ G QG  G PG  GT G  G  G  G PG +G  G  G  GE                       G G  G  G  G+ G  G +G PG  G PG  G  GP G  G PG+ G  G  G               E G +G+ G  G +G PGL G PG  G  G  G PG      I G PG  G++G  G        G+PG  G  G +G+ G PG                                    K   PG  G  GE G PG+                G+ G  GPPGN+G+RG      P G  GN G       PG  G NG  GP GP G++GD G  G  G  G  G+ G+ G  G PGIPG  G  G+             + G KG+ G  G  GR G  G              G+QG PG  G+ G  G  G +G I     P      G PG  G+KG++G  G PG PG  GP+
Sbjct:  275 VGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGE-----------------------GTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYT-------------EKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYD----IQGPPGLDGQSGRDG------FPGIPGDIGDPGYSGEKGFPGTGVN--------------------------------KVGPPGMTGLPGEPGMPGRI---------------GVDGYPGPPGNNGERGEDCGYCPDGVPGNAGD------PGFPGMNGYPGPPGPNGDHGDCGMPGAPGKPGSAGSDGLSGSPGLPGIPGYPGMKGEAGEIVGPMENPAGIPGLKGDHGLPGLPGRPGSDGLPGYPGGPGQNGFPGLQGEPGLAGIDGKRGRQGSLG-IPGLQGPPGDSFPGQPGTPGYKGERGADGLPGLPGAQGPR 717          

HSP 4 Score: 78.9518 bits (193), Expect = 6.719e-14
Identity = 205/578 (35.47%), Postives = 237/578 (41.00%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPG---------MKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAP--------------GRRGTVGSPGPVGNAGH---PGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGG---LGIKGSIGQDGYPGSDGKRGAPG---EHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPG---LRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGP-----------PGNSGQ---------------------RGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPG 7176
            G PG+ GP GP G PG         + G  G+ G+ G RG+ G+ G  G  G+ G  G  G P              G  G VG PGP G+AG    PG  G  GR G  G PG  G  G+ G  G  G+ GS+G    +GI G  G+DG PG+ G+ G PG   E G PG+ G+DG  G  GD G                          GS G  G  GPSG PG   L G PG+ G  G  G PG  G  G  GS   RG  G  G  G  G  G+PG PG DG+ G VG                               AG PGTPG   QPG  G L   G PG  G  G  G  G PGQ GL G  G            PG SGQ                      G+PG  G SG  G  G +G  G PG  G  G  G  G  G  G  G  G+QG  GE G  GI G NG PG+ G+DG+ G    +G  G  G  GS+G+ G  G  G  G PG  G  G+ G  G                       G +G+ G PG PG PG
Sbjct:  749 GLPGLPGPVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYP------------------------GSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGS---RGLDGVPGYPGEHGTDGLPGLPGADGQPGFVG------------------------------EAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDG---------------------QPGLRGESGQPGQPGLPG 1248          

HSP 5 Score: 77.0258 bits (188), Expect = 2.877e-13
Identity = 169/498 (33.94%), Postives = 202/498 (40.56%), Query Frame = 1
Query: 5692 MKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAP---GIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPG 7176
            ++GP+G  G KG++GR   DG +GP G LG  GP G PG +G  G  G  G  G  G  G+ G  G                         +G  G +G  G  GYPG+ G  G PG  G PG  G  GP G  G+                      G  G  G++G  G  G  G PG  G PG +G  G  G PGA G  GI G PG     G +G  G  G AG PG PG+ G  G  G                                   G PG ++Q    GP G  G  G+ G              G+ G IG PG SG++G PG+       G  G  G  G+PG+ G  G  G  GP G NG+ G      P G  GNAG  G  G     G PG +G++G   + GA G  G  GS G  G  G+ GI G PG  G  G+I   GPM                P G  G KGD GLPG PG PG
Sbjct:  256 LQGPVGPAGVKGEKGR---DGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYG------------------------EKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGE--------------------GTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPG-YTEKGDRGEDGYPGFAGEPGLPGEPGDCGYPG---------------------------------EDGLPGYDIQ----GPPGLDGQSGRDGF------------PGIPGDIGDPGYSGEKGFPGTG--VNKVGPPGMTGLPGEPGMPGRIGVDGYPGPPGNNGERGEDCGYCPDGVPGNAGDPGFPGMNGYPGPPGPNGDHGDCGMPGAPGKPGSAGSDGLSGSPGLPGIPGYPGMKGEAGEI--VGPM--------------ENPAGIPGLKGDHGLPGLPGRPG 638          

HSP 6 Score: 74.7146 bits (182), Expect = 1.152e-12
Identity = 202/569 (35.50%), Postives = 248/569 (43.59%), Query Frame = 1
Query: 5653 GINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGT---VGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGE--------------------------------QGPVGEVGNAGIRGVNGAPGIPGKDGENGK---------------DAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSI---GLKGDIGST---GPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            GI+G  G  G PG +G  G  G  G+ G  G++G+ G  G  G QG  G+PG+ G     G PG  G  G PG++G  G  G  G  G  G  G  GL G  G  G  G  G+ G  G DG PG  G+ G PG  G  G+ G  G     G PG  G PG  G  G  G  G  G+ GE G  GD  P    G+PGL G PG  G  G  G PG  G  GI G PG +G +G  G  G  G  G+PG PG +G+ G+ G                                  PG+PG+   PG QG  GE+G PG           G  G  GL+G  G PG  G+ GL G  G  G+ G  G+ G  G PG  G+NG +G QG  G+ G  G +G+                                 GP G+ G  G  G++G PG PG +GE G                  + G  G  G  G  G+RG  G+ G  G PG     GL+GD G     G  G  G  G PG+ G+ G PG +G  GD G PG PG PG+ GP+
Sbjct:  889 GIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSYP----GNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGF---------------------------------PGSPGQPGYPGQQGREGEKGYPGIP---------GENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPR 1411          

HSP 7 Score: 74.7146 bits (182), Expect = 1.295e-12
Identity = 167/479 (34.86%), Postives = 199/479 (41.54%), Query Frame = 1
Query: 5791 PTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGV--IGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX---------XXTPGKNMQPGPQGP---LGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIG 7185
            P   PG +G  G+PG  G  GHPG  G  G                     PEG  G+ G  G +G  G  G  G+ G RG PG  G PG  G+DG  G+KG+ G  G  G  G  G  G           G  G  G  G  G PGL G PG   + S G +G  G  G  G+ G PG  G  G KG++G  G  G+PG PG  G  G++G+        +  P  P              P             G  G+  + GP GP   LG  GPPG  G  G  G++G  GQ G +G  G PGN G++G  G  G  GT G  G+KG  G+PG  G  G  G  GP G  G+   TGE GP G  G  G++G  G PG             DG  G +GP G  G  G  G  GI G PG    KGD G  G                       GF G+ GLPG PG  G  G
Sbjct:   38 PCVCPGTKGERGNPGFGGEPGHPGAPGQDG---------------------PEGAPGAPGMFGAEGDFGDMGSKGARGDRGLPGSPGHPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGL---------AGPPGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGE--GTGEAGPHGAQGFDGVQGGKGLPGH------------DGLPGPVGPRGPVGAPGAPGQPGIDGMPGYT-EKGDRGEDG---------------------YPGFAGEPGLPGEPGDCGYPG 450          

HSP 8 Score: 74.3294 bits (181), Expect = 1.813e-12
Identity = 182/487 (37.37%), Postives = 205/487 (42.09%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKG-DI----GPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQG---------ILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
            TG PG+ G +G  G+PG +G  G+ G  G  G  G+DG     G+ G  G  G  GR G  G PG  G  G PG++G  G+PG +GE G                    G  G  GS GQ G PG  G  GAPGE+GD G  G DG  G++G+ G+ G PG  GR G  GP G  G  G  G+ G DI    G  G  G PGL G PG  G  G  G PG  G  G         + G PG RG  G  G +G  G+ G PG PG +G  G  G                                G  G PG    PG  G  GERG PG  G            Q G  G  G PG  GQ   PG  GP G  G  G  G  G PG  G  G  GP      N   G  GE G  GE G  G+ G NG  G PGK G  G    DG  G  G  G  G  G QG  G  G  G+ GL G  G  G
Sbjct: 1106 TGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGF---PGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENG------------------LDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEG------------------------------DCGEDGYPGAPGAPGSNGYPGERGLPGVPG------------QQGRSGDNGYPGAPGQ---PGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRN-PPGQPGENGYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPGPPGLSGMPGHGGDQGFQGAAGRTGNPGLPGTPGYPG 1525          

HSP 9 Score: 70.8626 bits (172), Expect = 2.201e-11
Identity = 136/378 (35.98%), Postives = 166/378 (43.92%), Query Frame = 1
Query: 6220 GSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNG---------------------------------ASGP------QGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKD------GENGKDAVDGAKGNIGPIGSSGRR---------GPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            G+PG  G PG  G+ G  G  GA G  G+ G+ G  G  GSKG++G  G+ G PG PG  G  G  G+                      G++G PG  G  G PG     GP G  G+ G PG+ G  G PG  G   Q G +G  G  G SG  GLPG++G  G KG KG  GPYG PG  G +G                                 AS P      QGP G  G  G  G  GPVG  G  G+ G  G PG+ G+       G+ GK   DG  GN G  GS G +         G +G  G  G PG  G +GD G  GP+G        G+ G  G  G +G +G KGLPG+ G PG +GP+
Sbjct:   49 GNPGFGGEPGHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGSKGARGDRGLPGSPGHPGLQGLDGLPGL---------------------KGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVNSQ-GRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGE-----GTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPR 399          

HSP 10 Score: 70.0922 bits (170), Expect = 3.706e-11
Identity = 189/547 (34.55%), Postives = 223/547 (40.77%), Query Frame = 1
Query: 5680 GVPGMKGPLGVKGDK--------GQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGA------PGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKD-----GKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRG---------LPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPI-----------------GSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIG 7185
            G+PG+ G  G  GD         GQ G  G DG+ G  G  G  G TG PG +G  G PG  G  G+ G+ G  G  G                          G  G  GS GQ GYPG  G+ G       PGE+G PG  G DG  G+KG+ G  G PG                    GS G +G  G  G PG  G  G  G+ G  G PG RG  G  G PG  GR G  G  G  G  G PG PG+D     G+AGQ G                                     PG +  PG  G  GE G PG+ G  G+PG  G  G  G  G  G PG  G+RG         +PG  G  G +G+ G  G  G PG  G NG  G +G  G  G  G +G+ G  G  G  GI+G  G  G PG+DG +G     G +G  GP+                 G  G  G  G  G+ GPPG  G  G  G+ G  G  G+ G+PG  G  G  G  G  G+ GLPG PG PG  G
Sbjct: 1060 GLPGLNGERGDNGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIPGQPGLEG------------------------ECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYP------------------GSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGY------------------------------------PGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPGPPGLSGMPGHGGDQGFQGAAGRTGNPGLPGTPGYPGSPG 1528          

HSP 11 Score: 68.9366 bits (167), Expect = 8.098e-11
Identity = 204/575 (35.48%), Postives = 248/575 (43.13%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMG------------KDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQ-----DGYPGSDGKRGAPGEHGD---------------PGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGP-----IGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGK---------------PGIAGDNGASGPQGPRGEN---GDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXX-----XXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGP 7188
            G PG +G  GP+G+PG  G +G  G +G+ G  G              G+ G  G  G  G  G PG  G  G PG VG AG PG  G  G+PG  G     G PG  G  GP+G  G  G  G+ G  G+     D YPG+ G  G PG+ G                 G  G+ G SG+ G PG+                GN GI G+ G +G+ G  G  GSPG  G PG  G  G +G+PG  G  G+ G  G  G+ G KG  G  G  G PG+ G+ G  G VG PG  G  G  G                          G++ QPG +G  G+ G PG  G DG PG VGPPG  G  G       GPPG +GQ G PG +G  G  G  G  G  G+               PG  G+ G  G  G RG +   G  G  G +G  G  G+ G  G  GAPG PG +G  G+  + G  G  G  G +G  G  G  GI+GP G  G  G  G  G  GR G                G PG  G+ G+KG PG PG  G+ GP
Sbjct:  937 GSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQ---------------GNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQ------------------------GRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGP 1472          

HSP 12 Score: 68.5514 bits (166), Expect = 1.096e-10
Identity = 209/553 (37.79%), Postives = 250/553 (45.21%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGL-GIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARG---PQGILGSPGPRG---------------RTGSKGSQGTIGIAG--VPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGE---------NGKDAVDGAKGN--IGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGF------KGDKGLPGNPGTPGVIG 7185
             G+ G  G  GP G PG  G  G  G  G+ G  G+DG  G  G+ G  G  G  G++G  G+PG  G  G PG  G +G                            Q G+ G  G+ G  GYPGS G+ G PG  G PG+ G+ G  G++G+ G  G PG  G  G  G RG  G+    G  G+ G  G  G PG  G PG +G  G  G PG RG     G L  PG  G               + G  G  G  G  G   PG PG  G+ G  G  G +G PG PG  G  G+PG  G+ G PG  G  G  G   QPG +G  GE G PG  G  G PG      Q G +G  G PG  G+ GLPG  G  G  G KG  G  G+PG  G  G  G  G  G  G  G  G+ G  G  G  G+RG +G PG PG  G           G D   GA G    GP G +G+ G  G+ G+   PG+ GL G+ GS G  G  G+PG PG+ G+ G PG  G       +G  GLPG PG PGV G
Sbjct:  837 NGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAG-------------------------APGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVP---GYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPGSPGQPGYPG------QQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGL---PGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEG 1352          

HSP 13 Score: 68.1662 bits (165), Expect = 1.286e-10
Identity = 175/528 (33.14%), Postives = 210/528 (39.77%), Query Frame = 1
Query: 5677 TGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKD-----GKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQR---------GLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGP--QGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXX---------XXXXXXXXXEGFKGDKGLPGNPGTPGVIG 7185
            TG+PG+KG  G+ G     GR G DGI          G  G  G  G  G PG  G  G+PG QG                                         G+ GYPG  G+ G PG  G  G+ G+ G +G+ G PG                          GS G +G  G  G PG  G  G  G+ G  G PG RG  G  G PG  GR G  G  G  G  G PG PG+D     G+AGQ G                                     PG +  PG  G  GE G PG+ G  G+PG  G  G  G  G  G PG  G+R         G+PG  G  G +G+ G  G  G PG  G NG  G +G  G  G  G +G+ G  G  G  GI+G  G  G PG+DG +G     G +G  GP+  + R  P   G  G  G  G  GL GD G +GP G+ G PG PG           G+ G  G +GF+G  G  GNPG PG  G
Sbjct: 1106 TGMPGLKGESGLPG---LPGRQGNDGI---------PGQPGLEGECGEDGFPGSPGQPGYPGQQGRE---------------------------------------GEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYP------------------------GSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGY------------------------------------PGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPGPPGLSGMPGHGGDQGFQGAAGRTGNPGLPGTPG 1522          

HSP 14 Score: 63.5438 bits (153), Expect = 2.980e-9
Identity = 196/588 (33.33%), Postives = 242/588 (41.16%), Query Frame = 1
Query: 5644 GEPGINGPTGPT--------GVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQG-----------FPGARGPQGILGSPGPRGRTGSK---------------GSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPG-------KSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPS------GTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGP--------------------VGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGL---KGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGF---KGDKGLPGNPGTPGVIGP 7188
            G+PGI+G  G T        G PG  G  G+ G+ G  G  G+DG+ G     GP G  G  GR G  G PG +G+ G+ G +G  G   N+  P                     G  G+ G IG DGYPG  G  G  GE  D G    DG  G  GDPG  G  G  G  GP G  G+ G+ G  G  G  G  G SGSPGL G PG  G  G  G            PG +G  G+ G PG   R GS                G QG  G+AG+ G  G+ G  G  G+                                    PG+   PG +G  G  G PG       +     +       GQ G+ G  G PG+ G  GLPG  GP       GT G +G  G  G PG+ G+ G  G QG  G NG  G+ GE G                      G+VG  G  G  GA G+PG DG  G+D + G  G  G  G +G+ G  G  G +G  G +G+   KG  G+ G  G+ G PG  G+ G  G  G +G+    GD+G PG+PG  G  GP
Sbjct:  409 GQPGIDGMPGYTEKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPG-YDIQGPPGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPGTGVNKVGPPGMTGLP--------------GEPGMPGRIGVDGYPGPPGNNGERGE--DCGYC-PDGVPGNAGDPGFPGMNGYPGPPGPNGDHGDCGMPGAPGKPGSAGSDGLSGSPGLPGIPGYPGMKGEAGEIVGPMENPAGIPGLKGDHGLPGLPG---RPGSDGLPGYPGGPGQNGFPGLQGEPGLAGIDGKRGRQGSLGIPGL----------------------------QGPPGDSFPGQPGTPGYKGERGADGLPGLPGAQGPRGIPAPLRIVNQVAGQPGVDGMPGLPGDRGADGLPGLPGPVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGP 947          

HSP 15 Score: 62.3882 bits (150), Expect = 6.621e-9
Identity = 154/476 (32.35%), Postives = 182/476 (38.24%), Query Frame = 1
Query: 5683 VPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGL-GIKGSIGQDGYPGSDGKRGA------PGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGV-----------IGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGST 7056
             PG++G  G+ G  G+RGR G  GI G +G  G   P G PG  G  G  G  G  G PG QG  G P                            GL G+ G +G DGYPG+ G+RG       PG HG+PG  G  G  G  G  G                                      G PGL G PG             G  G  G+PG  G  G  G PGP G  G  G  GT G  G  G  G+DG  G                                             QPG +G  G  G  GK G DG PG  G  G  G  G  G PG +G  G PG+ G  G  G+ G  G  G  GI G++G  G  G RGE+GD    G  G  GE G  G RG++G PG PG+ G +G   + GA G  G +G +G  G  G  G  G PG++   G  G  
Sbjct:  654 FPGLQGEPGLAGIDGKRGRQGSLGIPGLQGPPGDSFP-GQPGTPGYKGERGADGLPGLPGAQGPRGIPAPLRIVNQVAGQPGVDGMPGLPGDRGADGLPGLPGPVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDC------------------------------------GEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPG---------------------------------------------QPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGD---NGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDV 1044          

HSP 16 Score: 61.6178 bits (148), Expect = 1.254e-8
Identity = 154/466 (33.05%), Postives = 189/466 (40.56%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQ--DGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGL 7035
            G+PG  G  G +G PG+ G  G  G KG+ G      I+GP  N     P G PG +G  G PG     G PG  G+ G PG  G+ G  G  G PGL G +G++G QG LGI G  G   D +PG  G  G  GE G  G  G+ G  G +G P       +                              +G PG+ G PG+ G  G+ G PG  GP G  G PG  G  G  G  G  G+ G PG  G+ G+ G  GI               +                  G PG+   PGP G  G  G P                        GP G  G+ GLPG+ G  G  G  G  G  G+PG  G++G  G  G +G +G  G  G+ G  G  G AG  G NG  G PG  G+ G     G  G  GP G  G  G  G  G++G  G  GL
Sbjct:  579 GKPGSAGSDGLSGSPGLPGIPGYPGMKGEAGE-----IVGPMEN-----PAGIPGLKGDHGLPG---LPGRPGSDGLPGYPGGPGQNGFPGLQGEPGLAGIDGKRGRQGSLGIPGLQGPPGDSFPGQPGTPGYKGERGADGLPGLPGAQGPRGIPAPLRIVNQV-----------------------------AGQPGVDGMPGLPGDRGADGLPGLPGPVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGI-------DGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLP------------------------GPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGL 971          

HSP 17 Score: 54.299 bits (129), Expect = 2.201e-6
Identity = 193/580 (33.28%), Postives = 227/580 (39.14%), Query Frame = 1
Query: 5677 TGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQG------PTGAPGRRGT---------------------VGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGA---------------PGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPS--GSPGLRGNPGVIGSLGSQGFPGARGPQGI-------------------LGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGE---------RGPPGKSXXXXXXXXXXXXXQSGLQGP--IGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKD---GENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIG 7185
             G PGM G   + G+ G  GR+G DG  GP GN G +G      P G PG  G                       G PG  G  G  G  G+SG PG  G PG  G  G  G      E  +    GI G  G  G PG  G+ G+               PG  G+PG AGIDG  G +G                            LG  G  GP G S  G PG  G  G  G+ G  G PGA+GP+GI                    G PG RG  G  G  G +G  G PGTPG+ G  G  G                                     PG + +PG +G  GE          G PG  G  G PG  G PG++G   P  +G PG +G  G  G  GP G  G  G  G  G PG AG NG  G  G  G  G+ G  G  G  G  G  G RG +G PG  G+    G+NG D   GA G+ G  GS G+ G  G +GI G  G +G  G  G  G  G  G+ G  G+ G  G  G  G+ G+ G  G PG PG  G
Sbjct:  500 VGPPGMTG---LPGEPGMPGRIGVDGYPGPPGNNGERGEDCGYCPDGVPGNAGDPGFPGMNGYPGPPGPNGDHGDCGMPGAPGKPGSAGSDGLSGSPGLPGIPGYPGMKGEAGEIVGPMENPA----GIPGLKGDHGLPGLPGRPGSDGLPGYPGGPGQNGFPGLQGEPGLAGIDGKRGRQG---------------------------SLGIPGLQGPPGDSFPGQPGTPGYKGERGADGLPGLPGAQGPRGIPAPLRIVNQVAGQPGVDGMPGLPGDRGADGLPGLPGPVGPDGYPGTPGERGMDGLPGF------------------------------------PGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADG 1009          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Celegans
Match: emb-9 (Collagen alpha-1(IV) chain [Source:UniProtKB/Swiss-Prot;Acc:P17139])

HSP 1 Score: 97.0561 bits (240), Expect = 1.818e-19
Identity = 184/509 (36.15%), Postives = 225/509 (44.20%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDG---------YPGSDGKRGAPGEHGDPGKAGIDG--------PSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXEL----------GSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSN---GPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGI-----PGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQ--GPPGSIGLKGDIGSTG 7059
            G PG +GP G  G PGM G  G  GD G +G  G  G+ G  G+ G QG  G PG +G  G PG  G  G PG+ G++G P  Q                 EG   SQG  G+KG  G+ G         YPG  G +G PG +G PG  G+ G         SGVKG+ G  G PG  G+ G          +  L          G KG  GP+GP G  GL G PG  G  G +G  G  G +G  G  G  G  G KGSQG  G+ G PG PG  G AG+ G                                  PG PG     GP+GPLGE                   G++G  G  G  G  G +GLPG +   GP G +G  G+ G  G+PGI G  G +  +G RGE+G  G  GE G  GE G+ G  G +G PG      PG DG++G+D   G  G+IG  G SG +G  G TG+   GP G  G  G+ G  G
Sbjct:   61 GAPGQDGPEGAPGAPGMFGAEGDFGDMGSKGARGDRGLPGSPGHPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGLAG-PPGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGY---------------------------------PGRPGFEGDCGPEGPLGE-----------------GTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYT-EKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYDIQGPPGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPG-TGVNKVGPDGYPGTPGERGMDG 516          

HSP 2 Score: 94.3597 bits (233), Expect = 1.556e-18
Identity = 193/550 (35.09%), Postives = 229/550 (41.64%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGI---LGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGA--RGP------------QGILGSPGPRGRTGSKGSQGT----IGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGE---------RGPPGKSXXXXXXXXXXXXXQSGLQGP--IGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKD---GENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIG 7185
             G PG+ G  GP G PG+KG  G  GD GQRG+ GKDG+    G +G+ G QG  G PG  GT G  G  G  G PG +G  G  G  GE                       G G  G  G  G+ G  G +G PG  G PG  G  GP G  G PG+                       E G +G+ G  G +G PGL G PG  G  G  G PG   +GP             GI G  G  G +G KG  GT    +G  G PGTPG+ G  G  G                                     PG + +PG +G  GE          G PG  G  G PG  G PG++G   P  +G PG +G  G  G  GP G  G  G  G  G PG AG NG  G  G  G  G+ G  G  G  G  G  G RG +G PG  G+    G+NG D   GA G+ G  GS G+ G  G +GI G  G +G  G  G  G  G  G+ G  G+ G  G  G  G+ G+ G  G PG PG  G
Sbjct:  275 VGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGE-----------------------GTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQP-------------GIDGMPGYTEKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYDIQGPPGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPGTGVNKVGPDGYPGTPGERGMDGLPGF------------------------------------PGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADG 752          

HSP 3 Score: 80.8777 bits (198), Expect = 1.734e-14
Identity = 160/447 (35.79%), Postives = 193/447 (43.18%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGG--LGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAG---------------IDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIG-----PPGNSGQRGLPGSNGPSGTKGNKGSKGPYGK---PGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPG 6906
             GE G  G  G  G+PG++G  G  G KG+ G  G+ G  G  G LG  G  G PG  G  G  G  G  G PG++G SG+PG  G PG  G PG  G  G +G  G+ G    G  G  GQDGYPG DG  GAPG +G+PG  G               + G  G +G PG                          G +G  G  G  G PG+ G PG+ G  G  G+PGA G  G  G PG RG               +PG PG+ G++G  G                                     PG   QPG +GP G+ G PG+ G DG+PG  G   + GL GP+      PPG  G+ G PG  G  G  G+ G  GP GK   PG  G +G  GP G  G  G  G+ G QG  G  GN G+ G  G PG PG
Sbjct:  903 EGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLD------------------------GKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERG---------------LPGVPGQQGRSGDNGY------------------------------------PGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPG---REGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPGPPGLSGMPGHGGDQGFQGAAGRTGNPGLPGTPGYPGSPG 1271          

HSP 4 Score: 78.5666 bits (192), Expect = 8.727e-14
Identity = 201/566 (35.51%), Postives = 231/566 (40.81%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPT--------------GAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGG---LGIKGSIGQDGYPGSDGKRGAPG---EHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPG---LRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGP-----------PGNSGQ---------------------RGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPG 7176
            G PG  G  G  G+PG  G  G  G +GQ+G +G +GI G  G  G  G                G PG+ G  G  G  G AG PG  G  GR G  G PG  G  G+ G  G  G+ GS+G    +GI G  G+DG PG+ G+ G PG   E G PG+ G+DG  G  GD G                          GS G  G  GPSG PG   L G PG+ G  G  G PG  G  G  GS   RG  G  G  G  G  G+PG PG DG+ G VG                               AG PGTPG   QPG  G L   G PG  G  G  G  G PGQ GL G  G            PG SGQ                      G+PG  G SG  G  G +G  G PG  G  G  G  G  G  G  G  G+QG  GE G  GI G NG PG+ G+DG+ G    +G  G  G  GS+G+ G  G  G  G PG  G  G+ G  G                       G +G+ G PG PG PG
Sbjct:  504 GYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYP------------------------GSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGS---RGLDGVPGYPGEHGTDGLPGLPGADGQPGFVG------------------------------EAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDG---------------------QPGLRGESGQPGQPGLPG 991          

HSP 5 Score: 76.6406 bits (187), Expect = 2.957e-13
Identity = 173/548 (31.57%), Postives = 203/548 (37.04%), Query Frame = 1
Query: 5650 PGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAP---GEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGS---------------------------------QGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIG 7185
            PG  G  G  G  G  G  G  G  G  G  G  G+ G  G+ G  G  GA G RG  GSPG      HPG+QG+ G                          G +G  GI G  G DG+PG  G  G P   G++G+PG+ G+ GP G  G                         +   G KG  G  G SG PGL GN G  G  G++G PG  G  G  G  G +GR G + S                                 QG +G AGV G  G+DG  G                                                P G LG  GPPG  G  G  G++G  GQ G +G  G PGN G++G  G  G  GT G  G+KG  G+PG  G  G  G  GP G  G+   TGE GP G  G  G++G  G PG             DG  G +GP G  G  G  G  GI G PG    KGD G  G                       GF G+ GLPG PG  G  G
Sbjct:   42 PGTKGERGNPGFGGEPGHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGSKGARGDRGLPGSPG------HPGLQGLDGL------------------------PGLKGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGG-------------------------VNSQGRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVG------------------------------------------------PPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGE--GTGEAGPHGAQGFDGVQGGKGLPGH------------DGLPGPVGPRGPVGAPGAPGQPGIDGMPGYT-EKGDRGEDG---------------------YPGFAGEPGLPGEPGDCGYPG 450          

HSP 6 Score: 75.485 bits (184), Expect = 7.154e-13
Identity = 202/569 (35.50%), Postives = 248/569 (43.59%), Query Frame = 1
Query: 5653 GINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGT---VGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGE--------------------------------QGPVGEVGNAGIRGVNGAPGIPGKDGENGK---------------DAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSI---GLKGDIGST---GPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            GI+G  G  G PG +G  G  G  G+ G  G++G+ G  G  G QG  G+PG+ G     G PG  G  G PG++G  G  G  G  G  G  G  GL G  G  G  G  G+ G  G DG PG  G+ G PG  G  G+ G  G     G PG  G PG  G  G  G  G  G+ GE G  GD  P    G+PGL G PG  G  G  G PG  G  GI G PG +G +G  G  G  G  G+PG PG +G+ G+ G                                  PG+PG+   PG QG  GE+G PG           G  G  GL+G  G PG  G+ GL G  G  G+ G  G+ G  G PG  G+NG +G QG  G+ G  G +G+                                 GP G+ G  G  G++G PG PG +GE G                  + G  G  G  G  G+RG  G+ G  G PG     GL+GD G     G  G  G  G PG+ G+ G PG +G  GD G PG PG PG+ GP+
Sbjct:  632 GIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSYP----GNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGF---------------------------------PGSPGQPGYPGQQGREGEKGYPGIP---------GENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPR 1154          

HSP 7 Score: 74.3294 bits (181), Expect = 1.565e-12
Identity = 182/487 (37.37%), Postives = 206/487 (42.30%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKG-DI----GPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQG---------ILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
            TG PG+ G +G  G+PG +G  G+ G  G  G  G+DG     G+ G  G  G  GR G  G PG  G  G PG++G  G+PG +GE G+                   G  G  GS GQ G PG  G  GAPGE+GD G  G DG  G++G+ G+ G PG  GR G  GP G  G  G  G+ G DI    G  G  G PGL G PG  G  G  G PG  G  G         + G PG RG  G  G +G  G+ G PG PG +G  G  G                                G  G PG    PG  G  GERG PG  G            Q G  G  G PG  GQ   PG  GP G  G  G  G  G PG  G  G  GP      N   G  GE G  GE G  G+ G NG  G PGK G  G    DG  G  G  G  G  G QG  G  G  G+ GL G  G  G
Sbjct:  849 TGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGF---PGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGL------------------DGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEG------------------------------DCGEDGYPGAPGAPGSNGYPGERGLPGVPG------------QQGRSGDNGYPGAPGQ---PGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRN-PPGQPGENGYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPGPPGLSGMPGHGGDQGFQGAAGRTGNPGLPGTPGYPG 1268          

HSP 8 Score: 71.2478 bits (173), Expect = 1.569e-11
Identity = 136/378 (35.98%), Postives = 166/378 (43.92%), Query Frame = 1
Query: 6220 GSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNG---------------------------------ASGP------QGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKD------GENGKDAVDGAKGNIGPIGSSGRR---------GPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            G+PG  G PG  G+ G  G  GA G  G+ G+ G  G  GSKG++G  G+ G PG PG  G  G  G+                      G++G PG  G  G PG     GP G  G+ G PG+ G  G PG  G   Q G +G  G  G SG  GLPG++G  G KG KG  GPYG PG  G +G                                 AS P      QGP G  G  G  G  GPVG  G  G+ G  G PG+ G+       G+ GK   DG  GN G  GS G +         G +G  G  G PG  G +GD G  GP+G        G+ G  G  G +G +G KGLPG+ G PG +GP+
Sbjct:   49 GNPGFGGEPGHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGSKGARGDRGLPGSPGHPGLQGLDGLPGL---------------------KGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVNSQ-GRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGE-----GTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPR 399          

HSP 9 Score: 71.2478 bits (173), Expect = 1.582e-11
Identity = 194/591 (32.83%), Postives = 245/591 (41.46%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNL------------------------------------------GPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGS-------NGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGP--------------------VGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGL---KGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGF---KGDKGLPGNPGTPGVIGP 7188
            +G  G+ G  G +G PG+K   G KGD G  G  G  G+ G +G +                                          GP G  G  GR G VG PG +G  G PG  G+ G+ G+ G+ G +G  G  G+ G  GEKGSQG  G+ G+    GYPG+ G  G PG  G PG  G  GP G  G+                      G  G  G++G  G  G  G PG  G PG +G  G  G PGA G  GI G PG     G +G  G  G AG PG PG+ G  G  G                                   G PG ++    QGP G  G  G+ G              G+ G IG PG SG++G PG+       +G  GT G +G  G  G PG+ G+ G  G QG  G NG  G+ GE G                      G+VG  G  G  GA G+PG DG  G+D + G  G  G  G +G+ G  G  G +G  G +G+   KG  G+ G  G+ G PG  G+ G  G  G +G+    GD+G PG+PG  G  GP
Sbjct:  176 SGRSGVPGLPGNSGYPGLK---GAKGDPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGT---PGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGE--------------------GTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPG-YTEKGDRGEDGYPGFAGEPGLPGEPGDCGYPG---------------------------------EDGLPGYDI----QGPPGLDGQSGRDGF------------PGIPGDIGDPGYSGEKGFPGTGVNKVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGP 690          

HSP 10 Score: 70.4774 bits (171), Expect = 2.711e-11
Identity = 189/547 (34.55%), Postives = 223/547 (40.77%), Query Frame = 1
Query: 5680 GVPGMKGPLGVKGDK--------GQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGA------PGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKD-----GKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRG---------LPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPI-----------------GSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIG 7185
            G+PG+ G  G  GD         GQ G  G DG+ G  G  G  G TG PG +G  G PG  G  G+ G+ G  G  G                          G  G  GS GQ GYPG  G+ G       PGE+G PG  G DG  G+KG+ G  G PG                    GS G +G  G  G PG  G  G  G+ G  G PG RG  G  G PG  GR G  G  G  G  G PG PG+D     G+AGQ G                                     PG +  PG  G  GE G PG+ G  G+PG  G  G  G  G  G PG  G+RG         +PG  G  G +G+ G  G  G PG  G NG  G +G  G  G  G +G+ G  G  G  GI+G  G  G PG+DG +G     G +G  GP+                 G  G  G  G  G+ GPPG  G  G  G+ G  G  G+ G+PG  G  G  G  G  G+ GLPG PG PG  G
Sbjct:  803 GLPGLNGERGDNGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIPGQPGLEG------------------------ECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYP------------------GSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGY------------------------------------PGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPGPPGLSGMPGHGGDQGFQGAAGRTGNPGLPGTPGYPGSPG 1271          

HSP 11 Score: 69.3218 bits (168), Expect = 5.315e-11
Identity = 206/575 (35.83%), Postives = 249/575 (43.30%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMG------------KDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQ-----DGYPGSDGKRGAPGEHGD---------------PGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGP-----IGPPGNSGQRGLPGSN---GPSGTKGNKGSKGPYGK------------PGIAGDNGASGPQGPRGEN---GDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXX-----XXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGP 7188
            G PG +G  GP+G+PG  G +G  G +G+ G  G              G+ G  G  G  G  G PG  G  G PG VG AG PG  G  G+PG  G     G PG  G  GP+G  G  G  G+ G  G+     D YPG+ G  G PG+ G                 G  G+ G SG+ G PG+                GN GI G+ G +G+ G  G  GSPG  G PG  G  G +G+PG  G  G+ G  G  G+ G KG  G  G  G PG+ G+ G  G VG PG  G  G  G                          G++ QPG +G  G+ G PG  G DG PG VGPPG  G  G       GPPG +GQ G PG +   G  G  G  GS G YG             PG  G+ G  G  G RG +   G  G  G +G  G  G+ G  G  GAPG PG +G  G+  + G  G  G  G +G  G  G  GI+GP G  G  G  G  G  GR G                G PG  G+ G+KG PG PG  G+ GP
Sbjct:  680 GSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQ---------------GNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQ------------------------GRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGP 1215          

HSP 12 Score: 68.9366 bits (167), Expect = 7.195e-11
Identity = 209/553 (37.79%), Postives = 250/553 (45.21%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGL-GIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARG---PQGILGSPGPRG---------------RTGSKGSQGTIGIAG--VPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGE---------NGKDAVDGAKGN--IGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGF------KGDKGLPGNPGTPGVIG 7185
             G+ G  G  GP G PG  G  G  G  G+ G  G+DG  G  G+ G  G  G  G++G  G+PG  G  G PG  G +G                            Q G+ G  G+ G  GYPGS G+ G PG  G PG+ G+ G  G++G+ G  G PG  G  G  G RG  G+    G  G+ G  G  G PG  G PG +G  G  G PG RG     G L  PG  G               + G  G  G  G  G   PG PG  G+ G  G  G +G PG PG  G  G+PG  G+ G PG  G  G  G   QPG +G  GE G PG  G  G PG      Q G +G  G PG  G+ GLPG  G  G  G KG  G  G+PG  G  G  G  G  G  G  G  G+ G  G  G  G+RG +G PG PG  G           G D   GA G    GP G +G+ G  G+ G+   PG+ GL G+ GS G  G  G+PG PG+ G+ G PG  G       +G  GLPG PG PGV G
Sbjct:  580 NGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAG-------------------------APGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVP---GYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPGSPGQPGYPG------QQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGL---PGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEG 1095          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Celegans
Match: let-2 (Collagen alpha-2(IV) chain [Source:UniProtKB/Swiss-Prot;Acc:P17140])

HSP 1 Score: 83.9593 bits (206), Expect = 2.250e-15
Identity = 211/589 (35.82%), Postives = 258/589 (43.80%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGM------------KGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGI---------------SGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGS---------DGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGP---PGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQ--------------------------------GPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGI---QGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIG 7185
            +G+PG  G  G  G+PG+             G  GV G KG+ G  G  G+ G +G+LG  G +GAPG  G  G PG  GNAG PGV G                 G PG  G PG  G  G  GL G  G  G  G  G+KG  G +G PG          DG++G  G  G PG  G  GPSG+ G PG                       GE G  G     G  G PG +G PG+ G  G QG PG+ G  G+ G PG +G +G  G  G  G  G+PG PG+ G  GQ G                                G  G PG + QPG  G  G++G    PG  GD G+ G  G  G++G  G  G PG  G++G  G+ G  G KG+ G  G  G PGI G  G SG  G  G+ G  G +GE+                                G  G  G  G  G++G PG PG  GE+G     GAKG++G  G  G+RG  G+ G+    G PG  GLKG++G  G  G+ G PGIPG  G  G PG  G KG+ G PG PG PG  G
Sbjct:  870 SGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFK---------------------GETGLPG----YGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSG------------------------------QPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAG 1403          

HSP 2 Score: 76.2554 bits (186), Expect = 4.606e-13
Identity = 186/545 (34.13%), Postives = 232/545 (42.57%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQ--RGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPG------------KDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGL--QGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIR---GVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGM------------TGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIG 7185
            G PGI GP G  G PG+ G  G KG+ G    G+ G  G  G +G+ G  G  G PG  G  G PG  G  G  G+ G+SG+P                           G  G KG  G  G PG +G  G PG+ G PG  G+ G  G+ G PG T                        G KGD+G  G SG+PGL G PG  G  G+ G PG     G  G  G  G  G  G +G  G+ G+PGTPG            +DG +G  G+ G  G  G PG  G  G     G+ G  G       PG+    GPQGP G  G PG  G            ++GL   G  G PG  G  G+PG  G  G  G+ G  G  G PG+ G++G  G  G  G +G  G  G++G +G+ G  G+    G++G PG+PG  G+ G+  + G  G+ G  G  G++G  G              G  G PG  GLKG  G  G  G                PG  G KGD G PG PG  G+ G
Sbjct:  791 GLPGIPGPKGDVGNPGLPGLNGQKGEPGVGVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQP---------------------------GYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVT------------------------GLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGV---PGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAG------LPGQPGLRGPQGPSGLPGVPGFKG------------ETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGL---------------PGIPGLKGDSGFPGQPGQEGLPG 1248          

HSP 3 Score: 62.7734 bits (151), Expect = 5.232e-9
Identity = 145/384 (37.76%), Postives = 175/384 (45.57%), Query Frame = 1
Query: 5986 GSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPG-----VIGSLGSQGFPGARGPQGILGSPGPRGRTGS---------KGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPV------------GEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
            G  G  G PG+ G+ G PG  G+ G+ G  G  G+KGD G  G PG  G  G  G +G  G+ G  G  G  G +G  G PGL G  G     V G  GS GFPG +G  G+ G PG  G  G          KG  G  G++G PG PG+ G AG  G+PG+ G PG                            PG++  PG  G  GE G PG  G             +GL+G +G PG SG  GLPG+ G  G KGN G  G  G  G  G  G  G  GP+GE G  G  G  G              G  G  G++G  G  G+PG+ GE G  A DG KG+ G  G  G RGPQG +G+   PG  G KG+ G  G
Sbjct:  728 GQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGVGVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPG---------------------------FPGQDGLPGVPGMKGEDGLPGLPGV------------TGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGL---PGVPGFKGETGLPG 1069          

HSP 4 Score: 56.9954 bits (136), Expect = 3.081e-7
Identity = 164/542 (30.26%), Postives = 204/542 (37.64%), Query Frame = 1
Query: 5644 GEPGINGPTGPTG---VPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPR--------------------------------GRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEV-----------------------------------GNAGIRGVNGAPGIPGKDG------------------ENGKDAVDGAKGNIGPIGSSGRRGPQGMTG 7005
            G+PG+ GP GP+G   VPG KG  G+ G  GQ G+ G+ G+ G  G  G QG  G+PG+ G  G PG  G +G+PG  G+ GR G  G PG                   +G LG  G  G  G PG DG+ G PG  GD G+ G+ G  G +G  G  G  G +G  G  G  G  G  G  G+ G  G  G  G PG  G PG+ G  G  GFPG  G +G+ G  G +                                G  G  G +G  G++G+PG PG  G++G  G                                           PG +G LG  G PGK                G  G  G PG  GQ G+PG  G  G  G  G  G  G PG+ G+ G  G  G +GE G  G  G  G  GE                                    G  G+ G+ GAPG+ G+ G                  + G D   GA G  G  G  G  G  G+ G
Sbjct: 1042 GQPGLRGPQGPSGLPGVPGFKGETGLPG-YGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPG------------------QKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGF------------------------------------------PGAKGDLGANGIPGKR---------------GEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGLRGEKGMPGLDGPPGNDGPPGLPGQRGNDGYPGAPGLSGEKGMGGLPGFPGLDG 1507          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Fly
Match: vkg (gene:FBgn0016075 transcript:FBtr0333541)

HSP 1 Score: 113.235 bits (282), Expect = 3.448e-24
Identity = 206/567 (36.33%), Postives = 259/567 (45.68%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGI---DGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPG------LRGNPGVIGSLGSQGFPGARGPQGILGS--------------PGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPY-----GKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGE------------VGNAGIRGVNGAPGIP------GKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGP---PGSIGL---KGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGP 7188
            GE G+ G   P    G +GP G +GD G  G  G  G +G  G  G QG  G PGR G  G PGP G  G PG  G +G         ++      G  G  G+ G +G  G  G  G+DG  GS G+RG  G+ GD G AG    DG  G  G  G  G    + +    G  G  GI GE G  GD G  G  G P         G PG  G  G +G  GA+G QG +G               PGP G  G  G  G  G  G PG PG+DG+ G  G                                   G  G+   PG +   GE GPPG+SG  G PG+VG PGQ GL G  GP G  G++G  G+ G +G  GNKG +G +     G  G  G NG   P G +G+ G++G+ G+ G  G             +GNAG++G+ G+PGIP      G+ GE G+   +G +G+IGP G +G  GP+G++G  GP   PG+ GL   KG+ G+ G  GR G  G+    GI G  G  G  G  G PG PG  G  GP
Sbjct:  519 GEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAG----PDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDG---------------------------------GIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGP 1048          

HSP 2 Score: 96.2857 bits (238), Expect = 4.966e-19
Identity = 193/575 (33.57%), Postives = 236/575 (41.04%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGR------RGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKT----------------------XXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTG-----SKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGK--------DA----VDGAKGNIGPIGSSG-----------RRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKG---LPGNPGTPGVIGPQ 7191
            GE G+ GP G  G PG KG  G  GD     +   DG+ G +G +G  GP G PGR      RG  G PG  G  G PG +G+ G P                           G  GI G  G  G+PG  G +G  GE G     G+DG +G  GD G                               R   RG  G++G+ GE G +GD+GP+G  G PG +G  G IG  G  GF GA G +G  G  GPRG  G      KG +G  G+ G  G PG  G+ G  G                                     PG+N   GP G +G RGP                    +QGP GP G+ G  G PG NG  G  G KG  G  G+ G  G++G +      G  GD+G+ G QG   E G  G +G  G PG+PGK+G  G         DA    +DG  G +GP G  G            RG  G+ G QG  G  G  G IG  G  G +G  G  G+ G  G  GP+G +GDKG   L G PG  G+ GPQ
Sbjct: 1026 GESGLTGPIGYPGAPGAKGQRGPVGDS----QPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYP---------------------------GRNGINGLKGATGFPGPQGPKGPQGESG---VVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPG------------------------------------PPGEN---GPNGAIGHRGPQ-------------------IQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYA----IVGRQGDIGDIGFQG---EPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPGLRGLPGPQ 1501          

HSP 3 Score: 91.6633 bits (226), Expect = 1.141e-17
Identity = 185/521 (35.51%), Postives = 230/521 (44.15%), Query Frame = 1
Query: 5659 NGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSD------GKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXX--------XXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSP---GLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGS------QGTIGIAGVPGTPGKDGKAGQVG-------IXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQG---PLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPS--GTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQ-----GPVGEVGNAGIRGVNGAPGI---------PGKDGENGKD--AVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMG 7068
            NG   P G  G KG +G  G  GQ G  G  G  G RG LG  G  G PG  G  G PG +G  G  G  G +GR                G  GP G  G  G  G+ G  G DGYPG++      G+ G PG  G PG  G+   SG+KGD G++G  G         +  +          + G  G KG++G  GP+G P   GL+G  G  G  G QG PG  G +G+ G PG  G  G KG+      QG  G  G  G  G DG+ GQ+G       I  +     +                 +    GF G  G   + G QG   P+G  GPPG  G+ G  G  G  G  G +G  G  G+ G RG PG   P+  G +G  G  G  G+PG  G  GA GP G  G NG +G+ G Q     GP G+VG  G  G NG  G+          G+ GE G+   A+ G +G+IG IG  G  G  G  G QG PG  G  G +G+ GP G
Sbjct:  887 NGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGR---------------QGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRG 1392          

HSP 4 Score: 88.5817 bits (218), Expect = 9.811e-17
Identity = 170/500 (34.00%), Postives = 216/500 (43.20%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGA--PGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGS---------IGQDGYPGSDGKRGAPGEHGDPGKAGIDG---PSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGD--IGPMGPSGSP---------GLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNA--GIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
            TGEPG +G TGP GV G KG               + G +G RG +G +GP G   PG  G  G PGP G+ G  G  G+ GR G  G                       GG+G KG           G+ G PG  G +G PG+ G PG+ G+ G   P GVKG+ G  G  G++G  G +            G +GD  +GP GP G P         G +G  G +GSLG  G  GA+G  G  G  G  G  G +G  G+ GI G+PG  G+ G+ G++G                                      G+    GP+GP GE GP G                SG  GP G PG +G  G  G  G  G  G  G+KG     GI GD+G SG  GP G  G  G  G++GPVG+   A  G+ G  G  G PG +G  G+  + G +G+ G  G  GR G  G  G+ G PG  G+ G  G+TG
Sbjct:  721 TGEPGEDGYTGPKGVKGAKG---------------EQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGL---------------------DGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNK------------GQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYN------------------------------------GRQGDIGPRGPNGEFGPKG---------------LSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATG 1121          

HSP 5 Score: 83.1889 bits (204), Expect = 5.135e-15
Identity = 168/455 (36.92%), Postives = 207/455 (45.49%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILG---PRGNLGPQGPTGAPGRRGTVGSPGPVGNA-------GHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPG-----EHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPS--GSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGS-----QGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQ---PGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGL--PGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGK 6927
            G  GING  G TG PG +GP G +G+ G  G  G++G +G   PRG +G QG  G  G  G VG PG + N        G  G QG+ G  G QG+ G  G  G PG +G  G+ G  G LG  G+ G  G+ G  G RG PG     E GD G AG+DG +G  G  G+ G PG  G               E G  G IG  GP   G PG +G+ G  G+ G  G  G  GP+G LG  G +G  G  G      QG IG  G  G PG DG  G+ G PG                                  PGKN +   PGP+GP G+ G  G  G              GL GP G PG +    +  PG  G  G  G +G +G  G PG+ G  G  G  G RG+ G++G TG  GP G+ G+ G  G+ GAPG+ G  G  G+
Sbjct: 1109 GRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPG---------------ENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPG---------------------------------LPGKNGRVGAPGPRGPTGDAGWGGIDG------------MDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPGLRGLPGPQGE 1503          

HSP 6 Score: 81.2629 bits (199), Expect = 1.665e-14
Identity = 176/538 (32.71%), Postives = 210/538 (39.03%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGP-----------------QGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGN------KGSKGPYGKPGIAG---DNGASGPQGPRG-----------------------EN-----------GDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMT--GIQGPPGSIGLKGDIGSTGPMGR 7071
            G PG  G  G  G+ G  GP GVKG++G  G +G+ G+ G +G  G                  Q P GA G++G VGS G  G  G  G  G SGR                               G+ G+ G  G PGS G  G PG  G+ G+ G  G +G +GD G  G  G                  E G KG  G  GP G PG  G PG  G  G+ GFPG  G +G+    G +G  G  G  G IG  G PG  G+ G  G                         P  DG  G  G  G+PG N  PG  G  G+RG  G                 G QG  G PG  G  G PG NG +G KG       +G KGP G+ G+ G    NG  G QGPRG                       EN           GD G  GE+G  G++G  G  G  GA G  G  G  G+   DGA+G  G  G  G RGP G+T    +G  G  GL G  G  G  G+
Sbjct:  826 GFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRR------------------------------GLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNG------------------EFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGD----------------------SQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRG---------------LPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQ 1278          

HSP 7 Score: 78.1814 bits (191), Expect = 1.609e-13
Identity = 179/539 (33.21%), Postives = 230/539 (42.67%), Query Frame = 1
Query: 5653 GINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISG---------RXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPG--EHGDPG---------------KAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPG----------------LRGNPGVIGSLGSQGFPGAR------------GPQGILGSPGPRGRTGSKGSQGTIGIA---GVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKG---------NIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGR 7071
            G  G  G  G+PG +G +G  G++G+ G+ G+ G  G +G  G  G TGA G  G+ G  G  G  G PGVQG +G              G  G QG  G PG +GP G  G  G  G  G  GQ G PG +G RG PG  E G+ G               +AG+ G  G+ G+PG+       G +G  G  G  G+ G  G +G++G  G  G PG                 RG PG  G  G +G PG +            GP+G  G  G  G  GS G++G IG+    GV G  G  G+AG  G+                                    PG    PG  G +G  GP GK+ + G          S  +G IG  G+SG RG  G +G  G  G+ GSKG  G+ G  GD G +G QG  GE G  G  G  G         + G  G  GI G+ G++G     G KG         N G  G  G  GP+G+ G +G  G+IGL+G+IG  GP G 
Sbjct:  271 GEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQN----VVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGL------------------------------------PGPAGIPGEPGKVGAAGPDGKAIEVG----------SLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGE 759          

HSP 8 Score: 70.4774 bits (171), Expect = 3.692e-11
Identity = 189/561 (33.69%), Postives = 231/561 (41.18%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGV------PGMKGPLGVKGD------------KGQRGRMGKDGILGPRGNLGPQGPTGAPGR--RGTVGS---------PGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGI-------------------------DGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGD------IGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVP---GTPGKDGKAGQVGIXXXXX--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGP---YGKPGIAGDNGASGPQGPRGENGDL------GNTGEQGPVGEV-----------GNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSS---GRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
            TG PG+ G  GP G+        + GP+G +GD             G+ GR G  G+ G  G+ G  G  G PGR  RG  G           GP G AG PG  G+ G                            Q  +G KG  G +G PG +G RG  GE G PG  G+                         DG +G++G PG                        E G +GD       GP GP G  G  G PG  G+ G+ G  G RG QG+ G+P   GR G KG  G  GI G P   G  G DGKA +VG   K      G  G  G  G  G  G+DG  G  G  G  G+    G  G  G  G PG+ G DG PG      +  L   IG PG  G +G  G +G +G KG KG   P   Y   G  G++G +GP+G +G  G+       G  G++GP GEV           G  G  G  GAPG+PG+DGE G D   G KG  G  G     G  GP G +GI+G PG +G  G  G  G
Sbjct:  336 TGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGE-------------------------PGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPG------------------------EKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNP---GRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYL---IGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAG 841          

HSP 9 Score: 68.9366 bits (167), Expect = 1.038e-10
Identity = 108/295 (36.61%), Postives = 138/295 (46.78%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAP---GRRGTVGSPGPV---GNAGHPGVQGISGRXXXXXXXX--XXXXXXXXXXXXXXXXXXSQGGLGIKG------------------SIGQDGYPGSDGKRGAPGEHGDPGKAG--------IDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGI 6423
             G PG+ GP G  G PG  GPLG KGD G+ G  G+ G    RG++GP+G  G P   G+ G  G+PGP    G  G PG+QG SG PG  G  G   +     P     EG   S+G  G +G                  S G  GY G  G++G PG  G  G  G        + GP G KG+PG +           +     +G  G +G +GD GP GP+G  G  G  G+ G+ G  G PG RG  G  G PG  G  G KG+ G  G  G+ G+PG+ G+ G  G+
Sbjct:   53 IGVPGLEGPAGDIGPPGRAGPLGEKGDVGEYGEQGEKGH---RGDIGPKGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDS------LSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGM 338          

HSP 10 Score: 63.1586 bits (152), Expect = 6.152e-9
Identity = 177/536 (33.02%), Postives = 211/536 (39.37%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGV-----PGMKGPLGVKGDKGQR---------GRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGD------PGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPG------LRGNPGVIGSLGSQGFPGARGPQG--ILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGN-------------SGQRGLPGSNGPSGTKGNKGSK------------GPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGA--------KGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMG 7068
            G+PG+ GP G TG        + GP G KG+ G              G  G +G +G+ GPQGPTG  G  G  G PG  G  G PG +G  G+ G                          G  G KG  G  G+ G+DG  G+PGE G+      PG  G  GP G+  DP  T +                     +GS+GDIGP G  G PG       RG  G+ G  G  G  G+RGP G    G  G  G  G  G QG  G AG+PG  G  G+ GQ  +  K                                 PG N QPG +G  G+RG                  + GL G  G PG               G RGLPG +G +G +G  G K            GP G  G  GD G  G  G RG  G  G  G QG  G  G AG +G+ G  GIPG+ G+ G    DG         KG IG  G SG RG  G  G +G  GS G KG+ G TG  G
Sbjct:  206 GDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDG------------------------EPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIY-DPSLTKSLPGP-----------------IGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKG-------------------------------EPGLNGQPGLEGYRGDRG------------------EVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRG 650          

HSP 11 Score: 56.225 bits (134), Expect = 6.618e-7
Identity = 207/617 (33.55%), Postives = 247/617 (40.03%), Query Frame = 1
Query: 5662 GPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGD---PGKAGIDG-----------PSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXE---LGSKGDIGPMGPSGS--------------PGLRGNPG------------VIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGN---------------SGQRGLPGSNGPSGTKGNKGSKGPYGKP--GIAGDN---------------GASGPQGPRGENGD--LGNTGEQGPVGEVGNAGIRGVNGAPGIPG----------------------------KDGENGKDAVDGAKGNIG---PIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGP 7188
            G  GP GVPG++GP    GD G  GR G    LG +G++G  G  G  G RG +G   P G  G+PG+ G SG P                           G  G +G  G DG PG  G  GAPG++G    PGK G  G             G KG+ G+TG PG  G  G  G RG++G  G     G KGD G  GP G               PG +G PG            + G  G  G  G  GPQG  G  G  GR G  G++G IG  G  G PGKDG+ G+ G                          G  G  G+ G  G +  PG +G  G  G PG  G  G PG   P     L GPIG  G+                G+RG  G  G SG  G  GS+GP G+   G AGD                G  G  G  GE G   +G  GE G  G+ G  G RG  G  G+PG                             DG NG   + G KG  G   P+ ++G RGP+G  G  G PGS G +G IG TGP G      + G  G  G  G +G  G  G+PG PG  G  GP
Sbjct:   48 GAPGPIGVPGLEGP---AGDIGPPGRAGP---LGEKGDVGEYGEQGEKGHRGDIG---PKGEMGYPGIMGKSGEP---------------------------GTPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFG------------------------DKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRG------VQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGP 598          

HSP 12 Score: 55.8398 bits (133), Expect = 9.339e-7
Identity = 80/177 (45.20%), Postives = 91/177 (51.41%), Query Frame = 1
Query: 6715 GTKGNKGSKGPYGKPGI---AGDNGASGPQGPRGENGDLGNTGEQG---------PVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPG--------SIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIG 7185
            G KG  G+ GP G PG+   AGD G  G  GP GE GD+G  GEQG         P GE+G  GI G +G PG PG  G +G D   G +G  G  G +G RGP G  G QGPPG        S G KG+ G TG  G +G PG  G  G  G  G  G  G+KG PG PG  G  G
Sbjct:   42 GIKGRMGAPGPIGVPGLEGPAGDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTG 218          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Fly
Match: vkg (gene:FBgn0016075 transcript:FBtr0079036)

HSP 1 Score: 113.235 bits (282), Expect = 3.448e-24
Identity = 206/567 (36.33%), Postives = 259/567 (45.68%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGI---DGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPG------LRGNPGVIGSLGSQGFPGARGPQGILGS--------------PGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPY-----GKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGE------------VGNAGIRGVNGAPGIP------GKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGP---PGSIGL---KGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGP 7188
            GE G+ G   P    G +GP G +GD G  G  G  G +G  G  G QG  G PGR G  G PGP G  G PG  G +G         ++      G  G  G+ G +G  G  G  G+DG  GS G+RG  G+ GD G AG    DG  G  G  G  G    + +    G  G  GI GE G  GD G  G  G P         G PG  G  G +G  GA+G QG +G               PGP G  G  G  G  G  G PG PG+DG+ G  G                                   G  G+   PG +   GE GPPG+SG  G PG+VG PGQ GL G  GP G  G++G  G+ G +G  GNKG +G +     G  G  G NG   P G +G+ G++G+ G+ G  G             +GNAG++G+ G+PGIP      G+ GE G+   +G +G+IGP G +G  GP+G++G  GP   PG+ GL   KG+ G+ G  GR G  G+    GI G  G  G  G  G PG PG  G  GP
Sbjct:  519 GEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAG----PDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDG---------------------------------GIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGP 1048          

HSP 2 Score: 96.2857 bits (238), Expect = 4.966e-19
Identity = 193/575 (33.57%), Postives = 236/575 (41.04%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGR------RGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKT----------------------XXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTG-----SKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGK--------DA----VDGAKGNIGPIGSSG-----------RRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKG---LPGNPGTPGVIGPQ 7191
            GE G+ GP G  G PG KG  G  GD     +   DG+ G +G +G  GP G PGR      RG  G PG  G  G PG +G+ G P                           G  GI G  G  G+PG  G +G  GE G     G+DG +G  GD G                               R   RG  G++G+ GE G +GD+GP+G  G PG +G  G IG  G  GF GA G +G  G  GPRG  G      KG +G  G+ G  G PG  G+ G  G                                     PG+N   GP G +G RGP                    +QGP GP G+ G  G PG NG  G  G KG  G  G+ G  G++G +      G  GD+G+ G QG   E G  G +G  G PG+PGK+G  G         DA    +DG  G +GP G  G            RG  G+ G QG  G  G  G IG  G  G +G  G  G+ G  G  GP+G +GDKG   L G PG  G+ GPQ
Sbjct: 1026 GESGLTGPIGYPGAPGAKGQRGPVGDS----QPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYP---------------------------GRNGINGLKGATGFPGPQGPKGPQGESG---VVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPG------------------------------------PPGEN---GPNGAIGHRGPQ-------------------IQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYA----IVGRQGDIGDIGFQG---EPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPGLRGLPGPQ 1501          

HSP 3 Score: 91.6633 bits (226), Expect = 1.141e-17
Identity = 185/521 (35.51%), Postives = 230/521 (44.15%), Query Frame = 1
Query: 5659 NGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSD------GKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXX--------XXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSP---GLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGS------QGTIGIAGVPGTPGKDGKAGQVG-------IXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQG---PLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPS--GTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQ-----GPVGEVGNAGIRGVNGAPGI---------PGKDGENGKD--AVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMG 7068
            NG   P G  G KG +G  G  GQ G  G  G  G RG LG  G  G PG  G  G PG +G  G  G  G +GR                G  GP G  G  G  G+ G  G DGYPG++      G+ G PG  G PG  G+   SG+KGD G++G  G         +  +          + G  G KG++G  GP+G P   GL+G  G  G  G QG PG  G +G+ G PG  G  G KG+      QG  G  G  G  G DG+ GQ+G       I  +     +                 +    GF G  G   + G QG   P+G  GPPG  G+ G  G  G  G  G +G  G  G+ G RG PG   P+  G +G  G  G  G+PG  G  GA GP G  G NG +G+ G Q     GP G+VG  G  G NG  G+          G+ GE G+   A+ G +G+IG IG  G  G  G  G QG PG  G  G +G+ GP G
Sbjct:  887 NGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGR---------------QGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRG 1392          

HSP 4 Score: 88.5817 bits (218), Expect = 9.811e-17
Identity = 170/500 (34.00%), Postives = 216/500 (43.20%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGA--PGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGS---------IGQDGYPGSDGKRGAPGEHGDPGKAGIDG---PSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGD--IGPMGPSGSP---------GLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNA--GIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
            TGEPG +G TGP GV G KG               + G +G RG +G +GP G   PG  G  G PGP G+ G  G  G+ GR G  G                       GG+G KG           G+ G PG  G +G PG+ G PG+ G+ G   P GVKG+ G  G  G++G  G +            G +GD  +GP GP G P         G +G  G +GSLG  G  GA+G  G  G  G  G  G +G  G+ GI G+PG  G+ G+ G++G                                      G+    GP+GP GE GP G                SG  GP G PG +G  G  G  G  G  G  G+KG     GI GD+G SG  GP G  G  G  G++GPVG+   A  G+ G  G  G PG +G  G+  + G +G+ G  G  GR G  G  G+ G PG  G+ G  G+TG
Sbjct:  721 TGEPGEDGYTGPKGVKGAKG---------------EQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGL---------------------DGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNK------------GQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYN------------------------------------GRQGDIGPRGPNGEFGPKG---------------LSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATG 1121          

HSP 5 Score: 83.1889 bits (204), Expect = 5.135e-15
Identity = 168/455 (36.92%), Postives = 207/455 (45.49%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILG---PRGNLGPQGPTGAPGRRGTVGSPGPVGNA-------GHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPG-----EHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPS--GSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGS-----QGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQ---PGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGL--PGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGK 6927
            G  GING  G TG PG +GP G +G+ G  G  G++G +G   PRG +G QG  G  G  G VG PG + N        G  G QG+ G  G QG+ G  G  G PG +G  G+ G  G LG  G+ G  G+ G  G RG PG     E GD G AG+DG +G  G  G+ G PG  G               E G  G IG  GP   G PG +G+ G  G+ G  G  G  GP+G LG  G +G  G  G      QG IG  G  G PG DG  G+ G PG                                  PGKN +   PGP+GP G+ G  G  G              GL GP G PG +    +  PG  G  G  G +G +G  G PG+ G  G  G  G RG+ G++G TG  GP G+ G+ G  G+ GAPG+ G  G  G+
Sbjct: 1109 GRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPG---------------ENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPG---------------------------------LPGKNGRVGAPGPRGPTGDAGWGGIDG------------MDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPGLRGLPGPQGE 1503          

HSP 6 Score: 81.2629 bits (199), Expect = 1.665e-14
Identity = 176/538 (32.71%), Postives = 210/538 (39.03%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGP-----------------QGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGN------KGSKGPYGKPGIAG---DNGASGPQGPRG-----------------------EN-----------GDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMT--GIQGPPGSIGLKGDIGSTGPMGR 7071
            G PG  G  G  G+ G  GP GVKG++G  G +G+ G+ G +G  G                  Q P GA G++G VGS G  G  G  G  G SGR                               G+ G+ G  G PGS G  G PG  G+ G+ G  G +G +GD G  G  G                  E G KG  G  GP G PG  G PG  G  G+ GFPG  G +G+    G +G  G  G  G IG  G PG  G+ G  G                         P  DG  G  G  G+PG N  PG  G  G+RG  G                 G QG  G PG  G  G PG NG +G KG       +G KGP G+ G+ G    NG  G QGPRG                       EN           GD G  GE+G  G++G  G  G  GA G  G  G  G+   DGA+G  G  G  G RGP G+T    +G  G  GL G  G  G  G+
Sbjct:  826 GFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRR------------------------------GLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNG------------------EFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGD----------------------SQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRG---------------LPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQ 1278          

HSP 7 Score: 78.1814 bits (191), Expect = 1.609e-13
Identity = 179/539 (33.21%), Postives = 230/539 (42.67%), Query Frame = 1
Query: 5653 GINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISG---------RXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPG--EHGDPG---------------KAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPG----------------LRGNPGVIGSLGSQGFPGAR------------GPQGILGSPGPRGRTGSKGSQGTIGIA---GVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKG---------NIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGR 7071
            G  G  G  G+PG +G +G  G++G+ G+ G+ G  G +G  G  G TGA G  G+ G  G  G  G PGVQG +G              G  G QG  G PG +GP G  G  G  G  G  GQ G PG +G RG PG  E G+ G               +AG+ G  G+ G+PG+       G +G  G  G  G+ G  G +G++G  G  G PG                 RG PG  G  G +G PG +            GP+G  G  G  G  GS G++G IG+    GV G  G  G+AG  G+                                    PG    PG  G +G  GP GK+ + G          S  +G IG  G+SG RG  G +G  G  G+ GSKG  G+ G  GD G +G QG  GE G  G  G  G         + G  G  GI G+ G++G     G KG         N G  G  G  GP+G+ G +G  G+IGL+G+IG  GP G 
Sbjct:  271 GEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQN----VVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGL------------------------------------PGPAGIPGEPGKVGAAGPDGKAIEVG----------SLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGE 759          

HSP 8 Score: 70.4774 bits (171), Expect = 3.692e-11
Identity = 189/561 (33.69%), Postives = 231/561 (41.18%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGV------PGMKGPLGVKGD------------KGQRGRMGKDGILGPRGNLGPQGPTGAPGR--RGTVGS---------PGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGI-------------------------DGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGD------IGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVP---GTPGKDGKAGQVGIXXXXX--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGP---YGKPGIAGDNGASGPQGPRGENGDL------GNTGEQGPVGEV-----------GNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSS---GRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
            TG PG+ G  GP G+        + GP+G +GD             G+ GR G  G+ G  G+ G  G  G PGR  RG  G           GP G AG PG  G+ G                            Q  +G KG  G +G PG +G RG  GE G PG  G+                         DG +G++G PG                        E G +GD       GP GP G  G  G PG  G+ G+ G  G RG QG+ G+P   GR G KG  G  GI G P   G  G DGKA +VG   K      G  G  G  G  G  G+DG  G  G  G  G+    G  G  G  G PG+ G DG PG      +  L   IG PG  G +G  G +G +G KG KG   P   Y   G  G++G +GP+G +G  G+       G  G++GP GEV           G  G  G  GAPG+PG+DGE G D   G KG  G  G     G  GP G +GI+G PG +G  G  G  G
Sbjct:  336 TGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGE-------------------------PGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPG------------------------EKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNP---GRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYL---IGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAG 841          

HSP 9 Score: 68.9366 bits (167), Expect = 1.038e-10
Identity = 108/295 (36.61%), Postives = 138/295 (46.78%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAP---GRRGTVGSPGPV---GNAGHPGVQGISGRXXXXXXXX--XXXXXXXXXXXXXXXXXXSQGGLGIKG------------------SIGQDGYPGSDGKRGAPGEHGDPGKAG--------IDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGI 6423
             G PG+ GP G  G PG  GPLG KGD G+ G  G+ G    RG++GP+G  G P   G+ G  G+PGP    G  G PG+QG SG PG  G  G   +     P     EG   S+G  G +G                  S G  GY G  G++G PG  G  G  G        + GP G KG+PG +           +     +G  G +G +GD GP GP+G  G  G  G+ G+ G  G PG RG  G  G PG  G  G KG+ G  G  G+ G+PG+ G+ G  G+
Sbjct:   53 IGVPGLEGPAGDIGPPGRAGPLGEKGDVGEYGEQGEKGH---RGDIGPKGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDS------LSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGM 338          

HSP 10 Score: 63.1586 bits (152), Expect = 6.152e-9
Identity = 177/536 (33.02%), Postives = 211/536 (39.37%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGV-----PGMKGPLGVKGDKGQR---------GRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGD------PGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPG------LRGNPGVIGSLGSQGFPGARGPQG--ILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGN-------------SGQRGLPGSNGPSGTKGNKGSK------------GPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGA--------KGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMG 7068
            G+PG+ GP G TG        + GP G KG+ G              G  G +G +G+ GPQGPTG  G  G  G PG  G  G PG +G  G+ G                          G  G KG  G  G+ G+DG  G+PGE G+      PG  G  GP G+  DP  T +                     +GS+GDIGP G  G PG       RG  G+ G  G  G  G+RGP G    G  G  G  G  G QG  G AG+PG  G  G+ GQ  +  K                                 PG N QPG +G  G+RG                  + GL G  G PG               G RGLPG +G +G +G  G K            GP G  G  GD G  G  G RG  G  G  G QG  G  G AG +G+ G  GIPG+ G+ G    DG         KG IG  G SG RG  G  G +G  GS G KG+ G TG  G
Sbjct:  206 GDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDG------------------------EPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIY-DPSLTKSLPGP-----------------IGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKG-------------------------------EPGLNGQPGLEGYRGDRG------------------EVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRG 650          

HSP 11 Score: 56.225 bits (134), Expect = 6.618e-7
Identity = 207/617 (33.55%), Postives = 247/617 (40.03%), Query Frame = 1
Query: 5662 GPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGD---PGKAGIDG-----------PSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXE---LGSKGDIGPMGPSGS--------------PGLRGNPG------------VIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGN---------------SGQRGLPGSNGPSGTKGNKGSKGPYGKP--GIAGDN---------------GASGPQGPRGENGD--LGNTGEQGPVGEVGNAGIRGVNGAPGIPG----------------------------KDGENGKDAVDGAKGNIG---PIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGP 7188
            G  GP GVPG++GP    GD G  GR G    LG +G++G  G  G  G RG +G   P G  G+PG+ G SG P                           G  G +G  G DG PG  G  GAPG++G    PGK G  G             G KG+ G+TG PG  G  G  G RG++G  G     G KGD G  GP G               PG +G PG            + G  G  G  G  GPQG  G  G  GR G  G++G IG  G  G PGKDG+ G+ G                          G  G  G+ G  G +  PG +G  G  G PG  G  G PG   P     L GPIG  G+                G+RG  G  G SG  G  GS+GP G+   G AGD                G  G  G  GE G   +G  GE G  G+ G  G RG  G  G+PG                             DG NG   + G KG  G   P+ ++G RGP+G  G  G PGS G +G IG TGP G      + G  G  G  G +G  G  G+PG PG  G  GP
Sbjct:   48 GAPGPIGVPGLEGP---AGDIGPPGRAGP---LGEKGDVGEYGEQGEKGHRGDIG---PKGEMGYPGIMGKSGEP---------------------------GTPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFG------------------------DKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRG------VQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGP 598          

HSP 12 Score: 55.8398 bits (133), Expect = 9.339e-7
Identity = 80/177 (45.20%), Postives = 91/177 (51.41%), Query Frame = 1
Query: 6715 GTKGNKGSKGPYGKPGI---AGDNGASGPQGPRGENGDLGNTGEQG---------PVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPG--------SIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIG 7185
            G KG  G+ GP G PG+   AGD G  G  GP GE GD+G  GEQG         P GE+G  GI G +G PG PG  G +G D   G +G  G  G +G RGP G  G QGPPG        S G KG+ G TG  G +G PG  G  G  G  G  G  G+KG PG PG  G  G
Sbjct:   42 GIKGRMGAPGPIGVPGLEGPAGDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTG 218          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Fly
Match: vkg (gene:FBgn0016075 transcript:FBtr0333540)

HSP 1 Score: 113.235 bits (282), Expect = 3.448e-24
Identity = 206/567 (36.33%), Postives = 259/567 (45.68%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGI---DGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPG------LRGNPGVIGSLGSQGFPGARGPQGILGS--------------PGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPY-----GKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGE------------VGNAGIRGVNGAPGIP------GKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGP---PGSIGL---KGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGP 7188
            GE G+ G   P    G +GP G +GD G  G  G  G +G  G  G QG  G PGR G  G PGP G  G PG  G +G         ++      G  G  G+ G +G  G  G  G+DG  GS G+RG  G+ GD G AG    DG  G  G  G  G    + +    G  G  GI GE G  GD G  G  G P         G PG  G  G +G  GA+G QG +G               PGP G  G  G  G  G  G PG PG+DG+ G  G                                   G  G+   PG +   GE GPPG+SG  G PG+VG PGQ GL G  GP G  G++G  G+ G +G  GNKG +G +     G  G  G NG   P G +G+ G++G+ G+ G  G             +GNAG++G+ G+PGIP      G+ GE G+   +G +G+IGP G +G  GP+G++G  GP   PG+ GL   KG+ G+ G  GR G  G+    GI G  G  G  G  G PG PG  G  GP
Sbjct:  519 GEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAG----PDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDG---------------------------------GIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGP 1048          

HSP 2 Score: 96.2857 bits (238), Expect = 4.966e-19
Identity = 193/575 (33.57%), Postives = 236/575 (41.04%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGR------RGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKT----------------------XXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTG-----SKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGK--------DA----VDGAKGNIGPIGSSG-----------RRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKG---LPGNPGTPGVIGPQ 7191
            GE G+ GP G  G PG KG  G  GD     +   DG+ G +G +G  GP G PGR      RG  G PG  G  G PG +G+ G P                           G  GI G  G  G+PG  G +G  GE G     G+DG +G  GD G                               R   RG  G++G+ GE G +GD+GP+G  G PG +G  G IG  G  GF GA G +G  G  GPRG  G      KG +G  G+ G  G PG  G+ G  G                                     PG+N   GP G +G RGP                    +QGP GP G+ G  G PG NG  G  G KG  G  G+ G  G++G +      G  GD+G+ G QG   E G  G +G  G PG+PGK+G  G         DA    +DG  G +GP G  G            RG  G+ G QG  G  G  G IG  G  G +G  G  G+ G  G  GP+G +GDKG   L G PG  G+ GPQ
Sbjct: 1026 GESGLTGPIGYPGAPGAKGQRGPVGDS----QPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYP---------------------------GRNGINGLKGATGFPGPQGPKGPQGESG---VVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPG------------------------------------PPGEN---GPNGAIGHRGPQ-------------------IQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYA----IVGRQGDIGDIGFQG---EPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPGLRGLPGPQ 1501          

HSP 3 Score: 91.6633 bits (226), Expect = 1.141e-17
Identity = 185/521 (35.51%), Postives = 230/521 (44.15%), Query Frame = 1
Query: 5659 NGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSD------GKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXX--------XXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSP---GLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGS------QGTIGIAGVPGTPGKDGKAGQVG-------IXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQG---PLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPS--GTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQ-----GPVGEVGNAGIRGVNGAPGI---------PGKDGENGKD--AVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMG 7068
            NG   P G  G KG +G  G  GQ G  G  G  G RG LG  G  G PG  G  G PG +G  G  G  G +GR                G  GP G  G  G  G+ G  G DGYPG++      G+ G PG  G PG  G+   SG+KGD G++G  G         +  +          + G  G KG++G  GP+G P   GL+G  G  G  G QG PG  G +G+ G PG  G  G KG+      QG  G  G  G  G DG+ GQ+G       I  +     +                 +    GF G  G   + G QG   P+G  GPPG  G+ G  G  G  G  G +G  G  G+ G RG PG   P+  G +G  G  G  G+PG  G  GA GP G  G NG +G+ G Q     GP G+VG  G  G NG  G+          G+ GE G+   A+ G +G+IG IG  G  G  G  G QG PG  G  G +G+ GP G
Sbjct:  887 NGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGR---------------QGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRG 1392          

HSP 4 Score: 88.5817 bits (218), Expect = 9.811e-17
Identity = 170/500 (34.00%), Postives = 216/500 (43.20%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGA--PGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGS---------IGQDGYPGSDGKRGAPGEHGDPGKAGIDG---PSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGD--IGPMGPSGSP---------GLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNA--GIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
            TGEPG +G TGP GV G KG               + G +G RG +G +GP G   PG  G  G PGP G+ G  G  G+ GR G  G                       GG+G KG           G+ G PG  G +G PG+ G PG+ G+ G   P GVKG+ G  G  G++G  G +            G +GD  +GP GP G P         G +G  G +GSLG  G  GA+G  G  G  G  G  G +G  G+ GI G+PG  G+ G+ G++G                                      G+    GP+GP GE GP G                SG  GP G PG +G  G  G  G  G  G  G+KG     GI GD+G SG  GP G  G  G  G++GPVG+   A  G+ G  G  G PG +G  G+  + G +G+ G  G  GR G  G  G+ G PG  G+ G  G+TG
Sbjct:  721 TGEPGEDGYTGPKGVKGAKG---------------EQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGL---------------------DGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNK------------GQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYN------------------------------------GRQGDIGPRGPNGEFGPKG---------------LSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATG 1121          

HSP 5 Score: 83.1889 bits (204), Expect = 5.135e-15
Identity = 168/455 (36.92%), Postives = 207/455 (45.49%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILG---PRGNLGPQGPTGAPGRRGTVGSPGPVGNA-------GHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPG-----EHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPS--GSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGS-----QGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQ---PGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGL--PGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGK 6927
            G  GING  G TG PG +GP G +G+ G  G  G++G +G   PRG +G QG  G  G  G VG PG + N        G  G QG+ G  G QG+ G  G  G PG +G  G+ G  G LG  G+ G  G+ G  G RG PG     E GD G AG+DG +G  G  G+ G PG  G               E G  G IG  GP   G PG +G+ G  G+ G  G  G  GP+G LG  G +G  G  G      QG IG  G  G PG DG  G+ G PG                                  PGKN +   PGP+GP G+ G  G  G              GL GP G PG +    +  PG  G  G  G +G +G  G PG+ G  G  G  G RG+ G++G TG  GP G+ G+ G  G+ GAPG+ G  G  G+
Sbjct: 1109 GRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPG---------------ENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPG---------------------------------LPGKNGRVGAPGPRGPTGDAGWGGIDG------------MDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPGLRGLPGPQGE 1503          

HSP 6 Score: 81.2629 bits (199), Expect = 1.665e-14
Identity = 176/538 (32.71%), Postives = 210/538 (39.03%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGP-----------------QGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGN------KGSKGPYGKPGIAG---DNGASGPQGPRG-----------------------EN-----------GDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMT--GIQGPPGSIGLKGDIGSTGPMGR 7071
            G PG  G  G  G+ G  GP GVKG++G  G +G+ G+ G +G  G                  Q P GA G++G VGS G  G  G  G  G SGR                               G+ G+ G  G PGS G  G PG  G+ G+ G  G +G +GD G  G  G                  E G KG  G  GP G PG  G PG  G  G+ GFPG  G +G+    G +G  G  G  G IG  G PG  G+ G  G                         P  DG  G  G  G+PG N  PG  G  G+RG  G                 G QG  G PG  G  G PG NG +G KG       +G KGP G+ G+ G    NG  G QGPRG                       EN           GD G  GE+G  G++G  G  G  GA G  G  G  G+   DGA+G  G  G  G RGP G+T    +G  G  GL G  G  G  G+
Sbjct:  826 GFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRR------------------------------GLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNG------------------EFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGD----------------------SQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRG---------------LPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQ 1278          

HSP 7 Score: 78.1814 bits (191), Expect = 1.609e-13
Identity = 179/539 (33.21%), Postives = 230/539 (42.67%), Query Frame = 1
Query: 5653 GINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISG---------RXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPG--EHGDPG---------------KAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPG----------------LRGNPGVIGSLGSQGFPGAR------------GPQGILGSPGPRGRTGSKGSQGTIGIA---GVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKG---------NIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGR 7071
            G  G  G  G+PG +G +G  G++G+ G+ G+ G  G +G  G  G TGA G  G+ G  G  G  G PGVQG +G              G  G QG  G PG +GP G  G  G  G  G  GQ G PG +G RG PG  E G+ G               +AG+ G  G+ G+PG+       G +G  G  G  G+ G  G +G++G  G  G PG                 RG PG  G  G +G PG +            GP+G  G  G  G  GS G++G IG+    GV G  G  G+AG  G+                                    PG    PG  G +G  GP GK+ + G          S  +G IG  G+SG RG  G +G  G  G+ GSKG  G+ G  GD G +G QG  GE G  G  G  G         + G  G  GI G+ G++G     G KG         N G  G  G  GP+G+ G +G  G+IGL+G+IG  GP G 
Sbjct:  271 GEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQN----VVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGL------------------------------------PGPAGIPGEPGKVGAAGPDGKAIEVG----------SLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGE 759          

HSP 8 Score: 70.4774 bits (171), Expect = 3.692e-11
Identity = 189/561 (33.69%), Postives = 231/561 (41.18%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGV------PGMKGPLGVKGD------------KGQRGRMGKDGILGPRGNLGPQGPTGAPGR--RGTVGS---------PGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGI-------------------------DGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGD------IGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVP---GTPGKDGKAGQVGIXXXXX--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGP---YGKPGIAGDNGASGPQGPRGENGDL------GNTGEQGPVGEV-----------GNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSS---GRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
            TG PG+ G  GP G+        + GP+G +GD             G+ GR G  G+ G  G+ G  G  G PGR  RG  G           GP G AG PG  G+ G                            Q  +G KG  G +G PG +G RG  GE G PG  G+                         DG +G++G PG                        E G +GD       GP GP G  G  G PG  G+ G+ G  G RG QG+ G+P   GR G KG  G  GI G P   G  G DGKA +VG   K      G  G  G  G  G  G+DG  G  G  G  G+    G  G  G  G PG+ G DG PG      +  L   IG PG  G +G  G +G +G KG KG   P   Y   G  G++G +GP+G +G  G+       G  G++GP GEV           G  G  G  GAPG+PG+DGE G D   G KG  G  G     G  GP G +GI+G PG +G  G  G  G
Sbjct:  336 TGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGE-------------------------PGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPG------------------------EKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNP---GRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYL---IGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAG 841          

HSP 9 Score: 68.9366 bits (167), Expect = 1.038e-10
Identity = 108/295 (36.61%), Postives = 138/295 (46.78%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAP---GRRGTVGSPGPV---GNAGHPGVQGISGRXXXXXXXX--XXXXXXXXXXXXXXXXXXSQGGLGIKG------------------SIGQDGYPGSDGKRGAPGEHGDPGKAG--------IDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGI 6423
             G PG+ GP G  G PG  GPLG KGD G+ G  G+ G    RG++GP+G  G P   G+ G  G+PGP    G  G PG+QG SG PG  G  G   +     P     EG   S+G  G +G                  S G  GY G  G++G PG  G  G  G        + GP G KG+PG +           +     +G  G +G +GD GP GP+G  G  G  G+ G+ G  G PG RG  G  G PG  G  G KG+ G  G  G+ G+PG+ G+ G  G+
Sbjct:   53 IGVPGLEGPAGDIGPPGRAGPLGEKGDVGEYGEQGEKGH---RGDIGPKGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDS------LSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGM 338          

HSP 10 Score: 63.1586 bits (152), Expect = 6.152e-9
Identity = 177/536 (33.02%), Postives = 211/536 (39.37%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGV-----PGMKGPLGVKGDKGQR---------GRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGD------PGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPG------LRGNPGVIGSLGSQGFPGARGPQG--ILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGN-------------SGQRGLPGSNGPSGTKGNKGSK------------GPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGA--------KGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMG 7068
            G+PG+ GP G TG        + GP G KG+ G              G  G +G +G+ GPQGPTG  G  G  G PG  G  G PG +G  G+ G                          G  G KG  G  G+ G+DG  G+PGE G+      PG  G  GP G+  DP  T +                     +GS+GDIGP G  G PG       RG  G+ G  G  G  G+RGP G    G  G  G  G  G QG  G AG+PG  G  G+ GQ  +  K                                 PG N QPG +G  G+RG                  + GL G  G PG               G RGLPG +G +G +G  G K            GP G  G  GD G  G  G RG  G  G  G QG  G  G AG +G+ G  GIPG+ G+ G    DG         KG IG  G SG RG  G  G +G  GS G KG+ G TG  G
Sbjct:  206 GDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDG------------------------EPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIY-DPSLTKSLPGP-----------------IGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKG-------------------------------EPGLNGQPGLEGYRGDRG------------------EVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRG 650          

HSP 11 Score: 56.225 bits (134), Expect = 6.618e-7
Identity = 207/617 (33.55%), Postives = 247/617 (40.03%), Query Frame = 1
Query: 5662 GPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGD---PGKAGIDG-----------PSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXE---LGSKGDIGPMGPSGS--------------PGLRGNPG------------VIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGN---------------SGQRGLPGSNGPSGTKGNKGSKGPYGKP--GIAGDN---------------GASGPQGPRGENGD--LGNTGEQGPVGEVGNAGIRGVNGAPGIPG----------------------------KDGENGKDAVDGAKGNIG---PIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGP 7188
            G  GP GVPG++GP    GD G  GR G    LG +G++G  G  G  G RG +G   P G  G+PG+ G SG P                           G  G +G  G DG PG  G  GAPG++G    PGK G  G             G KG+ G+TG PG  G  G  G RG++G  G     G KGD G  GP G               PG +G PG            + G  G  G  G  GPQG  G  G  GR G  G++G IG  G  G PGKDG+ G+ G                          G  G  G+ G  G +  PG +G  G  G PG  G  G PG   P     L GPIG  G+                G+RG  G  G SG  G  GS+GP G+   G AGD                G  G  G  GE G   +G  GE G  G+ G  G RG  G  G+PG                             DG NG   + G KG  G   P+ ++G RGP+G  G  G PGS G +G IG TGP G      + G  G  G  G +G  G  G+PG PG  G  GP
Sbjct:   48 GAPGPIGVPGLEGP---AGDIGPPGRAGP---LGEKGDVGEYGEQGEKGHRGDIG---PKGEMGYPGIMGKSGEP---------------------------GTPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFG------------------------DKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRG------VQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGP 598          

HSP 12 Score: 55.8398 bits (133), Expect = 9.339e-7
Identity = 80/177 (45.20%), Postives = 91/177 (51.41%), Query Frame = 1
Query: 6715 GTKGNKGSKGPYGKPGI---AGDNGASGPQGPRGENGDLGNTGEQG---------PVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPG--------SIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIG 7185
            G KG  G+ GP G PG+   AGD G  G  GP GE GD+G  GEQG         P GE+G  GI G +G PG PG  G +G D   G +G  G  G +G RGP G  G QGPPG        S G KG+ G TG  G +G PG  G  G  G  G  G  G+KG PG PG  G  G
Sbjct:   42 GIKGRMGAPGPIGVPGLEGPAGDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTG 218          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Fly
Match: Col4a1 (gene:FBgn0000299 transcript:FBtr0079003)

HSP 1 Score: 106.686 bits (265), Expect = 3.411e-22
Identity = 202/557 (36.27%), Postives = 253/557 (45.42%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRM---------GKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGE------------RGPPGKSXXXXXXXXXXXXXQSGLQGPIGP---PGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVN------------GAPGIPGKDGENGKDAVDGAKGNIGPI---GSSGRRGPQGMTGIQGPPGSIG----LKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIG 7185
            G  G+ G TGP G PG++GP G+ G +G++G           GKDG+ G  G  G  GP G PG    +  PGP+   G PG+ G+                              QG  G +G  G  G+PG+DG  G PG+ GD G  G+ G  G+                              +G KGD+GP+GP+G  G  G PG+ G  G  G  G  G  G++G PG +G  G+ G+ G  G AGV G PGK G AG  G+ G  G  G  G  G  G  G  G  G PG  G  G  G    PG QG  G              GPPG  GD    G  G PG SGL+G  GP   PG  G++GLPG     G  G  G KG  G+ GI G +G +G +G +G  G  G  GE+G VG  G  G  G++            G PG  G  GE G   + G KG  GP+   G +G  GP+G  GI+G PG       ++GD GS G  G  G  G  G+ G+ GP G  G KGD+GL G PG  G+ G
Sbjct:  786 GYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPG----ISRPGPM---GPPGLNGL------------------------------QGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGI------------------------------VGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLA-VHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNG 1274          

HSP 2 Score: 103.219 bits (256), Expect = 4.112e-21
Identity = 191/566 (33.75%), Postives = 236/566 (41.70%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSP------------------GPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYP------------GSDGKRGAPGEHGDPGKAGIDGPSG-----VKGDPG-------KTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGS---------IGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIG 7185
             G PG  G  G  G PG KG +G+KGD G +    +    GP+G+ G  G  G PG+ G  G P                  GP G  G  G  G+ G  G  G+P +     +  L+G +G  G+ G  G++G  G +G P            G  G  GAPG  G PG+AG DG  G     +KG+PG       K              P        ++ +KG+ G  G +G PG  G  G  G  G  G  G  GPQG  G  GPRG  G +G +G  G  GVPG PGKDG  G                                        PG+N QPGP      RG PG S                  GP+GPPG +G +G  G  GP+G  G  G+ G  G PG  GD G  G  G  G  G+ G+ G  GP G  G  G+ G++G  G  G  GE G   + G  GN G  G+ G  GP+G  G+ G PG           G KGD G+TG  G  G  G  G PG  G     G KGD+GL G PG  G+ G
Sbjct:  539 AGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCR---AGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRG---------------------------------------IPGRNGQPGP------RGEPGISRP----------------GPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLM---GIKGDQGLAGAPGQQGLDG 1037          

HSP 3 Score: 99.7525 bits (247), Expect = 4.406e-20
Identity = 196/564 (34.75%), Postives = 246/564 (43.62%), Query Frame = 1
Query: 5653 GINGPTGPTGVPGM--------------KGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVG---------------NAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQ-------DGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQG---FPGA--RGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSK------GPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENG------KDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIG 7185
            G+ G TGP G PG                GP G KGD+G+ G  G+DGI G +G  G QG  G PG +G+VG+PG  G                 G+PG +G  G PG  G PG++G  G  GL+G  G  G +G  GI+G  G         G  GS G+RG  GE G+ G+ G+ GP+GV                               G+KGD G  GP G+ GL G PG  G +G +G   +PG   +G +G+ G PG  GR G  G+ G IG  G+PG  G+ G  G                                              PGP GP G +G  G +G  G PG  G PG  GL+G  GP G  G+RGL      +G +G KG K      GP G PG+ G  G +G  G  G +G +G  GE+G  G  G     G +G PG+PG+ GE G           G  G  GP G  GR G +G+ GIQG  G  G +G IG TG +GR                   G KGD+G PG  G  G IG
Sbjct: 1073 GLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGV------------------------------AGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGL---------------------------------------------PGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGL------NGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGR---DGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRP------------------GPKGDRGEPGERGYEGAIG 1534          

HSP 4 Score: 97.8265 bits (242), Expect = 1.721e-19
Identity = 170/502 (33.86%), Postives = 224/502 (44.62%), Query Frame = 1
Query: 5653 GINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRG-----TVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKR------------GAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGV----------IGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQG------TIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPG---PQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIG 7050
            G+ G  G  G PG+ GP G+ GD  ++G+ G+ G  G RG+ GP G  G PG +G       G  GP G  G  G  GI GR G  GE G QG  G              G  G KGS+G  G PG+ G              G PG+ GD G+ G+ G  G+KG+ G                         +G +G  G  GP G  G+RG PG+           GS G +G+ G +G QG  G  GP G  G+KG +G        G+ G+PG  G  G  G++G PG      +  P                        PG+N + G     G +GERG PG +G+ G           GL GPIGP G+ G+RGL GS G  G  G  G+      PG+ GD G  G +G RG NG  G  G++G      + G++G +G PG+ G+ G+ G   ++G  G +G  G  G  GP+G  G  G PG  G KG+ G
Sbjct: 1037 GMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQG------------VWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGP------------------------VGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPG----------------------RPGRNGRQGLIGAPGLIGERGLPGLAGEPG---------LVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGA------PGLKGDTGPQGFKGERGLNGFEGQKGDKG------DRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPG 1459          

HSP 5 Score: 93.5893 bits (231), Expect = 3.582e-18
Identity = 195/602 (32.39%), Postives = 244/602 (40.53%), Query Frame = 1
Query: 5662 GPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTV--------------------------GSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXX--------------SQGGLGIKGSIGQD------------------GYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPG------------LRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGI---------------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGP---QGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTK---GNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKD---GENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIG 7185
            GP G  GV G+ GP G  G KG  G  G+ G  GP G  G +G  G  G +G++                          GS G  G  G+PG++G  G  G +G  G  G   L     P                    +G +GIKG +G                    G PG DG RG PGE G PG+ G DG +G  G PG                        E G  G  G  G +G PG            L+G+ G  G+ G++G  G +G +G+ G PGP+G  G KG +G  G  G  GTPG+ G+ G  GI                 K                     + K    G  G PG+   PGP    G  GERG  G  G+ G  G  G  G  GL GP G  GN G  G+PG+ G  G +   G  G  GP G+PGI+      GP GP G NG  G  G++GP G +G  G  G  G PG  G     G +G+  + G KG++GPIG +G  GP G+ GI G  G  G KG+ GS G +G                    G KGD+G PGN G  G  G
Sbjct:  416 GPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPG------------------------EKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGIS----RPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMP------------------GNKGDRGAPGNDGPKGFAG 971          

HSP 6 Score: 91.6633 bits (226), Expect = 1.143e-17
Identity = 223/584 (38.18%), Postives = 279/584 (47.77%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSP------------GPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGK--RGAPGEHGDPGKAGIDGP---SGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKG------SQGTIGIAGVPGTPG--------KDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPG---------PQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGP---SGTKGNKGSKGPYGKPGIA---GDNGASG------------------PQGPRGENGDLGNTGEQ---GPVGEVGNAGIRGVNGAPGIPG---KDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTG--IQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGV 7179
            G+ G +G  G  G  G +GP G +G  G+RG  G +G  GP G  G  G TG PG  G  G P            G  G  G PG +G+ G  G +G PG+ GP G  G +G +G  G+ G  G  G  G+DGYPG  G+  +G PG HG  G  G  G    SG KG+PG                        E G  G  GP G  GSPG RG  G+ G+ G QG PG  GP+G+ G  G +G  G+ G        G  GI G  G PG        + G  G  G+ G  G  G  GP GPIG PG  G  G PG  G  G PG + +PG         P GP G  GPPG  G DGV G  G  G+ G  G +G PGN G RG PG++GP   +G  G  G +GP G PG++   GD GA+G                    G +G+ G  G  G+Q   G  GE GN G  G++G PG+PG   + G+ G+    G +G+ GP G+ G  G +G+ G  + G  G  G KGD G +G  GR G+ G  G+ G+ G  G  G KG  G PG PG PG+
Sbjct:  579 GDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKG--------EPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGM 1154          

HSP 7 Score: 91.6633 bits (226), Expect = 1.308e-17
Identity = 210/582 (36.08%), Postives = 258/582 (44.33%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGP---SGVKGDPG--------------KTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTP----GKNMQPGPQGPLGER---GPPGKSXXXXXXXXXXXXXQSGLQGPIGP------------PGNSGQRGLPGSN-----------GPSGTKGNKGSKG-----------PYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGN---------AGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIG 7185
             G PG+ GP+G  G  G  GP G +GDKG+RG     G+ G  G  G QGP G PG  G  G  G  G  G PG++G+SG PG +G  G  G  G  G    E    ++G  G  G  G  G  G  G  G  GE GD G  G  GP    G+KG+ G              K      +     +      G  G++G KG+ G +G  G PG  G+ G+ G  G +G PG  G +G  G+ GP G TG KG +G  G+ G+PG PG+ G+ G+ G  GK G  G PGP G       P     P        P    G +  PGPQG  G++   G PG+ G++G PG  G  G +GL GP G              G  G  GLPG             G  G KG+KG +G             G+PG  G  GA G +G  G  G  G  G+ G  G+VG           G +G +G PGIPGK         DGA+G  G  G  G RG  G+ G  GPPG  G  G  G  G  G       PGKP +      E  KGDKG PG PG  GV G
Sbjct:  106 MGFPGMEGPSGDKGQKGDPGPYGQRGDKGERG---SPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGK---------DGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGE------PGKPALCDLSLIEPLKGDKGYPGAPGAKGVQG 669          

HSP 8 Score: 85.1149 bits (209), Expect = 1.071e-15
Identity = 207/533 (38.84%), Postives = 244/533 (45.78%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGP-RGNLG---------PQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPS--GVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQ---PGPQGPLGERGPPGKSXXXXXXXXXXXXXQS---GLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGP 7188
            GEPG +G  G     G KG  G  G+KG+ G    D I  P +GN G         P G  G+PG RG  G  G  G  G PGV+G  G  G                         +G  G +G++G  G PG DG RG PG +G PG  G  G S  G  G PG  G                       G KGD GP GP G PG  G+ G  G  G  G PG  G  GI+G        G  G  G  G+AG PG PG DG  G+ G  G+ G PG  G  G  G  G PG DG  G AG  G PGK      PG  G  G++G  G +G+DG  G  GPPG     G++G  G  G  GQ+GL G  G  G +G  G  GP G PG A + G  G  GP G  GD G  G  G  GE G  G+  V+G  G PG+ G+ G+  +DG  G       +G +G QG+ G+ G PG  G  G  G  G  G  G+PG  G PG VG PG  G KG+ GL G PG  G  GP
Sbjct:  722 GEPGFHGRDG---AKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNG------------------------PRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQ---------------------GEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVG------EKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLA-VHGRAGPPGEKGDQGRSGIDGRDG------INGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGP 1193          

HSP 9 Score: 83.1889 bits (204), Expect = 4.905e-15
Identity = 201/557 (36.09%), Postives = 241/557 (43.27%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQ-------GGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKG--DIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQG--ILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQ---RGLPGSNGPSG------------TKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGI---RGVNGAPGIPGKD--GENGKDAVDGAKGNIGPIGSSGRRGPQGMTGI----------QGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            GEPG+    G  G PG +G  G+ G KG++G  G  G  G +GN GP G TG  G RG    PG  G  G+PG +G  GR G  G+PG+ GPPG PG                  G  G +G  G DG PG  G  G  G  G PG+ G +GP G KG+ G  G  G  G  GP G  G  G  G+ G  G    G  G  G  G+ G PG+ GS G +GF G  G  G   LG PG  G  G+ G +G  G  G PG  G  G  G VG                        + G  G  G  G PG   + G +GP GERG PG+ G              G+ G  GPPG  G+    GLPG+ G  G             KG+KG  G  G  G+ G  GA G  G  G  G+ G  GE+G  G  GN G     G +G PGIPG+   GE G    DGAKG+ G  G SG +G  G   +          +G PG  G+ G  G  G  G                    G+ G KG  G  G PGV GP+
Sbjct:  304 GEPGL---VGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRG---EPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVG------------------GKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERG------------HDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGE------------------RGYTGLKGNTGPQGPPGVEGPR 806          

HSP 10 Score: 77.411 bits (189), Expect = 2.844e-13
Identity = 182/550 (33.09%), Postives = 221/550 (40.18%), Query Frame = 1
Query: 5653 GINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGV-PGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGAS-------------------------GPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNI------GPIGSSGRRGPQGM--TGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGN-----PGTPGVIG 7185
            G+ GP GPTG   +KG +G  G +G  G  G+ G  GP G  G +G  G+PG  G  G PG  G AG+PG  GI+G+                                  G  GQDG PG +G  G PG  G    AG  G  G KG+P K                            GD    G  G PG RG  G+ G  G  G  G RG  G  G+ GPRG  G KG +G      + PG PG  G+ G+                         G  G  G  G PG  G+  +PGP+G  G  G  G+ G  G PG        G QG  GPPG++GQ+G  G  G +G  GN G KG  G+ G  G  G                           G  GP+G NG  G  G QG  G+ G AG+ G  G  G PGK GE G   ++G KG+I      GP G  G++G  G+   GIQG  G  G+ G  G  G  G                    GFKG+ G PG+     PGTPG  G
Sbjct:   92 GLPGPLGPTG---LKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGK---------------------------------DGCDGQDGIPGLEGLSGMPGPRG---YAGQLGSKGEKGEPAK--------------------------ENGDYA-KGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGE-----------PASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPG------DRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGE------------------RGFKGNAGAPGDSKLGRPGTPGAAG 540          

HSP 11 Score: 76.2554 bits (186), Expect = 5.433e-13
Identity = 112/326 (34.36%), Postives = 144/326 (44.17%), Query Frame = 1
Query: 6178 ELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPG------ARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGAS----------GPQGPRGE----------------NGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
            E G++G  GP+GP+G  G  G PG+ G  G +G  G       RG +G  GSPG  G+ G  G QG  G  G PG  GKDG  GQ GI                                 PG  G +  PGP+G  G+ G  G+ G+          G+ G  G  G  G +G +G PG  G  G  G  G+KGP G+ G+ G+ GAS          G +G +GE                 GD+G  GE G VG  G  G  G  G  G  G+ G  G     G +GN GP GS+G++G +G  G+ G PG+ G KG+ G  G
Sbjct:   87 EKGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGI---------------------------------PGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAG 379          

HSP 12 Score: 73.1738 bits (178), Expect = 4.792e-12
Identity = 200/590 (33.90%), Postives = 247/590 (41.86%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGR------MGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXX-----SQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVI---GSLGSQGFPGARGPQG----------------------------ILGSPGPRGRTGSKG---SQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQ-----------PGPQGPLGERGPPGKSXXXXXXX--------XXXXXXQSGLQGPIGPPGNSGQRGLPG------SNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPR---GENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGL---PGNPGTPGVIG 7185
            G PG+ G +G  G  G  G LG KG+KG+  +       G+ G  G RG  G  GP G PG +G  G  GP G  G  G  G+ G  G      M+           E         +   +G +G +GQ G PG  G++G PG  GD    G+DG  G KG PG                       G+ G +G+ GP G +G  G RG PG+    G+ G +G PG  G  G                             +G+PGP+G  G  G    QG  G  G  G PG+ G  G  G  G+ G  G  GP G IG  GHPG  G  G  G  G PG  +Q           PG +G  GERG  G +G  G             G PGQ G  G  G PG  G  G+ G      S+  +G KG+KG+    G PGI G +GA GP G R   GE G  G  G+ GP GE G  G  G+ GA G PGK        ++  KG+ G  G+ G +G QG  G +G PG  G KG+                            GFKG+KGL   PGN GTPG  G
Sbjct:  173 GIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGD---TGLDGQKGEKGLPG---------------------GPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTS---GLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEF---------------------------GFKGEKGLSGAPGNDGTPGRAG 708          

HSP 13 Score: 72.7886 bits (177), Expect = 6.431e-12
Identity = 149/438 (34.02%), Postives = 185/438 (42.24%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDG----ILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGA------RGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERG---PPGKSXXXXXXXXXXXXXQSGL---------------QGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAG 6870
            +G PG+ G TGP G+ G  G  G KG++G RG+ G       I G +G+ G +G TG  G +G  G  GP G AG  G +G+ G                                   G+ G +G PG+ G  G  GE G PG   I G  G+ G PG+ G  G  G  G  G RG  G+ GE G  G  GP+GP+GS G RG  G  G  G  GFPGA       GPQG  G  G  G  G KG +G  G+ G  G PG  G+ G  G                                     PG N   GP G  GERG   P G+ G DG PG  G  G+ G+                GP G PG  G+RGL G  G  G KG +         G+ G+ G  G  GP+G+ G+ G  G +G +G +G  G
Sbjct: 1182 SGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQG---------------------------------PPGASGLNGIPGAKGDIGPRGEIGYPGVT-IKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGY------------------------------------PGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGER---------GLIGETGNVGRPGPKGDRGEPGERGYEGAIGLIGQKG 1540          

HSP 14 Score: 61.2326 bits (147), Expect = 2.250e-8
Identity = 107/259 (41.31%), Postives = 129/259 (49.81%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDG---YPG---SDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGP---RGRTGSKGSQGTIGIAGVPGTPG 6393
            G PG NG  G  G PG+ G  G+ G  G+ G +G  G         P GP G+ G RG  GSPG  G  G PG  G+ G  G QG  G +G  G  G +G +G++G QG  G+ G +GQ G   YPG   +DG  GAPGE G  G  G DG  G  G PG+ G PG     GP+G  G  G           GP G  G PG RG  G+ G  G +G  G  G  G +G PGP   RG  G +G +G IG+ G  G PG
Sbjct: 1303 GRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPG---------PIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRN---------GPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPKGDRGEPGERGYEGAIGLIGQKGEPG 1543          

HSP 15 Score: 55.0694 bits (131), Expect = 1.541e-6
Identity = 60/166 (36.14%), Postives = 76/166 (45.78%), Query Frame = 1
Query: 6721 KGNKGSKGPYGKPGIAGDN---GASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGI------PGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            KGN+G  GP G  G+ G+    G  GP G +G+ GD G  G++G  GE G+ G+ G  G PG+      PG  G NGKD  D            G+ G  G+ G+ G PG  G  G +GS G  G                      KG+KG PG  GT G+ GPQ
Sbjct:   88 KGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCD------------GQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYA------------KGEKGEPGWRGTAGLAGPQ 229          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Fly
Match: Col4a1 (gene:FBgn0000299 transcript:FBtr0079002)

HSP 1 Score: 106.686 bits (265), Expect = 3.411e-22
Identity = 202/557 (36.27%), Postives = 253/557 (45.42%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRM---------GKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGE------------RGPPGKSXXXXXXXXXXXXXQSGLQGPIGP---PGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVN------------GAPGIPGKDGENGKDAVDGAKGNIGPI---GSSGRRGPQGMTGIQGPPGSIG----LKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIG 7185
            G  G+ G TGP G PG++GP G+ G +G++G           GKDG+ G  G  G  GP G PG    +  PGP+   G PG+ G+                              QG  G +G  G  G+PG+DG  G PG+ GD G  G+ G  G+                              +G KGD+GP+GP+G  G  G PG+ G  G  G  G  G  G++G PG +G  G+ G+ G  G AGV G PGK G AG  G+ G  G  G  G  G  G  G  G  G PG  G  G  G    PG QG  G              GPPG  GD    G  G PG SGL+G  GP   PG  G++GLPG     G  G  G KG  G+ GI G +G +G +G +G  G  G  GE+G VG  G  G  G++            G PG  G  GE G   + G KG  GP+   G +G  GP+G  GI+G PG       ++GD GS G  G  G  G  G+ G+ GP G  G KGD+GL G PG  G+ G
Sbjct:  786 GYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPG----ISRPGPM---GPPGLNGL------------------------------QGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGI------------------------------VGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLA-VHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNG 1274          

HSP 2 Score: 103.219 bits (256), Expect = 4.112e-21
Identity = 191/566 (33.75%), Postives = 236/566 (41.70%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSP------------------GPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYP------------GSDGKRGAPGEHGDPGKAGIDGPSG-----VKGDPG-------KTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGS---------IGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIG 7185
             G PG  G  G  G PG KG +G+KGD G +    +    GP+G+ G  G  G PG+ G  G P                  GP G  G  G  G+ G  G  G+P +     +  L+G +G  G+ G  G++G  G +G P            G  G  GAPG  G PG+AG DG  G     +KG+PG       K              P        ++ +KG+ G  G +G PG  G  G  G  G  G  G  GPQG  G  GPRG  G +G +G  G  GVPG PGKDG  G                                        PG+N QPGP      RG PG S                  GP+GPPG +G +G  G  GP+G  G  G+ G  G PG  GD G  G  G  G  G+ G+ G  GP G  G  G+ G++G  G  G  GE G   + G  GN G  G+ G  GP+G  G+ G PG           G KGD G+TG  G  G  G  G PG  G     G KGD+GL G PG  G+ G
Sbjct:  539 AGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCR---AGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRG---------------------------------------IPGRNGQPGP------RGEPGISRP----------------GPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLM---GIKGDQGLAGAPGQQGLDG 1037          

HSP 3 Score: 99.7525 bits (247), Expect = 4.406e-20
Identity = 196/564 (34.75%), Postives = 246/564 (43.62%), Query Frame = 1
Query: 5653 GINGPTGPTGVPGM--------------KGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVG---------------NAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQ-------DGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQG---FPGA--RGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSK------GPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENG------KDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIG 7185
            G+ G TGP G PG                GP G KGD+G+ G  G+DGI G +G  G QG  G PG +G+VG+PG  G                 G+PG +G  G PG  G PG++G  G  GL+G  G  G +G  GI+G  G         G  GS G+RG  GE G+ G+ G+ GP+GV                               G+KGD G  GP G+ GL G PG  G +G +G   +PG   +G +G+ G PG  GR G  G+ G IG  G+PG  G+ G  G                                              PGP GP G +G  G +G  G PG  G PG  GL+G  GP G  G+RGL      +G +G KG K      GP G PG+ G  G +G  G  G +G +G  GE+G  G  G     G +G PG+PG+ GE G           G  G  GP G  GR G +G+ GIQG  G  G +G IG TG +GR                   G KGD+G PG  G  G IG
Sbjct: 1073 GLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGV------------------------------AGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGL---------------------------------------------PGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGL------NGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGR---DGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRP------------------GPKGDRGEPGERGYEGAIG 1534          

HSP 4 Score: 97.8265 bits (242), Expect = 1.721e-19
Identity = 170/502 (33.86%), Postives = 224/502 (44.62%), Query Frame = 1
Query: 5653 GINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRG-----TVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKR------------GAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGV----------IGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQG------TIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPG---PQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIG 7050
            G+ G  G  G PG+ GP G+ GD  ++G+ G+ G  G RG+ GP G  G PG +G       G  GP G  G  G  GI GR G  GE G QG  G              G  G KGS+G  G PG+ G              G PG+ GD G+ G+ G  G+KG+ G                         +G +G  G  GP G  G+RG PG+           GS G +G+ G +G QG  G  GP G  G+KG +G        G+ G+PG  G  G  G++G PG      +  P                        PG+N + G     G +GERG PG +G+ G           GL GPIGP G+ G+RGL GS G  G  G  G+      PG+ GD G  G +G RG NG  G  G++G      + G++G +G PG+ G+ G+ G   ++G  G +G  G  G  GP+G  G  G PG  G KG+ G
Sbjct: 1037 GMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQG------------VWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGP------------------------VGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPG----------------------RPGRNGRQGLIGAPGLIGERGLPGLAGEPG---------LVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGA------PGLKGDTGPQGFKGERGLNGFEGQKGDKG------DRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPG 1459          

HSP 5 Score: 93.5893 bits (231), Expect = 3.582e-18
Identity = 195/602 (32.39%), Postives = 244/602 (40.53%), Query Frame = 1
Query: 5662 GPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTV--------------------------GSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXX--------------SQGGLGIKGSIGQD------------------GYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPG------------LRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGI---------------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGP---QGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTK---GNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKD---GENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIG 7185
            GP G  GV G+ GP G  G KG  G  G+ G  GP G  G +G  G  G +G++                          GS G  G  G+PG++G  G  G +G  G  G   L     P                    +G +GIKG +G                    G PG DG RG PGE G PG+ G DG +G  G PG                        E G  G  G  G +G PG            L+G+ G  G+ G++G  G +G +G+ G PGP+G  G KG +G  G  G  GTPG+ G+ G  GI                 K                     + K    G  G PG+   PGP    G  GERG  G  G+ G  G  G  G  GL GP G  GN G  G+PG+ G  G +   G  G  GP G+PGI+      GP GP G NG  G  G++GP G +G  G  G  G PG  G     G +G+  + G KG++GPIG +G  GP G+ GI G  G  G KG+ GS G +G                    G KGD+G PGN G  G  G
Sbjct:  416 GPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPG------------------------EKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGIS----RPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMP------------------GNKGDRGAPGNDGPKGFAG 971          

HSP 6 Score: 91.6633 bits (226), Expect = 1.143e-17
Identity = 223/584 (38.18%), Postives = 279/584 (47.77%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSP------------GPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGK--RGAPGEHGDPGKAGIDGP---SGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKG------SQGTIGIAGVPGTPG--------KDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPG---------PQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGP---SGTKGNKGSKGPYGKPGIA---GDNGASG------------------PQGPRGENGDLGNTGEQ---GPVGEVGNAGIRGVNGAPGIPG---KDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTG--IQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGV 7179
            G+ G +G  G  G  G +GP G +G  G+RG  G +G  GP G  G  G TG PG  G  G P            G  G  G PG +G+ G  G +G PG+ GP G  G +G +G  G+ G  G  G  G+DGYPG  G+  +G PG HG  G  G  G    SG KG+PG                        E G  G  GP G  GSPG RG  G+ G+ G QG PG  GP+G+ G  G +G  G+ G        G  GI G  G PG        + G  G  G+ G  G  G  GP GPIG PG  G  G PG  G  G PG + +PG         P GP G  GPPG  G DGV G  G  G+ G  G +G PGN G RG PG++GP   +G  G  G +GP G PG++   GD GA+G                    G +G+ G  G  G+Q   G  GE GN G  G++G PG+PG   + G+ G+    G +G+ GP G+ G  G +G+ G  + G  G  G KGD G +G  GR G+ G  G+ G+ G  G  G KG  G PG PG PG+
Sbjct:  579 GDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKG--------EPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGM 1154          

HSP 7 Score: 91.6633 bits (226), Expect = 1.308e-17
Identity = 210/582 (36.08%), Postives = 258/582 (44.33%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGP---SGVKGDPG--------------KTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTP----GKNMQPGPQGPLGER---GPPGKSXXXXXXXXXXXXXQSGLQGPIGP------------PGNSGQRGLPGSN-----------GPSGTKGNKGSKG-----------PYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGN---------AGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIG 7185
             G PG+ GP+G  G  G  GP G +GDKG+RG     G+ G  G  G QGP G PG  G  G  G  G  G PG++G+SG PG +G  G  G  G  G    E    ++G  G  G  G  G  G  G  G  GE GD G  G  GP    G+KG+ G              K      +     +      G  G++G KG+ G +G  G PG  G+ G+ G  G +G PG  G +G  G+ GP G TG KG +G  G+ G+PG PG+ G+ G+ G  GK G  G PGP G       P     P        P    G +  PGPQG  G++   G PG+ G++G PG  G  G +GL GP G              G  G  GLPG             G  G KG+KG +G             G+PG  G  GA G +G  G  G  G  G+ G  G+VG           G +G +G PGIPGK         DGA+G  G  G  G RG  G+ G  GPPG  G  G  G  G  G       PGKP +      E  KGDKG PG PG  GV G
Sbjct:  106 MGFPGMEGPSGDKGQKGDPGPYGQRGDKGERG---SPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGK---------DGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGE------PGKPALCDLSLIEPLKGDKGYPGAPGAKGVQG 669          

HSP 8 Score: 85.1149 bits (209), Expect = 1.071e-15
Identity = 207/533 (38.84%), Postives = 244/533 (45.78%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGP-RGNLG---------PQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPS--GVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQ---PGPQGPLGERGPPGKSXXXXXXXXXXXXXQS---GLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGP 7188
            GEPG +G  G     G KG  G  G+KG+ G    D I  P +GN G         P G  G+PG RG  G  G  G  G PGV+G  G  G                         +G  G +G++G  G PG DG RG PG +G PG  G  G S  G  G PG  G                       G KGD GP GP G PG  G+ G  G  G  G PG  G  GI+G        G  G  G  G+AG PG PG DG  G+ G  G+ G PG  G  G  G  G PG DG  G AG  G PGK      PG  G  G++G  G +G+DG  G  GPPG     G++G  G  G  GQ+GL G  G  G +G  G  GP G PG A + G  G  GP G  GD G  G  G  GE G  G+  V+G  G PG+ G+ G+  +DG  G       +G +G QG+ G+ G PG  G  G  G  G  G  G+PG  G PG VG PG  G KG+ GL G PG  G  GP
Sbjct:  722 GEPGFHGRDG---AKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNG------------------------PRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQ---------------------GEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVG------EKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLA-VHGRAGPPGEKGDQGRSGIDGRDG------INGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGP 1193          

HSP 9 Score: 83.1889 bits (204), Expect = 4.905e-15
Identity = 201/557 (36.09%), Postives = 241/557 (43.27%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQ-------GGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKG--DIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQG--ILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQ---RGLPGSNGPSG------------TKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGI---RGVNGAPGIPGKD--GENGKDAVDGAKGNIGPIGSSGRRGPQGMTGI----------QGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            GEPG+    G  G PG +G  G+ G KG++G  G  G  G +GN GP G TG  G RG    PG  G  G+PG +G  GR G  G+PG+ GPPG PG                  G  G +G  G DG PG  G  G  G  G PG+ G +GP G KG+ G  G  G  G  GP G  G  G  G+ G  G    G  G  G  G+ G PG+ GS G +GF G  G  G   LG PG  G  G+ G +G  G  G PG  G  G  G VG                        + G  G  G  G PG   + G +GP GERG PG+ G              G+ G  GPPG  G+    GLPG+ G  G             KG+KG  G  G  G+ G  GA G  G  G  G+ G  GE+G  G  GN G     G +G PGIPG+   GE G    DGAKG+ G  G SG +G  G   +          +G PG  G+ G  G  G  G                    G+ G KG  G  G PGV GP+
Sbjct:  304 GEPGL---VGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRG---EPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVG------------------GKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERG------------HDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGE------------------RGYTGLKGNTGPQGPPGVEGPR 806          

HSP 10 Score: 77.411 bits (189), Expect = 2.844e-13
Identity = 182/550 (33.09%), Postives = 221/550 (40.18%), Query Frame = 1
Query: 5653 GINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGV-PGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGAS-------------------------GPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNI------GPIGSSGRRGPQGM--TGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGN-----PGTPGVIG 7185
            G+ GP GPTG   +KG +G  G +G  G  G+ G  GP G  G +G  G+PG  G  G PG  G AG+PG  GI+G+                                  G  GQDG PG +G  G PG  G    AG  G  G KG+P K                            GD    G  G PG RG  G+ G  G  G  G RG  G  G+ GPRG  G KG +G      + PG PG  G+ G+                         G  G  G  G PG  G+  +PGP+G  G  G  G+ G  G PG        G QG  GPPG++GQ+G  G  G +G  GN G KG  G+ G  G  G                           G  GP+G NG  G  G QG  G+ G AG+ G  G  G PGK GE G   ++G KG+I      GP G  G++G  G+   GIQG  G  G+ G  G  G  G                    GFKG+ G PG+     PGTPG  G
Sbjct:   92 GLPGPLGPTG---LKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGK---------------------------------DGCDGQDGIPGLEGLSGMPGPRG---YAGQLGSKGEKGEPAK--------------------------ENGDYA-KGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGE-----------PASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPG------DRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGE------------------RGFKGNAGAPGDSKLGRPGTPGAAG 540          

HSP 11 Score: 76.2554 bits (186), Expect = 5.433e-13
Identity = 112/326 (34.36%), Postives = 144/326 (44.17%), Query Frame = 1
Query: 6178 ELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPG------ARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGAS----------GPQGPRGE----------------NGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
            E G++G  GP+GP+G  G  G PG+ G  G +G  G       RG +G  GSPG  G+ G  G QG  G  G PG  GKDG  GQ GI                                 PG  G +  PGP+G  G+ G  G+ G+          G+ G  G  G  G +G +G PG  G  G  G  G+KGP G+ G+ G+ GAS          G +G +GE                 GD+G  GE G VG  G  G  G  G  G  G+ G  G     G +GN GP GS+G++G +G  G+ G PG+ G KG+ G  G
Sbjct:   87 EKGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGI---------------------------------PGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAG 379          

HSP 12 Score: 73.1738 bits (178), Expect = 4.792e-12
Identity = 200/590 (33.90%), Postives = 247/590 (41.86%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGR------MGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXX-----SQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVI---GSLGSQGFPGARGPQG----------------------------ILGSPGPRGRTGSKG---SQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQ-----------PGPQGPLGERGPPGKSXXXXXXX--------XXXXXXQSGLQGPIGPPGNSGQRGLPG------SNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPR---GENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGL---PGNPGTPGVIG 7185
            G PG+ G +G  G  G  G LG KG+KG+  +       G+ G  G RG  G  GP G PG +G  G  GP G  G  G  G+ G  G      M+           E         +   +G +G +GQ G PG  G++G PG  GD    G+DG  G KG PG                       G+ G +G+ GP G +G  G RG PG+    G+ G +G PG  G  G                             +G+PGP+G  G  G    QG  G  G  G PG+ G  G  G  G+ G  G  GP G IG  GHPG  G  G  G  G PG  +Q           PG +G  GERG  G +G  G             G PGQ G  G  G PG  G  G+ G      S+  +G KG+KG+    G PGI G +GA GP G R   GE G  G  G+ GP GE G  G  G+ GA G PGK        ++  KG+ G  G+ G +G QG  G +G PG  G KG+                            GFKG+KGL   PGN GTPG  G
Sbjct:  173 GIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGD---TGLDGQKGEKGLPG---------------------GPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTS---GLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEF---------------------------GFKGEKGLSGAPGNDGTPGRAG 708          

HSP 13 Score: 72.7886 bits (177), Expect = 6.431e-12
Identity = 149/438 (34.02%), Postives = 185/438 (42.24%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDG----ILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGA------RGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERG---PPGKSXXXXXXXXXXXXXQSGL---------------QGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAG 6870
            +G PG+ G TGP G+ G  G  G KG++G RG+ G       I G +G+ G +G TG  G +G  G  GP G AG  G +G+ G                                   G+ G +G PG+ G  G  GE G PG   I G  G+ G PG+ G  G  G  G  G RG  G+ GE G  G  GP+GP+GS G RG  G  G  G  GFPGA       GPQG  G  G  G  G KG +G  G+ G  G PG  G+ G  G                                     PG N   GP G  GERG   P G+ G DG PG  G  G+ G+                GP G PG  G+RGL G  G  G KG +         G+ G+ G  G  GP+G+ G+ G  G +G +G +G  G
Sbjct: 1182 SGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQG---------------------------------PPGASGLNGIPGAKGDIGPRGEIGYPGVT-IKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGY------------------------------------PGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGER---------GLIGETGNVGRPGPKGDRGEPGERGYEGAIGLIGQKG 1540          

HSP 14 Score: 61.2326 bits (147), Expect = 2.250e-8
Identity = 107/259 (41.31%), Postives = 129/259 (49.81%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDG---YPG---SDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGP---RGRTGSKGSQGTIGIAGVPGTPG 6393
            G PG NG  G  G PG+ G  G+ G  G+ G +G  G         P GP G+ G RG  GSPG  G  G PG  G+ G  G QG  G +G  G  G +G +G++G QG  G+ G +GQ G   YPG   +DG  GAPGE G  G  G DG  G  G PG+ G PG     GP+G  G  G           GP G  G PG RG  G+ G  G +G  G  G  G +G PGP   RG  G +G +G IG+ G  G PG
Sbjct: 1303 GRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPG---------PIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRN---------GPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPKGDRGEPGERGYEGAIGLIGQKGEPG 1543          

HSP 15 Score: 55.0694 bits (131), Expect = 1.541e-6
Identity = 60/166 (36.14%), Postives = 76/166 (45.78%), Query Frame = 1
Query: 6721 KGNKGSKGPYGKPGIAGDN---GASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGI------PGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            KGN+G  GP G  G+ G+    G  GP G +G+ GD G  G++G  GE G+ G+ G  G PG+      PG  G NGKD  D            G+ G  G+ G+ G PG  G  G +GS G  G                      KG+KG PG  GT G+ GPQ
Sbjct:   88 KGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCD------------GQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYA------------KGEKGEPGWRGTAGLAGPQ 229          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Zebrafish
Match: col2a1b (collagen, type II, alpha 1b [Source:ZFIN;Acc:ZDB-GENE-050302-9])

HSP 1 Score: 160.999 bits (406), Expect = 1.062e-38
Identity = 90/255 (35.29%), Postives = 133/255 (52.16%), Query Frame = 1
Query: 8512 PVRTVRRDLLND-----DALAVKYLGS-----DVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASDVTEYRS-WFGE-ITGTFKFDYQIE-------ASQLMFLKLFSTNARQRITINCSRLSVV------GNSEHPVILYSDHDEEVLRNGD-LFKYSVIRDGCKNSAEIIDSTELEMDTEAI-RLPIRDIA-LNTGSSKEQQQFGLDIGQVCF 9192
            P+R +R D   D     DA     L S     + +++P GTK  PARTC+ L   +P+ + G Y+IDPN G   DA +V C  +  ESCI  K  +   K+W  +   + +  WFGE + G F F+Y  E       + Q+ FL+L ST A Q +T +C R S+       GN +  ++L   +D E+   G+  F YSV+ DGCK        T +E  ++   RLP+ DIA ++ G +   Q+FG+D+G VCF
Sbjct: 1092 PLRYMRADQAADGNHQHDAEVDATLKSLNNQMENIRRPDGTKKSPARTCRDLKQCHPDWKSGEYWIDPNQGCTVDAIKVFCNMETGESCIYPKPANIPRKNWWTTKGGDRKHIWFGEAMNGGFHFNYGDENLSPNTASIQMTFLRLLSTEASQNLTYHC-RNSIAYMDESSGNLKKALLLRGSNDVEIRAEGNSRFTYSVLEDGCKKHTGQWSKTVIEYKSQKTSRLPLVDIAPVDIGGA--HQEFGVDVGAVCF 1343          

HSP 2 Score: 95.5153 bits (236), Expect = 9.038e-19
Identity = 63/264 (23.86%), Postives = 118/264 (44.70%), Query Frame = -3
Query:  229 NDEDEDIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCIEPEVVNYKKTSYTKTISS-----WFSVLASLNKQISYKIPKEQLVFXXXXXXXXXXXXXXSCDQIALVSDDSITQDIRYN--NSVQLF----GDDNQILTVNNEDDL---------FQYKVVEDTCKDKSNNGRAVIKVEXXXXXXXXXXXLNFKSIENSRPAMI--------------GIEIGPVCF 918
            +  D ++   L  L++ ++N+ +P G+K  PAR+C D+++ + +  +G ++IDPN G   DAI V CN +  E+CI P+  N  + ++  T        WF    ++N    +    E L         S  T ++    + L+S ++ +Q++ Y+  NS+       G+  + L +   +D+         F Y V+ED CK  +      + +E             +KS + SR  ++              G+++G VCF
Sbjct: 1106 HQHDAEVDATLKSLNNQMENIRRPDGTKKSPARTCRDLKQCHPDWKSGEYWIDPNQGCTVDAIKVFCNMETGESCIYPKPANIPRKNWWTTKGGDRKHIWFG--EAMNGGFHFNYGDENL---------SPNTASIQMTFLRLLSTEA-SQNLTYHCRNSIAYMDESSGNLKKALLLRGSNDVEIRAEGNSRFTYSVLEDGCKKHTGQWSKTV-IE-------------YKSQKTSRLPLVDIAPVDIGGAHQEFGVDVGAVCF 1343          

HSP 3 Score: 95.1301 bits (235), Expect = 1.366e-18
Identity = 190/504 (37.70%), Postives = 228/504 (45.24%), Query Frame = 1
Query: 5656 INGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPG---------LRGNPGVIGS---LGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVG------IXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGV---NGAPGIPGKDGENGKDAVDGA---------------KGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
              GP GP G  G  G  G KG+ G +G +G  G+ G  G  G +G  G  G  G  G PGP G  G PG +G  G+                            G  G KG+ G+ G  G  G +GA G+ G PG+ G+ G  G+ G PG                        + G +G +GP G  G  G         +RG PGV+G     G  G  G  G +G+ G+PG RG  G  G  G  G  G  G+ G+ G+ GQ G      +PG  GPPG  G  G  G+PG  G  G  GP G  G PG+    GPQG  G RG PG  G DG  G VGP G +G QGP G  G  G+RG  G+ GP G +G+ G KGP G PG  G  G +GP GP G  G  G  GE GP G  G AG RGV    G  G PG  G  G    DG                 G  GP G SG  GPQG TG+ GP G+ G +G  G+TG
Sbjct:  302 ATGPLGPKGQSGDSGLAGFKGEAGPKGEIGNAGLQGAPGPAGEEGKRGPRGEPGAAGPPGPTGERGTPGNRGFPGQ---------------------------DGLAGPKGAPGERGPAGVSGPKGAGGDPGRPGEPGLPGARGLTGRPG------------------------DAGPQGKVGPSGAPGEDGRPGPPGPQGVRGQPGVMGFPGPKGGNGEAGKAGEKGLAGAPGLRGLPGKDGETGAAGPPGPAGSAGERGEQGQPGPSGFQGLPGPPGPPGEGGKPGDQGVPGEAGGAGATGPRGERGFPGERGGAGPQGLQGPRGLPGTPGTDGPKGGVGPAGTAGAQGPPGLQGMPGERGTSGNPGPKGDRGDNGDKGPEGAPGKDGSRGLTGPIGPTGPAGPNGEKGESGPAGPSGVAGTRGVPGDRGETGPPGPAGFAGPPGADGQPGVKGEQGEGGQKGDAGAPGPQGPSGAPGPQGPTGVSGPKGARGAQGPPGATG 754          

HSP 4 Score: 79.337 bits (194), Expect = 7.813e-14
Identity = 162/421 (38.48%), Postives = 196/421 (46.56%), Query Frame = 1
Query: 5677 TGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSK---GPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAP---GIPGKDGEN 6921
             G  G  G  G+ G KG RG  G DG  G  G  G +G +G+PG     G+PGP+G  G PG +G  G  G  G  G  G PG  G  GP G  GS G  G  G+ G+ G  G+ G  GA G  G+ G  G  GPSGV G+PG  G PG  G  G  G  G  G  G  G  G  G  GP G  G  G+ G+ G  G  G  G  G  G+ G+PGP G  G +G +G  G AG PG  G+ G  G  G                                     PG++   GP+G  GERGP G                SG +G  G PG  G+ GLPG+ G +G  G+ G +   GP G PG  G  G  GPQG RG+ G +G  G +G  GE G AG +G+ GAP   G+PGKDGE 
Sbjct:  129 QGARGFPGTPGLPGIKGHRGYTGLDGAKGESGATGAKGESGSPGE---SGAPGPMGPRGLPGERGRPGPSGASGARGNDGLPGGAGPPGPVGTAGSPGFPGSPGAKGEAGPTGARGPEGAQGPRGESGVPGASGPSGVSGNPGSDGMPGAKGSVGAPGIGGAPGFPGPRGPPGPQGATGPLGPKGQSGDSGLAGFKGEAGPKGEIGNAGLQGAPGPAGEEGKRGPRGEPGAAGPPGPTGERGTPGNRGF------------------------------------PGQDGLAGPKGAPGERGPAGV---------------SGPKGAGGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGVRGQPGVMGFPGPKGGNGEAGKAGEKGLAGAPGLRGLPGKDGET 495          

HSP 5 Score: 77.0258 bits (188), Expect = 3.681e-13
Identity = 204/544 (37.50%), Postives = 240/544 (44.12%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRM------------------------GKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXX------XXXQSGLQGP------I---------------------------------GPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMG 7068
            GE G  GP GP G+PG +G  G  G  G RG                          G  G  GP G  GP+G  G  G  G  G+ GP G +G+PG  G+ G  G+ G PG+ G PG PG RGP G +G+ G LG KG  G  G  G  G+ G  GE G+ G  G  GP+G +G  G  G                     E G+ G  GP G  G+PG RG PG  G  G +G PG RGP G+ G  G  G  G  G  G  G  G+ G PG  G  G+VG  G  G  GRPGP GP G+ G PG  G PGP G  G  GK  + G  G  G RG PGK G+ G  G  G        G+ G  GP                                        G PG  G  G  G  GP G  G  G+ GP G  G AG  GA GP G +G  G+ G +G  GP G+ G+ G +G  GA   PGKDG  G     G  G  GP G  G  GP G +G+    G+ G+ GD G TGP G
Sbjct:  172 GESGAPGPMGPRGLPGERGRPGPSGASGARGNDGLPGGAGPPGPVGTAGSPGFPGSPGAKGEAGPTGARGPEGAQGPRGESGVPGASGPSGVSGNPGSDGMPGAKGSVGAPGIGGAPGFPGPRGPPGPQGATGPLGPKGQSGDSGLAGFKGEAGPKGEIGNAGLQGAPGPAGEEGKRGPRG---------------------EPGAAGPPGPTGERGTPGNRGFPGQDGLAGPKGAPGERGPAGVSGPKGAGGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGVRGQPGVMGFPGPKGGNGEAGKAGEKGLAGAPGLRGLPGKDGETGAAGPPGPAGSAGERGEQGQPGPSGFQGLPGPPGPPGEGGKPGDQGVPGEAGGAGATGPRGERGFPGERGGAGPQGLQGPRGLPGTPGTDGPKGGVGPAGTAGAQGPPGLQGMPGERGTSGNPGPKGDRGDNGDKGPEGA---PGKDGSRGLTGPIGPTGPAGPNGEKGESGPAGPSGVA---GTRGVPGDRGETGPPG 688          

HSP 6 Score: 70.8626 bits (172), Expect = 3.277e-11
Identity = 131/388 (33.76%), Postives = 162/388 (41.75%), Query Frame = 1
Query: 6085 GVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIA------------------GDNGASGPQGPRGENGD---LGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIG 7185
            G  G+PGK GN                      G +G  GP G  G PG  G PG+ G  G  G  GA+G  G  G+ G  G  G  G+ G +G  G+PG  G+ G +G  G                    G+ G  G  GP G  GT G    PG  G  GE GP                  +G +GP G  G  G+ G+PG++GPSG  GN GS G  G  G                    G  GA+GP GP+G++GD    G  GE GP GE+GNAG++G  G  G  GK G  G+    G  G  G  G+ G RG  G  G+ GP G+ G +G  G +GP                     +G  GD G PG PG PG  G
Sbjct:  109 GDDGEPGKPGNG---------------------GERGPPGPQGARGFPGTPGLPGIKGHRGYTGLDGAKGESGATGAKGESGSPGESGAPGPMGPRGLPGERGRPGPSGASGA------------------RGNDGLPGGAGPPGPVGTAGSPGFPGSPGAKGEAGP------------------TGARGPEGAQGPRGESGVPGASGPSGVSGNPGSDGMPGAKGSVGAPGIGGAPGFPGPRGPPGPQGATGPLGPKGQSGDSGLAGFKGEAGPKGEIGNAGLQGAPGPAGEEGKRGPRGEPGAAGPPGPTGERGTPGNRGFPGQDGLAGPKGAPGERGPAGVSGP---------------------KGAGGDPGRPGEPGLPGARG 418          

HSP 7 Score: 65.855 bits (159), Expect = 1.061e-9
Identity = 224/645 (34.73%), Postives = 267/645 (41.40%), Query Frame = 1
Query: 5653 GINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILG---------------------PRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGID---------GPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPG---------LRGNPGVIGS---LGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVG------IXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGV---------------------NGAPGI---------------PGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSI------------------------------------------------GLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            G  GP G +GVPG  GP GV G+ G  G  G  G +G                       G LGP+G +G  G  G  G  GP G  G+ G+QG  G                          G +G  G +G  G  G PG  G+RG PG  G PG+ G+          GP+GV G  G  G+PGR G  G  G RG  G  G+ G +G +GP G  G  G         +RG PGV+G     G  G  G  G +G+ G+PG RG  G  G  G  G  G  G+ G+ G+ GQ G      +PG  GPPG  G  G  G+PG  G  G  GP G  G PG+    GPQG  G RG PG  G DG  G VGP G +G QGP G  G  G+RG  G+ GP G +G+ G KGP G PG  G  G +GP GP G  G  G  GE GP G  G AG RGV                     +G PG+               PG  G +G     G  G  GP G+ G +GP G TG  G  G +                                                G KGD G  GP G  G  G  G  G  G  G  G +G++G PG PG  G  G Q
Sbjct:  244 GAQGPRGESGVPGASGPSGVSGNPGSDGMPGAKGSVGAPGIGGAPGFPGPRGPPGPQGATGPLGPKGQSGDSGLAGFKGEAGPKGEIGNAGLQGAPG------------------------PAGEEGKRGPRGEPGAAGPPGPTGERGTPGNRGFPGQDGLAGPKGAPGERGPAGVSGPKGAGGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGVRGQPGVMGFPGPKGGNGEAGKAGEKGLAGAPGLRGLPGKDGETGAAGPPGPAGSAGERGEQGQPGPSGFQGLPGPPGPPGEGGKPGDQGVPGEAGGAGATGPRGERGFPGERGGAGPQGLQGPRGLPGTPGTDGPKGGVGPAGTAGAQGPPGLQGMPGERGTSGNPGPKGDRGDNGDKGPEGAPGKDGSRGLTGPIGPTGPAGPNGEKGESGPAGPSGVAGTRGVPGDRGETGPPGPAGFAGPPGADGQPGVKGEQGEGGQKGDAGAPGPQGPSGAPGPQGPTGVSGPKGARGAQGPPGATGFPGAAGRVGPPGPNGNPGPAGPAGPPGKDGPKGVRGDGGPPGRPGDAGLRGSAGPAGEKGDPGEDGPHGPDGPAGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQ 864          

HSP 8 Score: 54.6842 bits (130), Expect = 2.310e-6
Identity = 114/316 (36.08%), Postives = 136/316 (43.04%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGI---LGPRG---NLGPQGPTGAPGRRG---------------TVGSP------------------------------------GPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVG 6420
            G PGI G  G TG+ G KG  G  G KG+ G  G+ G    +GPRG     G  GP+GA G RG               T GSP                                    GP G +G+PG  G+ G  G+ G PG+ G PG PG RGP G +G+ G LG KG  G  G  G  G+ G  GE G+ G  G  GP+G +G  G                       GE G+ G  GP G  G+PG RG PG  G  G +G PG RGP G+ G  G  G  G  G  G  G  G+ G PG  G  G+VG
Sbjct:  139 GLPGIKGHRGYTGLDGAKGESGATGAKGESGSPGESGAPGPMGPRGLPGERGRPGPSGASGARGNDGLPGGAGPPGPVGTAGSPGFPGSPGAKGEAGPTGARGPEGAQGPRGESGVPGASGPSGVSGNPGSDGMPGAKGSVGAPGIGGAPGFPGPRGPPGPQGATGPLGPKGQSGDSGLAGFKGEAGPKGEIGNAGLQGAPGPAGEEGKRGPR---------------------GEPGAAGPPGPTGERGTPGNRGFPGQDGLAGPKGAPGERGPAGVSGPKGAGGDPGRPGEPGLPGARGLTGRPGDAGPQGKVG 433          

HSP 9 Score: 53.5286 bits (127), Expect = 5.543e-6
Identity = 86/176 (48.86%), Postives = 99/176 (56.25%), Query Frame = -3
Query: 3067 GSKGNVGPLGPKGEPGFQGNRGGRGSPGATGASGKRGSIGPQGENGFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDTGLQGSQGMPGLEGAKGKRGERGSIGMPGELGKRGVRGSPGIDGSIGYAGGRGLSGMRXXXXXXXXXXXXGLQGDSGPPGAIGNKGSQGD 3594
            G+KG  GP G +G  G QG RG  G PGA+G SG  G+ G  G  G KG  G  G  G PG  G RGPPG +G  G  GP G  GD+GL G +G  G +G  G  G +G+ G  GE GKRG RG PG  G  G  G RG  G RG PG +G  GP G  G+ GP G  G KG+ GD
Sbjct:  229 GAKGEAGPTGARGPEGAQGPRGESGVPGASGPSGVSGNPGSDGMPGAKGSVGAPGIGGAPGFPGPRGPPGPQGATGPLGPKGQSGDSGLAGFKGEAGPKGEIGNAGLQGAPGPAGEEGKRGPRGEPGAAGPPGPTGERGTPGNRGFPGQDGLAGPKGAPGERGPAGVSGPKGAGGD 404          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Zebrafish
Match: col2a1a (collagen, type II, alpha 1a [Source:ZFIN;Acc:ZDB-GENE-980526-192])

HSP 1 Score: 159.844 bits (403), Expect = 2.704e-38
Identity = 86/254 (33.86%), Postives = 124/254 (48.82%), Query Frame = 1
Query: 8512 PVRTVRRD-----LLNDDALAVKYLGS-----DVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASDV-TEYRSWFGE-ITGTFKFDY-------QIEASQLMFLKLFSTNARQRITINCSRL-----SVVGNSEHPVILYSDHDEEVLRNGD-LFKYSVIRDGCKNSAEIIDSTELEMDTEAI-RLPIRDIA-LNTGSSKEQQQFGLDIGQVCF 9192
            P+R +R D     L   D      L S     + ++ P G++  PAR+C+ L   +P  + G Y++DPN G A DA +V C  +  E+C++  +P    K+W  S    +   WFGE + G F F Y            QL FL+L ST A Q IT +C           GN +  ++L   +D E+   G+  F Y V+ DGCK        T +E  T+   RLPI DIA ++ G +   Q+FG+DIG VCF
Sbjct: 1169 PLRYMRADEASSSLRQHDVEVDATLKSINGQIEDIRSPDGSRKNPARSCRDLKLCHPEWKSGDYWVDPNLGSAADAIKVFCNMETGETCVKPSTPKIPRKNWWTSKSKAQKHVWFGESMNGGFHFSYADGSQTPSTTTIQLNFLRLLSTEATQTITYHCKNSVAYMDQATGNLKKAILLQGSNDVEIRAEGNSRFTYGVLEDGCKKHTGQWAKTVIEYKTQKTSRLPIMDIAPMDIGGA--DQEFGVDIGAVCF 1420          

HSP 2 Score: 99.7525 bits (247), Expect = 5.147e-20
Identity = 220/541 (40.67%), Postives = 266/541 (49.17%), Query Frame = 1
Query: 5659 NGPTGPTGVPGMKGPLGVKGDKG---QRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSN------------GPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGK---------------DGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
             G  GP G PG  GPLG  G++G    RG  G+DG+ G +G  G +G  G  G +G  G PG  G  G PG +G++GRPG+ G  G  G  G PG  G  G  G        G+ GQ G  G  G +GA GE G PG+ G+ G +G++G PGK G  G SG  GP G  G RG  G+ G  G  G  GP+G+PG  G PG  G  G  G  G  GP+G  G PG RG  G +G QG  G+   PGTPG DG  G +G  G  G  G PG  G  G  G  G  G  G        G + + GP+G  G+ G  G +G  G PG  GP G  G  GPIG  G  G RG PG              GP G  G  G+KG  G+ G  GD+GA GPQGP G  G +G TG  GP G  G  G  G  G PG  G+                G +GKD   G +G+ GP G +G        G++GPPG+ G KG+ G  GP G  G  G  G  G  G  G  G +G++G PG PG  G  G Q
Sbjct:  422 EGKRGPRGEPGSAGPLGPPGERGAPGNRGFPGQDGLAGAKGAPGDRGVPGLSGPKGGTGDPGRPGEPGLPGARGLTGRPGDAGAQGKVGATGAPGEDGRPGPPGP------LGARGQPGVMGFPGPKGANGEPGKPGEKGLVGRTGLRGLPGKDGETGPSGPPGPVGAVGERGEQGQPGPSGFQGLPGPTGAPGEPGKPGDQGVPGEGGAAGPTGPRGERGFPGERGGAGPQGLQGPRGL---PGTPGTDGPKGAIGPAGAAGAQGPPGLQGMPGERGAVGISGAKGDR------GDSGEKGPEGAPGKDGSRGLTGPIGPPGPSGPNGAKGETGPIGSIGAPGARGAPGDRGEIGAPGPAGFAGPPGADGQPGNKGEQGESGQKGDSGAPGPQGPSGAPGPVGPTGVTGPKGARGAQGAPGATGFPGAAGRVGPPGPNGNPGAAGPAGPSGKDGPKGVRGDAGPPGRAGD------AGLRGPPGAPGEKGEAGEDGPPGPDGPSGPAGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQ 941          

HSP 3 Score: 92.4337 bits (228), Expect = 9.079e-18
Identity = 67/277 (24.19%), Postives = 115/277 (41.52%), Query Frame = -3
Query:  229 EKISSIDPNDEDEDIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCIEPEVVNYKKTSYTKTISS-----WFSVLASLNKQISY----KIPKEQLVFXXXXXXXXXXXXXXSCDQIALVSDDSITQDIRYN--NSV----QLFGDDNQILTVNNEDDL---------FQYKVVEDTCKDKSNN-GRAVIKVEXXXXXXXXXXXLNFKSIENSR-PAM-------------IGIEIGPVCF 942
            E  SS+     D ++   L  ++  ++++  P GS+  PARSC D++  +    +G +++DPN G   DAI V CN +  ETC++P      + ++  + S      WF    +     SY    + P    +                 + + L+S ++ TQ I Y+  NSV    Q  G+  + + +   +D+         F Y V+ED CK  +    + VI+               +K+ + SR P M              G++IG VCF
Sbjct: 1177 EASSSL--RQHDVEVDATLKSINGQIEDIRSPDGSRKNPARSCRDLKLCHPEWKSGDYWVDPNLGSAADAIKVFCNMETGETCVKPSTPKIPRKNWWTSKSKAQKHVWFGESMNGGFHFSYADGSQTPSTTTI---------------QLNFLRLLSTEA-TQTITYHCKNSVAYMDQATGNLKKAILLQGSNDVEIRAEGNSRFTYGVLEDGCKKHTGQWAKTVIE---------------YKTQKTSRLPIMDIAPMDIGGADQEFGVDIGAVCF 1420          

HSP 4 Score: 92.0485 bits (227), Expect = 1.179e-17
Identity = 187/456 (41.01%), Postives = 224/456 (49.12%), Query Frame = 1
Query: 5743 GKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHG------DPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDG------------ENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGST 7056
            G  G  GP G  GP+G  G  G  GT GSPGP G +G+PG  GI G  G+ G  G+ G PG PG RGP G +G+ G LG KG  G  G PG  G+ G  GE G       PG +G +G  G +G+P                           GS G +GP G  G+PG RG PG  G  G++G PG RG  G+ G  G  G  G  G  G  G  G+ G PG  G  G+VG  G  G  GRPGP GP+G  G PG  G PGP G  G PGK  + G  G  G RG PGK G+ G  G  GP G  G +G  G PG SG +GLPG  G  G  G  G +      G+ G+ GA+GP GPRGE G  G  G  GP       G++G  G PG PG DG              G   + G  G  G +G SG +G +G +G +GP G+ G  G  G T
Sbjct:  306 GSKGEAGPTGARGPEGAQGPRGEAGTPGSPGPAGASGNPGTDGIPGAKGSAGASGIAGAPGFPGPRGPPGPQGATGPLGPKGQSGDPGIPGFKGEAGPKGERGVLGPQGPPGPSGEEGKRGPRGEP---------------------------GSAGPLGPPGERGAPGNRGFPGQDGLAGAKGAPGDRGVPGLSGPKGGTGDPGRPGEPGLPGARGLTGRPGDAGAQGKVGATGAPGEDGRPGPPGPLGARGQPGVMGFPGPKGANGEPGKPGEKGLVGRTGLRGLPGKDGETGPSGPPGPVGAVGERGEQGQPGPSGFQGLPGPTGAPGEPGKPGDQ------GVPGEGGAAGPTGPRGERGFPGERGGAGP------QGLQGPRGLPGTPGTDGPKGAIGPAGAAGAQGPPGLQGMPGERGAVGISGAKGDRGDSGEKGPEGAPGKDGSRGLT 722          

HSP 5 Score: 83.5741 bits (205), Expect = 3.971e-15
Identity = 179/533 (33.58%), Postives = 217/533 (40.71%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKG------QRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQG---------ILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSG---------------------------QRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGP---------RGENGDLGNT---------GEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
            TG  G  G +G  G+PG KG  G KG++G        G  G++G  GPRG  G  GP G PG RG  G      N G PG  G++G                           ++G  G +G  G  G  G  G  G PGE G PG  G+ G  G  G  GK G  G  G  G  GP G  G  G+ G  G  GP G +G PG  G  G++G  G +G PG  G  G          +G  G +G+ G  G QG  G  G PG PGK G  G                                        PG+    GP GP GERG PG+ G  G           GLQGP G PG  G                           +RG  G +G  G +G+ G KGP G PG  G  G +GP GP         +GE G +G+          G++G +G  G AG  G  GA G PG  GE G+    G  G  GP G SG  GP G TG+ GP G+ G +G  G+TG
Sbjct:  380 TGPLGPKGQSGDPGIPGFKGEAGPKGERGVLGPQGPPGPSGEEGKRGPRGEPGSAGPLGPPGERGAPG------NRGFPGQDGLAG---------------------------AKGAPGDRGVPGLSGPKGGTGDPGRPGEPGLPGARGLTGRPGDAGAQGKVGATGAPGEDGRPGPPGPLGARGQPGVMGFPGPKGANGEPGKPGEKGLVGRTGLRGLPGKDGETGPSGPPGPVGAVGERGEQGQPGPSGFQGLPGPTGAPGEPGKPGDQG---------------------------------------VPGEGGAAGPTGPRGERGFPGERGGAGP---------QGLQGPRGLPGTPGTDGPKGAIGPAGAAGAQGPPGLQGMPGERGAVGISGAKGDRGDSGEKGPEGAPGKDGSRGLTGPIGPPGPSGPNGAKGETGPIGSIGAPGARGAPGDRGEIGAPGPAGFAGPPGADGQPGNKGEQGESGQKGDSGAPGPQGPSGAPGPVGPTGVTGPKGARGAQGAPGATG 831          

HSP 6 Score: 73.1738 bits (178), Expect = 5.633e-12
Identity = 203/527 (38.52%), Postives = 237/527 (44.97%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGR---------------------RGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDI---GPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRT---------------GSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQ------PGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKG------------------SKGPYGKPGIAGDN---------------GASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRG 6987
            TG PG  G  G  GVPG  G  G  G +G+RG  G+ G  GP+G  GP+G  G PG                      +G  G  G VG +G  G +G SG  G +G PG  G  GL G  GP G  G  G  G  G IG  G PG+ G  G  GE G PG AG  GP G  G PG                    G  GE G KGD    GP GPSG+PG  G  GV G  G++   GA+G  G  G PG  GR                G  G  G  G+ G  G PG+ G AG  G PG  G  G  G  GP G  G  G  G  G  G  G PG+  +      PGP G  G++G PG SGD G PG VGPPG +G  G  G  GN G  G PG +G +G KG +G                  S GP GK G  G+N               G  GPQGPRG+ G+ G  GE+G  G  G  G++G+ G PG PG  G  G     GAKG  GP+G +G+ G
Sbjct:  605 TGAPGEPGKPGDQGVPGEGGAAGPTGPRGERGFPGERGGAGPQGLQGPRGLPGTPGTDGPKGAIGPAGAAGAQGPPGLQGMPGERGAVGISGAKGDRGDSGEKGPEGAPGKDGSRGLTGPIGPPGPSGPNGAKGETGPIGSIGAPGARGAPGDRGEIGAPGPAGFAGPPGADGQPGNK------------------GEQGESGQKGDSGAPGPQGPSGAPGPVGPTGVTGPKGAR---GAQGAPGATGFPGAAGRVGPPGPNGNPGAAGPAGPSGKDGPKGVRGDAGPPGRAGDAGLRGPPGAPGEKGEAGEDGPPGPDGPSGPAGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGGSGDRGPPGPVGPPGLTGPAGETGREGNPGSDGPPGRDGAAGVKGERGNTGPIGAPGAPGAPGAPGSVGPIGKQGDRGENGPQGPAGPPGPAGARGMVGPQGPRGDKGEAGEAGERGQKGHRGFTGLQGLPGPPGSPGDQGAAGPAGPSGAKGPSGPVGPAGKDG 1110          

HSP 7 Score: 55.0694 bits (131), Expect = 1.754e-6
Identity = 68/185 (36.76%), Postives = 84/185 (45.41%), Query Frame = 1
Query: 6640 SGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNG------------------ASGPQGPRGENGDLG---------------------------NTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
            +G +GP G  G  G+ G PGS GP+G  GN G+ G  G  G AG +G                  A+GP GP+G++GD G                             G++GP GE G+AG  G  G  G PG  G  G+D + GAKG  G  G  G  GP+G TG  G PG  GL G  G TG
Sbjct:  314 TGARGPEGAQGPRGEAGTPGSPGPAGASGNPGTDGIPGAKGSAGASGIAGAPGFPGPRGPPGPQGATGPLGPKGQSGDPGIPGFKGEAGPKGERGVLGPQGPPGPSGEEGKRGPRGEPGSAGPLGPPGERGAPGNRGFPGQDGLAGAKGAPGDRGVPGLSGPKGGTGDPGRPGEPGLPGARGLTG 498          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Zebrafish
Match: col1a2 (collagen, type I, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-030131-8415])

HSP 1 Score: 158.688 bits (400), Expect = 5.250e-38
Identity = 111/311 (35.69%), Postives = 149/311 (47.91%), Query Frame = 1
Query: 8353 QGSVGPTGTKGFPGENGSPGPVGMPGRDGPAXXXXXXXXXXXXXXXXXXAV----------FFPVRTVRRDLLNDDA---LAVKYLGSDV--VKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASDVTEYRSWFGE-ITGTFKFDYQIE-------ASQLMFLKLFSTNARQRITINCSRLSVV-----GNSEHPVILYSDHDEEVLRNGD-LFKYSVIRDGCKNSAEIIDSTELEMDT-EAIRLPIRDIA-LNTGSSKEQQQFGLDIGQVCF 9192
            +G  GP G  G  G NG PG +G PG  GPAG  GP G  G PG PGPP            +   R  +  L   D      +K L + +  +  P G+K  PARTC+ +  ++P    GFY+IDPN G   DA +  C     ++CI     S   K+W  S   +  +WFGE I    +F Y  E       A+QL F++L +  A Q IT +C           GN +  V+L   +D E+   G+  F +SV+ DGC         T +E  T +  RLPI DIA L+ G +   Q+FGLDIG VCF
Sbjct: 1043 RGPAGPNGPAGKDGSNGMPGAIGPPGHRGPAGHVGPAGPPGSPGLPGPPGPSGGGYDTSGGYDEYRADQASLRAKDYEVDATIKSLNTQIENLLSPEGSKKNPARTCRDIRLSHPEWSSGFYWIDPNQGCTMDAIKAFCDFSTGQTCIHPHPESIPRKNWYRSSQEKKHTWFGETINSGTEFAYNDETLSPQSMATQLAFMRLLANQAVQNITYHCKNSIAYMDAENGNLKKAVLLQGSNDVELRAEGNSRFTFSVLEDGCSRHTGQWSKTVIEYRTNKPSRLPILDIAPLDIGGA--DQEFGLDIGPVCF 1351          

HSP 2 Score: 99.3673 bits (246), Expect = 6.699e-20
Identity = 60/240 (25.00%), Postives = 111/240 (46.25%), Query Frame = -3
Query:  229 EDEDIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCIEPEVVNYKKTSYTKTI----SSWF-------SVLASLNKQISYKIPKEQLVFXXXXXXXXXXXXXXSCDQIALVSDDSITQDIRYNNSVQLFGDDNQILTVNNEDDLFQYKVVEDTCKDKSNNGRAVIKVEXXXXXXXXXXXLNFKSIE-NSRPAMIGIEIGPVCF 912
            +D ++   +  L++ ++NL  P GSK  PAR+C DI+  +   S+G ++IDPN G   DAI   C+F   +TCI P   +  + ++ ++      +WF       +  A  ++ +S +    QL F++L +  + Q +T  C       D    ++     +V L G ++  L     +  F + V+ED C   +      + +E    +   +  L+   ++        G++IGPVCF
Sbjct: 1117 KDYEVDATIKSLNTQIENLLSPEGSKKNPARTCRDIRLSHPEWSSGFYWIDPNQGCTMDAIKAFCDFSTGQTCIHPHPESIPRKNWYRSSQEKKHTWFGETINSGTEFAYNDETLSPQSMATQLAFMRLLANQAVQNITYHCKNSIAYMD---AENGNLKKAVLLQGSNDVELRAEG-NSRFTFSVLEDGCSRHTGQWSKTV-IEYRTNKPSRLPILDIAPLDIGGADQEFGLDIGPVCF 1351          

HSP 3 Score: 89.7373 bits (221), Expect = 6.232e-17
Identity = 208/520 (40.00%), Postives = 246/520 (47.31%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPG---------MKGPLGVKGDKGQR------------------------GRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSI---------GQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSG---TKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMG 7068
            G PG  GP G  G PG         + GP GVKG++G                          G  G+ G +GP G  GPQG  G PG RG  G+PG  G  G  G +G+ G  G  G  G  GP G PG  G  G+KG  G  G  G           G+ G  G  G  G PG  G  G  G  GP+G KGD    G  G +G  G  GP G  G +G  G++GD GP G      L G PG  G +G  G  G  GP G+ G   P G+ G +G +G +G AG    PG++G  G +G+ G+ GPPG  G  G  G  G  G+ G  G  G PG+ G    PG  G +GE   PG+ G  G PG  GP G  G+ G  GP G +G+ G PG++GP G     G KG +G  G PG AG  GA GP GP G  G  GN GE GP G  G  G  G  GAPG  G  GE G   V G KG+ G  G  G  G QGM G  GP G  G  G  G +GP G
Sbjct:  546 GLPGPAGPVGEAGKPGDRGIPGDQGVSGPAGVKGERGNPGPAGAAGAQGPIGARGPSGTPGPDGNKGEPGAVGPAGAPGPQGAAGMPGERGAAGTPGAKGEKGEAGYRGLEGNAGKDGARGAPGPSGPPGPAGANGDKGETGSFGPPGPAGPRGAPGERGESGPAGPSGFAGPPGADGQTGPRGEKGPAGGKGD---AGPAGPAGPAGNTGPLGPSGPVGPPGARGDSGPTG------LTGFPGAPGRVGPPGPAGIVGPAGLTG---PAGKDGPRGPRGDVGPAG---PPGENGMIGPLGLAGEKGPPGEAGAPGAPGPAGPQGQLGSQGFNGLPGSRGDRGLPGIPGSVGE---PGRVGPAGAPGARGPGGNIGMPGMTGPQGEAGREGSPGNDGPPGRPGAAGIKGDRGEPGSPGTAGPVGAPGPNGPSGAVGRPGNRGESGPSGPTGAVGPAGARGAPGPAGPRGEKG---VAGEKGDRGMKGLRGHPGLQGMPGPNGPSGDSGPAGIAGPSGPRG 1044          

HSP 4 Score: 78.9518 bits (193), Expect = 1.153e-13
Identity = 216/585 (36.92%), Postives = 254/585 (43.42%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRG------NLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGI------------SGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSG------VKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGS---------------KGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTG------------SKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKS------------------XXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            G PG  GP+G  G PG KGP+G  G +G  G  G +G  GP G        G QGP+GAPG +G  G  GPVG AG PG +GI             G  GN G  G  G  G  G RGP G  G  G  G  G++G  G PG  G  G PGE G  G  G  G  G      ++G+ GK G  G  G  GP GP G  G  GE GS               +G+ GP GPSG  G  G  G  G  G +G  G +G  G  G  GP G TG            ++G  G  G+ G PG PG+ G  G  GI G  G  G                             GK+   GP+G +G  GPPG++                  G  G PG  GP GQ G QG  G PG+ G RGLPG  G  G  G  G  G  G  G  G+ G  G  GP+GE G  G+ G  GP G  G AGI+G  G PG PG  G  G    +G  G +G  G+ G  GP G TG  GP G+ G  G  G  G  G                 G +G +G KGL G+PG  G+ GP 
Sbjct:  483 GFPGPKGPSGEAGKPGEKGPVGPTGLRGSPGPDGNNGPAGPVGLAGAPGEKGEQGPSGAPGFQGLPGPAGPVGEAGKPGDRGIPGDQGVSGPAGVKGERGNPGPAGAAGAQGPIGARGPSGTPGPDGNKGEPGAVGPAGAPGPQGAAGMPGERGAAGTPGAKGEKGEAGYRGLEGNAGKDGARGAPGPSGPPGPAGANGDKGETGSFGPPGPAGPRGAPGERGESGPAGPSGFAGPPGADGQTGPRGEKGPAGGKGDAGPAGPAGPAGNTGPLGPSGPVGPPGARGDSGPTGLTGFPGAPGRVGPPGPAGIVGPAGLTGPA---------------------------GKDGPRGPRGDVGPAGPPGENGMIGPLGLAGEKGPPGEAGAPGAPGPAGPQGQLGSQGFNGLPGSRGDRGLPGIPGSVGEPGRVGPAGAPGARGPGGNIGMPGMTGPQGEAGREGSPGNDGPPGRPGAAGIKGDRGEPGSPGTAGPVGAPGPNGPSGAVGRPGNRGESGPSGPTGAVGPAGARGAPGPAGPRGEKG---------------VAGEKGDRGMKGLRGHPGLQGMPGPN 1025          

HSP 5 Score: 75.0998 bits (183), Expect = 1.480e-12
Identity = 183/571 (32.05%), Postives = 231/571 (40.46%), Query Frame = 1
Query: 5656 INGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPR------------------GNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNP------------------GVIGSLGSQGFPG---------------------ARGPQGILGSPGP---RGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIA------------GDNGASGPQ---------------------GPRGENGDLGNTGEQGPVGEV------------GNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGS 7053
            + GP GP+G PG  G  G++G  G+ G  G+ G +G R                  G  G +G  GA G RG  G+PG  G  GH G  GI GR                     +GE G+ G  G  G+ G +G PG  G RG PGE G  G AG  G  G  G+ G  G  G  G  GP G  G  G  GELG     GP GPSG+ G RG P                  G+ G+ G+ G PG                     A GP+G+ G PGP   +G +G KG  G+ G  G PG  G++GK G  G                                          + GP GPLG RGP G +      G  G PG +G  GP+G PG  G  G PG+ GP G  G  G  G  G  G+             G +GA+G                       GP+G +G+ G  GE+GPVG              G AG  G+ GAPG  G+ G +G     G  G  GP+G +G+ G +G+ G QG  G  G+KG+ G+
Sbjct:   85 LMGPRGPSGSPGAPGAQGLQGHAGEPGEPGQAGAIGARGPPGPPGKNGEDGNNGRPGKPGDRGVLGAQGARGFPGTPGLPGMKGHRGYNGIDGR---------------------KGEPGAAGAKGENGAAGSNGTPGQRGGRGLPGERGRVGPAGPAGARGADGNTGPAGPAGPLGSAGPPGFPGAPGPKGELGP---AGPTGPSGAQGQRGEPGPNGAVGPVGPPGNPGANGINGAKGAAGLPGIAGAPGFPGPRGGPGPQGPSGASGPRGLGGDPGPVGVKGDSGVKGEPGSAGPQGPPGPSGEEGKRGSTG------------------------------------------EQGPTGPLGLRGPRGAA------GTRGLPGLAGRSGPMGMPGPRGGVGAPGARGPPGDAGRAGEAGLVGARGLPGSPGSSGPPGKEGPSGAAGQDGRTGPPGPTGPRGQPGNIGFPGPKGPSGEAGKPGEKGPVGPTGLRGSPGPDGNNGPAGPVGLAGAPGEKGEQGPSGAPGFQGLPGPAGPVGEAGKPGDRGIPGDQGVSGPAGVKGERGN 583          

HSP 6 Score: 71.2478 bits (173), Expect = 2.404e-11
Identity = 202/539 (37.48%), Postives = 245/539 (45.45%), Query Frame = 1
Query: 5704 LGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPG---------------KSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTG---------------------EQGPVGEVGNAGI---RGVNGAPGIPGKDGENGK------DAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIG 7185
            +G  G KG  G  GK G  GP   +GP G  G+PG  G  G  GPVG AG PG +G                               QG  G  G  G  G  G  G+ G PG+ G PG  G+ GP+GVKG+ G  G  G +G +GP G RG  G  G  G+KG+ G +GP+G+PG +G  G+ G  G+ G PGA+G +G  G  G  G  G  G++G  G +G PG  G +G  G+ G        G PGP GP G PG  G+ G  GP+GF G PG + Q GP+   GE+GP G                +G  G  G VGPPG  G  GP G  G  G  G  G  GP+G  G  G  GP GK G  G  G  GP GP GENG +G  G                      QG +G  G  G+   RG  G PGIPG  GE G+          G  GNI            GM G+ GP G  G +G  G+ GP GR G                 G KGD+G PG+PGT G +G
Sbjct:  482 IGFPGPKGPSGEAGKPGEKGP---VGPTGLRGSPGPDGNNGPAGPVGLAGAPGEKG------------------------------EQGPSGAPGFQGLPGPAGPVGEAGKPGDRGIPGDQGVSGPAGVKGERGNPGPAGAAGAQGPIGARGPSGTPGPDGNKGEPGAVGPAGAPGPQGAAGMPGERGAAGTPGAKGEKGEAGYRGLEGNAGKDGARGAPGPSGPPGPAGANGDKGETG------SFGPPGPAGPRGAPGERGESGPAGPSGFAGPPGADGQTGPR---GEKGPAGGKGDAGPAGPAGPAGNTGPLGPSGPVGPPGARGDSGPTGLTGFPGAPGRVGPPGPAGIVGPAGLTGPAGKDGPRGPRGDVGPAGPPGENGMIGPLGLAGEKGPPGEAGAPGAPGPAGPQGQLGSQGFNGLPGSRGDRGLPGIPGSVGEPGRVGPAGAPGARGPGGNI------------GMPGMTGPQGEAGREGSPGNDGPPGRPGAA---------------GIKGDRGEPGSPGTAGPVG 951          

HSP 7 Score: 70.0922 bits (170), Expect = 4.715e-11
Identity = 136/363 (37.47%), Postives = 162/363 (44.63%), Query Frame = 1
Query: 5977 GIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGT------KGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDI 7047
            G  G  G  G+PG      APG  G PG AGI GP+G+ G  GK G                       G +GD+GP GP G  G+ G  G+ G  G  G  GA G  G  G  G  G  G  G  G+ G  G+PG PG  G+ G+VG  G  G  G  G +G                            PG  GP GE G  G  G+DG PG  G  G  G +G  G PG +G  G PG NGPSG       +G  G  GP G  G AG  GA GP GPRGE G  G  G++G  G  G+ G++G+ G  G  G  G  G     G +G  GP G +G+ G  GM G  GPPG  G  G +
Sbjct:  768 GDSGPTGLTGFPG------APGRVGPPGPAGIVGPAGLTGPAGKDG---------------------PRGPRGDVGPAGPPGENGMIGPLGLAGEKGPPGEAGAPGAPGPAGPQGQLGSQGFNGLPGSRGDRGLPGIPGSVGEPGRVGPAGAPGARGPGGNIG---------------------------MPGMTGPQGEAGREGSPGNDGPPGRPGAAGIKGDRGEPGSPGTAGPVGAPGPNGPSGAVGRPGNRGESGPSGPTGAVGPAGARGAPGPAGPRGEKGVAGEKGDRGMKGLRGHPGLQGMPGPNGPSGDSGPAGIAGPSGPRGPAGPNGPAGKDGSNGMPGAIGPPGHRGPAGHV 1076          

HSP 8 Score: 69.3218 bits (168), Expect = 8.941e-11
Identity = 196/503 (38.97%), Postives = 232/503 (46.12%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSP---------GPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPG------------------SDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMG 7068
             G  G NG  G  G PG +G  G+ G++G+ G  G  G  G  GN GP GP G  G  G  G P         GP G  G  G QG  G PG  G  G  GPPG PG              GI G+ G  G PG                    G  G  G  GDPG  G+ G SGVKG+             G  GP+G  G  GE G +G  G  GP+G  GLRG     G+ G++G PG  G  G +G PGPRG  G+ G++G  G AG     G+ G  G  G+PG  G  G PG  GP G  G  G+ G PGP G  G PG    PGP+GP GE G PG+                  +GP+GP   +G RG PG +G         + GP G  G+AG  G  G QGP G  G  G  G  GPVGE G  G RG      IPG  G +G   V G +GN GP G++G +GP G  G  G PG  G KG+ G+ GP G
Sbjct:  185 AGAKGENGAAGSNGTPGQRGGRGLPGERGRVGPAGPAGARGADGNTGPAGPAGPLGSAGPPGFPGAPGPKGELGPAGPTGPSGAQGQRGEPGPNGAVGPVGPPGNPGAN------------GINGAKGAAGLPGIAGAPGFPGPRGGPGPQGPSGASGPRGLGGDPGPVGVKGDSGVKGE------------PGSAGPQGPPGPSGEEGKRGSTGEQGPTGPLGLRG---PRGAAGTRGLPGLAGRSGPMGMPGPRGGVGAPGARGPPGDAG---RAGEAGLVGARGLPGSPGSSGPPGKEGPSGAAGQDGRTGPPGPTGPRGQPGNIGFPGPKGPSGEAGKPGE------------------KGPVGP---TGLRGSPGPDG---------NNGPAGPVGLAGAPGEKGEQGPSGAPGFQGLPGPAGPVGEAGKPGDRG------IPGDQGVSGPAGVKGERGNPGPAGAAGAQGPIGARGPSGTPGPDGNKGEPGAVGPAG 621          

HSP 9 Score: 64.3142 bits (155), Expect = 2.993e-9
Identity = 121/309 (39.16%), Postives = 138/309 (44.66%), Query Frame = 1
Query: 5653 GINGPTGPTGVPGMKG------PLGVKGDKGQRGRMGKDGILGPRGNLGPQGP---------------------------------TGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGS------------PGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGT---PGKDGKAGQV 6417
            G +GPTG TG PG  G      P G+ G  G  G  GKDG  GPRG++GP GP                                  G  G +G  G PG  G+ G PG+ G  G PG  G  G  G  G  G  G  G  G QG  G +GS G DG PG  G  G  G+ G+PG  G  GP G  G  G +G  GR G RG  GP G  G +G  G++G  GP GP G              GLRG+PG+ G  G  G  G  GP GI G  GPRG  G  G  G  G  G+PG    PG  G AG V
Sbjct:  768 GDSGPTGLTGFPGAPGRVGPPGPAGIVGPAGLTGPAGKDGPRGPRGDVGPAGPPGENGMIGPLGLAGEKGPPGEAGAPGAPGPAGPQGQLGSQGFNGLPGSRGDRGLPGIPGSVGEPGRVGPAGAPGARGPGGNIGMPGMTGPQGEAGREGSPGNDGPPGRPGAAGIKGDRGEPGSPGTAGPVGAPGPNGPSGAVGRPGNRGESGPSGPTGAVGPAGARGAPGPAGPRGEKGVAGEKGDRGMKGLRGHPGLQGMPGPNGPSGDSGPAGIAGPSGPRGPAGPNGPAGKDGSNGMPGAIGPPGHRGPAGHV 1076          

HSP 10 Score: 58.151 bits (139), Expect = 2.424e-7
Identity = 134/364 (36.81%), Postives = 167/364 (45.88%), Query Frame = 1
Query: 6022 GKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPG---------------SNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMG 7068
            G RG  G  G PG  G+ G +G  G+PG+ G  G  G  GP G  G  G  G  G  GD G +G  G+ G  G PG+ G  G +G+ G  G +G  G+ G +G  G+ GS GT G  G  G PG+ G+ G  G                                      G     G  GP G  GP G +G  G PG  GP G+ G  GP GP G  GQRG PG               +NG +G KG  G  G  G PG  G  G  GPQGP G +G  G  G+ GPVG  G++G++G  G+ G  G  G +G++   G+ G  GP G  G RGP+G  G +G PG  G  G +G  GP G
Sbjct:   87 GPRGPSGSPGAPGAQGLQGHAGEPGEPGQAGAIGARGPPGPPGKNGEDGNNGRPGKPGDRGVLGAQGARGFPGTPGLPGMKGHRGYNGIDGRKGEPGAAGAKGENGAAGSNGTPGQRGGRGLPGERGRVGPAGPA------------------------------------GARGADGNTGPAGPAGPLGSAGPPGFPGAPGPKGELGPAGPTGPSGAQGQRGEPGPNGAVGPVGPPGNPGANGINGAKGAAGLPGIAGAPGFPGPRGGPGPQGPSGASGPRGLGGDPGPVGVKGDSGVKGEPGSAGPQGPPGPSGEEGKRGSTGEQGPTGPLGLRGPRGAAGTRGLPGLAGRSGPMGMPGPRG 414          

HSP 11 Score: 56.9954 bits (136), Expect = 4.874e-7
Identity = 140/362 (38.67%), Postives = 162/362 (44.75%), Query Frame = 1
Query: 5677 TGVPGMKGPLGVKGDKGQRGRM---GKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGL------RGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKG 6735
             G  G  GP G+ G  G  GR+   G  GI+GP G  GP G  G  G RG VG  GP G  G  G  G++G    +G PG  G PG PG  GP+G+ GSQG  G+ GS G  G PG  G  G PG  G  G  G  GP G  G PG T                  G  GE G +G  G  GP G PG       RG PG  G+ G  G PG  GP G +G PG RG +G  G  G +G AG  G PG  G  G+ G+                      G+ G  G  G  G PG    PGP GP G+ GP G +G  G           G  GP GP G  G  G+PG+ GP G +G  G
Sbjct:  764 PGARGDSGPTGLTGFPGAPGRVGPPGPAGIVGPAGLTGPAGKDGPRGPRGDVGPAGPPGENGMIGPLGLAGE---KGPPGEAGAPGAPGPAGPQGQLGSQGFNGLPGSRGDRGLPGIPGSVGEPGRVGPAGAPGARGPGGNIGMPGMT------------------GPQGEAGREGSPGNDGPPGRPGAAGIKGDRGEPGSPGTAGPVGAPGPNGPSGAVGRPGNRGESGPSGPTGAVGPAGARGAPGPAGPRGEKGV---------------------AGEKGDRGMKGLRGHPGLQGMPGPNGPSGDSGPAGIAGPSGP---------RGPAGPNGPAGKDGSNGMPGAIGPPGHRGPAG 1074          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Zebrafish
Match: col2a1a (collagen, type II, alpha 1a [Source:ZFIN;Acc:ZDB-GENE-980526-192])

HSP 1 Score: 156.762 bits (395), Expect = 2.154e-37
Identity = 86/254 (33.86%), Postives = 124/254 (48.82%), Query Frame = 1
Query: 8512 PVRTVRRD-----LLNDDALAVKYLGS-----DVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASDV-TEYRSWFGE-ITGTFKFDY-------QIEASQLMFLKLFSTNARQRITINCSRL-----SVVGNSEHPVILYSDHDEEVLRNGD-LFKYSVIRDGCKNSAEIIDSTELEMDTEAI-RLPIRDIA-LNTGSSKEQQQFGLDIGQVCF 9192
            P+R +R D     L   D      L S     + ++ P G++  PAR+C+ L   +P  + G Y++DPN G A DA +V C  +  E+C++  +P    K+W  S    +   WFGE + G F F Y            QL FL+L ST A Q IT +C           GN +  ++L   +D E+   G+  F Y V+ DGCK        T +E  T+   RLPI DIA ++ G +   Q+FG+DIG VCF
Sbjct: 1239 PLRYMRADEASSSLRQHDVEVDATLKSINGQIEDIRSPDGSRKNPARSCRDLKLCHPEWKSGDYWVDPNLGSAADAIKVFCNMETGETCVKPSTPKIPRKNWWTSKSKAQKHVWFGESMNGGFHFSYADGSQTPSTTTIQLNFLRLLSTEATQTITYHCKNSVAYMDQATGNLKKAILLQGSNDVEIRAEGNSRFTYGVLEDGCKKHTGQWAKTVIEYKTQKTSRLPIMDIAPMDIGGA--DQEFGVDIGAVCF 1490          

HSP 2 Score: 100.523 bits (249), Expect = 3.251e-20
Identity = 220/544 (40.44%), Postives = 263/544 (48.35%), Query Frame = 1
Query: 5659 NGPTGPTGVPGMKGPLGVKGDKG---QRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFP---GARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSN------------GPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGK---------------DGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
             G  GP G PG  GPLG  G++G    RG  G+DG+ G +G  G +G  G  G +G  G PG  G  G PG +G++GRPG+ G  G  G  G PG  G  G  G        G+ GQ G  G  G +GA GE G PG+ G+ G +G++G PGK       G  GP GP G  G +GE G +G  GP G  G PG  G PG  G  G QG P   GA GP G  G  G  G  G  G QG  G  G+PGTPG DG  G +G  G  G  G PG  G  G  G  G  G  G        G + + GP+G  G+ G  G +G  G PG  GP G  G  GPIG  G  G RG PG              GP G  G  G+KG  G+ G  GD+GA GPQGP G  G +G TG  GP G  G  G  G  G PG  G+                G +GKD   G +G+ GP G +G        G++GPPG+ G KG+ G  GP G  G  G  G  G  G  G  G +G++G PG PG  G  G Q
Sbjct:  492 EGKRGPRGEPGSAGPLGPPGERGAPGNRGFPGQDGLAGAKGAPGDRGVPGLSGPKGGTGDPGRPGEPGLPGARGLTGRPGDAGAQGKVGATGAPGEDGRPGPPGP------LGARGQPGVMGFPGPKGANGEPGKPGEKGLVGRTGLRGLPGKD------GETGPSGPPGPVGAVGERGEQGQPGPSGFQGLPGPTGAPGEPGKPGDQGVPGEGGAAGPTGPRGERGFPGERGGAGPQGLQGPRGLPGTPGTDGPKGAIGPAGAAGAQGPPGLQGMPGERGAVGISGAKGDR------GDSGEKGPEGAPGKDGSRGLTGPIGPPGPSGPNGAKGETGPIGSIGAPGARGAPGDRGEIGAPGPAGFAGPPGADGQPGNKGEQGESGQKGDSGAPGPQGPSGAPGPVGPTGVTGPKGARGAQGAPGATGFPGAAGRVGPPGPNGNPGAAGPAGPSGKDGPKGVRGDAGPPGRAGD------AGLRGPPGAPGEKGEAGEDGPPGPDGPSGPAGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQ 1011          

HSP 3 Score: 92.4337 bits (228), Expect = 8.014e-18
Identity = 187/456 (41.01%), Postives = 224/456 (49.12%), Query Frame = 1
Query: 5743 GKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHG------DPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDG------------ENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGST 7056
            G  G  GP G  GP+G  G  G  GT GSPGP G +G+PG  GI G  G+ G  G+ G PG PG RGP G +G+ G LG KG  G  G PG  G+ G  GE G       PG +G +G  G +G+P                           GS G +GP G  G+PG RG PG  G  G++G PG RG  G+ G  G  G  G  G  G  G  G+ G PG  G  G+VG  G  G  GRPGP GP+G  G PG  G PGP G  G PGK  + G  G  G RG PGK G+ G  G  GP G  G +G  G PG SG +GLPG  G  G  G  G +      G+ G+ GA+GP GPRGE G  G  G  GP       G++G  G PG PG DG              G   + G  G  G +G SG +G +G +G +GP G+ G  G  G T
Sbjct:  376 GSKGEAGPTGARGPEGAQGPRGEAGTPGSPGPAGASGNPGTDGIPGAKGSAGASGIAGAPGFPGPRGPPGPQGATGPLGPKGQSGDPGIPGFKGEAGPKGERGVLGPQGPPGPSGEEGKRGPRGEP---------------------------GSAGPLGPPGERGAPGNRGFPGQDGLAGAKGAPGDRGVPGLSGPKGGTGDPGRPGEPGLPGARGLTGRPGDAGAQGKVGATGAPGEDGRPGPPGPLGARGQPGVMGFPGPKGANGEPGKPGEKGLVGRTGLRGLPGKDGETGPSGPPGPVGAVGERGEQGQPGPSGFQGLPGPTGAPGEPGKPGDQ------GVPGEGGAAGPTGPRGERGFPGERGGAGP------QGLQGPRGLPGTPGTDGPKGAIGPAGAAGAQGPPGLQGMPGERGAVGISGAKGDRGDSGEKGPEGAPGKDGSRGLT 792          

HSP 4 Score: 89.7373 bits (221), Expect = 6.521e-17
Identity = 66/269 (24.54%), Postives = 117/269 (43.49%), Query Frame = -3
Query:  229 EKISSIDPNDEDEDIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCIEPEVVNYKKTSYTKTISSWFSVLASLNKQISY-KIPKEQLVFXXXXXXXXXXXXXXSCDQIALVSDDSITQDIRYN--NSV----QLFGDDNQILTVNNEDDL---------FQYKVVEDTCKDKSNN-GRAVIKVEXXXXXXXXXXXLNFKSIENSR-PAM-------------IGIEIGPVCF 942
            E  SS+     D ++   L  ++  ++++  P GS+  PARSC D++  +    +G +++DPN G   DAI V CN +  ETC++P      +        +W++  +   K + + +       F       +  T T+  + + L+S ++ TQ I Y+  NSV    Q  G+  + + +   +D+         F Y V+ED CK  +    + VI+               +K+ + SR P M              G++IG VCF
Sbjct: 1247 EASSSL--RQHDVEVDATLKSINGQIEDIRSPDGSRKNPARSCRDLKLCHPEWKSGDYWVDPNLGSAADAIKVFCNMETGETCVKPSTPKIPR-------KNWWTSKSKAQKHVWFGESMNGGFHFSYADGSQTPSTTTIQLNFLRLLSTEA-TQTITYHCKNSVAYMDQATGNLKKAILLQGSNDVEIRAEGNSRFTYGVLEDGCKKHTGQWAKTVIE---------------YKTQKTSRLPIMDIAPMDIGGADQEFGVDIGAVCF 1490          

HSP 5 Score: 84.3445 bits (207), Expect = 2.648e-15
Identity = 179/533 (33.58%), Postives = 217/533 (40.71%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKG------QRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQG---------ILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSG---------------------------QRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGP---------RGENGDLGNT---------GEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
            TG  G  G +G  G+PG KG  G KG++G        G  G++G  GPRG  G  GP G PG RG  G      N G PG  G++G                           ++G  G +G  G  G  G  G  G PGE G PG  G+ G  G  G  GK G  G  G  G  GP G  G  G+ G  G  GP G +G PG  G  G++G  G +G PG  G  G          +G  G +G+ G  G QG  G  G PG PGK G  G                                        PG+    GP GP GERG PG+ G  G           GLQGP G PG  G                           +RG  G +G  G +G+ G KGP G PG  G  G +GP GP         +GE G +G+          G++G +G  G AG  G  GA G PG  GE G+    G  G  GP G SG  GP G TG+ GP G+ G +G  G+TG
Sbjct:  450 TGPLGPKGQSGDPGIPGFKGEAGPKGERGVLGPQGPPGPSGEEGKRGPRGEPGSAGPLGPPGERGAPG------NRGFPGQDGLAG---------------------------AKGAPGDRGVPGLSGPKGGTGDPGRPGEPGLPGARGLTGRPGDAGAQGKVGATGAPGEDGRPGPPGPLGARGQPGVMGFPGPKGANGEPGKPGEKGLVGRTGLRGLPGKDGETGPSGPPGPVGAVGERGEQGQPGPSGFQGLPGPTGAPGEPGKPGDQG---------------------------------------VPGEGGAAGPTGPRGERGFPGERGGAGP---------QGLQGPRGLPGTPGTDGPKGAIGPAGAAGAQGPPGLQGMPGERGAVGISGAKGDRGDSGEKGPEGAPGKDGSRGLTGPIGPPGPSGPNGAKGETGPIGSIGAPGARGAPGDRGEIGAPGPAGFAGPPGADGQPGNKGEQGESGQKGDSGAPGPQGPSGAPGPVGPTGVTGPKGARGAQGAPGATG 901          

HSP 6 Score: 73.9442 bits (180), Expect = 3.533e-12
Identity = 203/527 (38.52%), Postives = 237/527 (44.97%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGR---------------------RGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDI---GPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRT---------------GSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQ------PGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKG------------------SKGPYGKPGIAGDN---------------GASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRG 6987
            TG PG  G  G  GVPG  G  G  G +G+RG  G+ G  GP+G  GP+G  G PG                      +G  G  G VG +G  G +G SG  G +G PG  G  GL G  GP G  G  G  G  G IG  G PG+ G  G  GE G PG AG  GP G  G PG                    G  GE G KGD    GP GPSG+PG  G  GV G  G++   GA+G  G  G PG  GR                G  G  G  G+ G  G PG+ G AG  G PG  G  G  G  GP G  G  G  G  G  G  G PG+  +      PGP G  G++G PG SGD G PG VGPPG +G  G  G  GN G  G PG +G +G KG +G                  S GP GK G  G+N               G  GPQGPRG+ G+ G  GE+G  G  G  G++G+ G PG PG  G  G     GAKG  GP+G +G+ G
Sbjct:  675 TGAPGEPGKPGDQGVPGEGGAAGPTGPRGERGFPGERGGAGPQGLQGPRGLPGTPGTDGPKGAIGPAGAAGAQGPPGLQGMPGERGAVGISGAKGDRGDSGEKGPEGAPGKDGSRGLTGPIGPPGPSGPNGAKGETGPIGSIGAPGARGAPGDRGEIGAPGPAGFAGPPGADGQPGNK------------------GEQGESGQKGDSGAPGPQGPSGAPGPVGPTGVTGPKGAR---GAQGAPGATGFPGAAGRVGPPGPNGNPGAAGPAGPSGKDGPKGVRGDAGPPGRAGDAGLRGPPGAPGEKGEAGEDGPPGPDGPSGPAGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGGSGDRGPPGPVGPPGLTGPAGETGREGNPGSDGPPGRDGAAGVKGERGNTGPIGAPGAPGAPGAPGSVGPIGKQGDRGENGPQGPAGPPGPAGARGMVGPQGPRGDKGEAGEAGERGQKGHRGFTGLQGLPGPPGSPGDQGAAGPAGPSGAKGPSGPVGPAGKDG 1180          

HSP 7 Score: 55.4546 bits (132), Expect = 1.626e-6
Identity = 68/185 (36.76%), Postives = 84/185 (45.41%), Query Frame = 1
Query: 6640 SGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNG------------------ASGPQGPRGENGDLG---------------------------NTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
            +G +GP G  G  G+ G PGS GP+G  GN G+ G  G  G AG +G                  A+GP GP+G++GD G                             G++GP GE G+AG  G  G  G PG  G  G+D + GAKG  G  G  G  GP+G TG  G PG  GL G  G TG
Sbjct:  384 TGARGPEGAQGPRGEAGTPGSPGPAGASGNPGTDGIPGAKGSAGASGIAGAPGFPGPRGPPGPQGATGPLGPKGQSGDPGIPGFKGEAGPKGERGVLGPQGPPGPSGEEGKRGPRGEPGSAGPLGPPGERGAPGNRGFPGQDGLAGAKGAPGDRGVPGLSGPKGGTGDPGRPGEPGLPGARGLTG 568          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Zebrafish
Match: col2a1a (collagen, type II, alpha 1a [Source:ZFIN;Acc:ZDB-GENE-980526-192])

HSP 1 Score: 155.606 bits (392), Expect = 4.989e-37
Identity = 86/254 (33.86%), Postives = 124/254 (48.82%), Query Frame = 1
Query: 8512 PVRTVRRD-----LLNDDALAVKYLGS-----DVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASDV-TEYRSWFGE-ITGTFKFDY-------QIEASQLMFLKLFSTNARQRITINCSRL-----SVVGNSEHPVILYSDHDEEVLRNGD-LFKYSVIRDGCKNSAEIIDSTELEMDTEAI-RLPIRDIA-LNTGSSKEQQQFGLDIGQVCF 9192
            P+R +R D     L   D      L S     + ++ P G++  PAR+C+ L   +P  + G Y++DPN G A DA +V C  +  E+C++  +P    K+W  S    +   WFGE + G F F Y            QL FL+L ST A Q IT +C           GN +  ++L   +D E+   G+  F Y V+ DGCK        T +E  T+   RLPI DIA ++ G +   Q+FG+DIG VCF
Sbjct: 1101 PLRYMRADEASSSLRQHDVEVDATLKSINGQIEDIRSPDGSRKNPARSCRDLKLCHPEWKSGDYWVDPNLGSAADAIKVFCNMETGETCVKPSTPKIPRKNWWTSKSKAQKHVWFGESMNGGFHFSYADGSQTPSTTTIQLNFLRLLSTEATQTITYHCKNSVAYMDQATGNLKKAILLQGSNDVEIRAEGNSRFTYGVLEDGCKKHTGQWAKTVIEYKTQKTSRLPIMDIAPMDIGGA--DQEFGVDIGAVCF 1352          

HSP 2 Score: 88.9669 bits (219), Expect = 8.586e-17
Identity = 67/269 (24.91%), Postives = 118/269 (43.87%), Query Frame = -3
Query:  229 EKISSIDPNDEDEDIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCIEPEVVNYKKTSYTKTISSWFSVLASLNKQISY-KIPKEQLVFXXXXXXXXXXXXXXSCDQIALVSDDSITQDIRYN--NSV----QLFGDDNQILTVNNEDDL---------FQYKVVEDTCKDKSNN-GRAVIKVEXXXXXXXXXXXLNFKSIENSR-PAM-------------IGIEIGPVCF 942
            E  SS+  +D + D    L  ++  ++++  P GS+  PARSC D++  +    +G +++DPN G   DAI V CN +  ETC++P      +        +W++  +   K + + +       F       +  T T+  + + L+S ++ TQ I Y+  NSV    Q  G+  + + +   +D+         F Y V+ED CK  +    + VI+               +K+ + SR P M              G++IG VCF
Sbjct: 1109 EASSSLRQHDVEVDA--TLKSINGQIEDIRSPDGSRKNPARSCRDLKLCHPEWKSGDYWVDPNLGSAADAIKVFCNMETGETCVKPSTPKIPR-------KNWWTSKSKAQKHVWFGESMNGGFHFSYADGSQTPSTTTIQLNFLRLLSTEA-TQTITYHCKNSVAYMDQATGNLKKAILLQGSNDVEIRAEGNSRFTYGVLEDGCKKHTGQWAKTVIE---------------YKTQKTSRLPIMDIAPMDIGGADQEFGVDIGAVCF 1352          

HSP 3 Score: 84.7297 bits (208), Expect = 1.709e-15
Identity = 177/463 (38.23%), Postives = 214/463 (46.22%), Query Frame = 1
Query: 5743 GKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHG------DPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGP-------LGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDG------------ENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGST 7056
            G  G  GP G  GP+G  G  G  GT GSPGP G +G+PG  GI G  G+ G  G+ G PG PG RGP G +G+ G LG KG  G  G PG  G+ G  GE G       PG +G +G  G +G+P                           GS G +GP G  G+PG RG PG  G  G++G PG RG  G+ G  G  G  G  G  G  G  G+ G PG  G  G+VG                 G PG  G+ G PGP G  G PG    PGP+G            G PGK G+ G  G  GP G  G +G  G PG SG +GLPG  G  G  G  G +      G+ G+ GA+GP GPRGE G  G  G  GP       G++G  G PG PG DG              G   + G  G  G +G SG +G +G +G +GP G+ G  G  G T
Sbjct:  270 GSKGEAGPTGARGPEGAQGPRGEAGTPGSPGPAGASGNPGTDGIPGAKGSAGASGIAGAPGFPGPRGPPGPQGATGPLGPKGQSGDPGIPGFKGEAGPKGERGVLGPQGPPGPSGEEGKRGPRGEP---------------------------GSAGPLGPPGERGAPGNRGFPGQDGLAGAKGAPGDRGVPGLSGPKGGTGDPGRPGEPGLPGARGLTGRPGDAGAQGKVGA---------------TGAPGEDGRPGPPGPLGARGQPGVMGFPGPKGANVKPSEHFCISGLPGKDGETGPSGPPGPVGAVGERGEQGQPGPSGFQGLPGPTGAPGEPGKPGDQ------GVPGEGGAAGPTGPRGERGFPGERGGAGP------QGLQGPRGLPGTPGTDGPKGAIGPAGAAGAQGPPGLQGMPGERGAVGISGAKGDRGDSGEKGPEGAPGKDGSRGLT 678          

HSP 4 Score: 68.9366 bits (167), Expect = 1.211e-10
Identity = 190/491 (38.70%), Postives = 223/491 (45.42%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNG------------------APGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
             GE G  G  GP+G  G+ GP G  G+ G+ G  G  G  G  G  GP+G  G PG RG  G  G  G  G PG  G  G                     P+G  G  G  G +G  G  G PG  G  G  G  GD G +G  GP G    PGK G+ G +G  GP GP G  G  G+      +      G+ G  GN G  G  G +G  GA GPQG  G+PGP G TG  G +G  G  G PG  G  G AG+VG PG NG PG  GP GP G  G  G  G  GP G  G  G     GP G  GE+G  G+ G  G  G  GP G +G +G +G PG  G+RG PG  GPSG  G +G+ G  G  G  G  G  G  GP GE G  GN G  GP G  G AG++G  G                  + G  GK G+ G++     K     I   G +GP+G  G  G  G  G KG  G TG
Sbjct:  540 VGERGEQGQPGPSGFQGLPGPTGAPGEPGKPGDQGVPGEGGAAGPTGPRGERGFPGERGGAGPQGLQGPRGLPGTPGTDG---------------------PKGAIGPAGAAGAQGPPGLQGMPGERGAVGISGAKGDRGDSGEKGPEGA---PGKDGSRGLTGPIGPPGPSGPNGAKGKTNLTQTLHYFSLQGADGQPGNKGEQGESGQKGDSGAPGPQGPSGAPGPVGPTGVTGPKGARGAQGAPGATGFPGAAGRVGPPGPNGNPGAAGPAGPSGKDGPKGVRGDAGPPGRAGDAGLR---GPPGAPGEKGEAGEDGPPGPDGPSGPAGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGGSGDRGPPGPVGPPGLTGPAGETGREGNPGSDGPPGRDGAAGVKGERGNTGPIGAPGAPGAPGAPGSVGPIGKQGDRGENVSKLPKSYFTLIHKCGPQGPRGDKGEAGEAGERGQKGHRGFTG 1003          

HSP 5 Score: 64.3142 bits (155), Expect = 3.284e-9
Identity = 181/539 (33.58%), Postives = 229/539 (42.49%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQG---------------------------PTGAPGRRGTV---GSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGAR------------------------GPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQ------PGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKG------------------SKGPYGKPGIAGDNGA------------SGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRG 6987
            TG PG  G  G  GVPG  G  G  G +G+RG  G+ G  GP+G  GP+G                             G PG RG V   G+ G  G++G  G +G  G+ G++G  G  GPPG  G  G +G+      L      G DG PG+ G++G  G+ GD G  G  GPSG                                      GP+GP+G  G +G  G  G+ G+ GFPGA                         GP+G+ G  GP GR G        G+ G PG PG+ G+AG+                GP G  G  G  G  G  G  G PG+  +      PGP G  G++G PG SGD G PG VGPPG +G  G  G  GN G  G PG +G +G KG +G                  S GP GK G  G+N +             GPQGPRG+ G+ G  GE+G  G  G  G++G+ G PG PG  G  G     GAKG  GP+G +G+ G
Sbjct:  561 TGAPGEPGKPGDQGVPGEGGAAGPTGPRGERGFPGERGGAGPQGLQGPRGLPGTPGTDGPKGAIGPAGAAGAQGPPGLQGMPGERGAVGISGAKGDRGDSGEKGPEGAPGKDGSRGLTGPIGPPGPSGPNGAKGKTNLTQTLHYFSLQGADGQPGNKGEQGESGQKGDSGAPGPQGPSGAP------------------------------------GPVGPTGVTGPKGARGAQGAPGATGFPGAAGRVGPPGPNGNPGAAGPAGPSGKDGPKGVRGDAGPPGRAGD------AGLRGPPGAPGEKGEAGE---------------DGPPGPDGPSGPAGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGGSGDRGPPGPVGPPGLTGPAGETGREGNPGSDGPPGRDGAAGVKGERGNTGPIGAPGAPGAPGAPGSVGPIGKQGDRGENVSKLPKSYFTLIHKCGPQGPRGDKGEAGEAGERGQKGHRGFTGLQGLPGPPGSPGDQGAAGPAGPSGAKGPSGPVGPAGKDG 1042          

HSP 6 Score: 61.2326 bits (147), Expect = 2.395e-8
Identity = 215/608 (35.36%), Postives = 254/608 (41.78%), Query Frame = 1
Query: 5659 NGPTGPTGVPGMKGPLGVKGDKG---QRGRMGKDGILGPRGN---------LGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGS-------IGQDGYPGSDGKR------------GAPGEHGDPGKAGIDG---PSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIG---------------SLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASG---------------PQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGA------KGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPG---------------------------TPGVIGPQ 7191
             G  GP G PG  GPLG  G++G    RG  G+DG+ G +G           GP+G TG PGR G  G PG  G  G PG  G  G+ G  G PG  G PG PG  G  G+ G  G  G KG+           G PG DG+             G  GE G PG +G  G   P+G  G+PGK G+ G  G  G  GP G RG  G  G +G  GP G  G  GL G PG  G                 G QG PG RG  GI G+ G RG +G KG +G          PGKDG  G  G  G  GP G  G  G   L                   G + QPG +G  GE                     SG +G  G PG  G  G PG  GP+G  G KG++G  G PG  G  GA+G               P GP G++G  G  G+ GP G  G+AG+RG  GAPG  G+ GE+G    DG        G  G +G  G+RG +G  G+ GP G  G +G  G +G  G  G  G PG  G  G  G EG  G  G PG  G                           + G IG Q
Sbjct:  386 EGKRGPRGEPGSAGPLGPPGERGAPGNRGFPGQDGLAGAKGAPGDRGVPGLSGPKGGTGDPGRPGEPGLPGARGLTGRPGDAGAQGKVGATGAPGEDGRPGPPGPLGARGQPGVMGFPGPKGANVKPSEHFCISGLPGKDGETGPSGPPGPVGAVGERGEQGQPGPSGFQGLPGPTGAPGEPGKPGDQGVPGEGGAAGPTGPRGERGFPGERGGAGPQGLQGPRGLPGTPGTDGPKGAIGPAGAAGAQGPPGLQGMPGERGAVGISGAKGDRGDSGEKGPEGA---------PGKDGSRGLTGPIGPPGPSGPNGAKGKTNLTQTLHYFSLQ---------GADGQPGNKGEQGE---------------------SGQKGDSGAPGPQGPSGAPGPVGPTGVTGPKGARGAQGAPGATGFPGAAGRVGPPGPNGNPGAAGPAGPSGKDGPKGVRGDAGPPGRAGDAGLRGPPGAPGEKGEAGEDGPPGPDGPSGPAGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGGSGDRGPPGPVGPPGLTGPAGETGREGNPGSDGPPGRDGAAGVKGERGNTGPIGAPGAPGAPGAPGSVGPIGKQ 954          

HSP 7 Score: 56.9954 bits (136), Expect = 4.834e-7
Identity = 185/524 (35.31%), Postives = 226/524 (43.13%), Query Frame = 1
Query: 5797 GAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKR---------------------------------GAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTG---------------EQGPVGEVGNAGIRGVNGAP-------GIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGP---------PGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPG 7176
            G PG+ G  G PGP G  G PG  G+ G  G++G PG+ G  G  G  G +GE GS G  G  G +G  G PG  G+                                  G+PG  G+ G  G  GP G +G  G                        E G+ G  GP G SG+PG  G PG  GS G+ G  GA G  G  G PGP+G TG  G +G  G  G+PG  G+ G  G+ G+ G  GPPG  G  G  G                    G+    GP GP GERG PG           G PGQ GL G  G PG+   RG+PG +GP   KG  G  G  G+PG+ G  G +G  G  G  G +G TG                +G  G +G  G +G N  P       G+PGKDGE G     G  G +G  G  G+ GP G  G+ GP         PG  G+ G+ G+ GP G     G  G PG  G  GP+G +G +GLPG PGT G
Sbjct:  156 GKPGKAGERGPPGPQGARGFPGTPGLPGIKGHRGHPGLDGAKGEAGAAGAKGEAGSNGESGAPGPMGPRGLPGERGRPGATGAAGARGNDGLPGPAGPPGPVGPAGAPGFPGSPGSKGEAGPTGARGPEGAQGPRG------------------------EAGTPGSPGPAGASGNPGTDGIPGAKGSAGASGIAGAPGFPGPRGPPGPQGATGPLGPKGQSGDPGIPGFKGEAGPKGERGVLGPQGPPGPSGEEGKRGPR------------------GEPGSAGPLGPPGERGAPGNR---------GFPGQDGLAGAKGAPGD---RGVPGLSGP---KGGTGDPGRPGEPGLPGARGLTGRPGDAGAQGKVGATGAPGEDGRPGPPGPLGARGQPGVMGFPGPKGANVKPSEHFCISGLPGKDGETGPSGPPGPVGAVGERGEQGQPGPSGFQGLPGPTGAPGEPGKPGDQGVPGEGGAAGPTG---PRGERGFPGERGGAGPQGLQGPRGLPGTPGTDG 619          

HSP 8 Score: 54.299 bits (129), Expect = 3.523e-6
Identity = 138/378 (36.51%), Postives = 169/378 (44.71%), Query Frame = 1
Query: 5989 SIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQG---------------------FPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
            S G+ G PG  G+RG PG  G  G  G  G  G+KG  G  G  G  G  G  G +G  G  GE G+ G   PMGP G PG RG PG  G+ G++G                     FPG+ G +G     GP G  G +G+QG  G AG PG+PG  G +G                                        PG +  PG +G  G  G    +G  G PG  GPPG  G  GP+GP G SG  G+PG  G +G KG +G  GP G PG +G+ G    +GPRGE G  G  G  G  G  GN G  G +G  G  G  G+ G   + G KG  G  G  G  G  G  G+ G PG  G +G +G+TG
Sbjct:  151 SDGEAGKPGKAGERGPPGPQGARGFPGTPGLPGIKGHRGHPGLDGAKGEAGAAGAKGEAGSNGESGAPG---PMGPRGLPGERGRPGATGAAGARGNDGLPGPAGPPGPVGPAGAPGFPGSPGSKG---EAGPTGARGPEGAQGPRGEAGTPGSPGPAGASG---------------------------------------NPGTDGIPGAKGSAGASG---IAGAPGFPGPRGPPGPQGATGPLGPKGQSGDPGIPGFKGEAGPKGERGVLGPQGPPGPSGEEGK---RGPRGEPGSAGPLGPPGERGAPGNRGFPGQDGLAGAKGAPGDRGVPGLSGPKGGTGDPGRPGEPGLPGARGLTGRPGDAGAQGKVGATG 477          

HSP 9 Score: 54.299 bits (129), Expect = 3.675e-6
Identity = 106/300 (35.33%), Postives = 122/300 (40.67%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKG------------QRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPS------------------GVKGDPGKTXXXXXXX-------------XXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFP---GARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDG 6402
            TG  G  G +G  G+PG KG  G KG++G            + G+ G  G  G  G LGP G  GAPG RG  G  G  G  G PG +G+ G                          G +GG G  G  G+ G PG+ G  G PG+ G  GK G  G                    GV G PG  G   +                 GP GP G  G +GE G +G  GP G  G PG  G PG  G  G QG P   GA GP G  G  G  G  G  G QG  G  G+PGTPG DG
Sbjct:  344 TGPLGPKGQSGDPGIPGFKGEAGPKGERGVLGPQGPPGPSGEEGKRGPRGEPGSAGPLGPPGERGAPGNRGFPGQDGLAGAKGAPGDRGVPG------------------------LSGPKGGTGDPGRPGEPGLPGARGLTGRPGDAGAQGKVGATGAPGEDGRPGPPGPLGARGQPGVMGFPGPKGANVKPSEHFCISGLPGKDGETGPSGPPGPVGAVGERGEQGQPGPSGFQGLPGPTGAPGEPGKPGDQGVPGEGGAAGPTGPRGERGFPGERGGAGPQGLQGPRGLPGTPGTDG 619          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Xenopus
Match: col1a2 (collagen type I alpha 2 [Source:NCBI gene;Acc:780175])

HSP 1 Score: 160.614 bits (405), Expect = 2.351e-38
Identity = 83/238 (34.87%), Postives = 119/238 (50.00%), Query Frame = 1
Query: 8530 RDLLNDDALAVKYLGSDVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASDVTEYRS-WFGE-ITGTFKFDYQIE-------ASQLMFLKLFSTNARQRITINCSRLSV-----VGNSEHPVILYSDHDEEVLRNGD-LFKYSVIRDGCKNSAEIIDSTELEMDT-EAIRLPIRDIA-LNTGSSKEQQQFGLDIGQVCF 9192
            +D   D  L       + +  P G+K  PARTC+ L  ++P+   GFY+IDPN G   D+ RV C     E+CI +   S   K+W  S   + +  WFGE I G  + +Y  E       A+Q  F++L + +A Q IT +C           GN +  ++L   +D E+   G+  F +SV+ DGC         T +E  T +  RLPI DIA L+ G   + Q+FGLDIG VCF
Sbjct: 1118 KDYEVDATLKSLNNQIETILTPEGSKKNPARTCRDLRLSHPDWSSGFYWIDPNQGCTSDSIRVFCDFSTGETCIHANPDSIPQKNWYTSKTKQRKHVWFGETINGGTQIEYNEEGVTSKDMATQFAFMRLLANHASQNITYHCKNSIAYMDGQTGNLKKAILLQGSNDVELRAEGNSRFTFSVLEDGCTQHTGEWGRTVIEYRTNKPSRLPILDIAPLDIGG--DDQEFGLDIGPVCF 1353          

HSP 2 Score: 109.768 bits (273), Expect = 5.918e-23
Identity = 208/537 (38.73%), Postives = 249/537 (46.37%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVK---GDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRR---GTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTI------------GIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGN---AGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGP 7188
            +G  G  GP G  G PG  G LG +   G  G  G  GK+G  GP+G  G  GP GA G R   G++G PGP G AG PG  G  G                           SQG  G +G+ G D   G++G +G PG  G+ G  G  GP+G  G           G  GP G  G  G  GE G+ GD GP GP+G  G RG PG  G+ G  G  G RGP G  GS G +G  G+ G  G +            G AGVPG  G+ G AG  G  G  G  G  GP G  G PG  G  G           G++   GP G  G RG PG+       G  GP G +G  GP G  G++G +G  G  GP G  G+ G+ G  G  G AG NG +G  GPRG+ G  G  G  GP G  G    AGI G +GA G PGKDG  G       +G+ GP+G  G +      GI GP G IG KG  G +GP G  G  G  G  G +G  G  G +G++G PG PG  G  GP
Sbjct:  417 SGPAGARGPNGDAGRPGEPGLLGARGLPGFSGSTGPAGKEGPAGPQGIEGRSGPAGASGPRGEPGSIGFPGPKGPAGEPGKNGDKG---------------------------SQGPSGNRGAPGPD---GNNGAQGPPGLAGNTGDKGEQGPAGAPG---------FQGLPGPGGAAGELGKHGERGAPGDFGPAGPAGPRGERGAPGESGAAGPLGALGPRGPTGAPGSDGAKGEPGAAGLNGALGPSGPGGIPGERGAAGVPGPKGEKGDAGHSGEYGNPGRDGARGPAGASGAPGPAGAAGDR---------GESGPAGPSGLAGPRGAPGER------GEAGPAGSTGFAGPPGAAGHTGVKGERGPKGPKGESGSPGALGAVGSHGPAGPNGPAGTTGPRGDGGAPGANGFPGPAGRTGAPGPAGIVGPSGATGHPGKDGPRGP------RGDSGPVGRPGEQ------GIGGPQGLIGEKGSSGESGPAGPPGASGPSGVLGALGISGLPGARGERGTPGGPGANGESGP 887          

HSP 3 Score: 108.227 bits (269), Expect = 2.151e-22
Identity = 169/478 (35.36%), Postives = 200/478 (41.84%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHG---DPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPG------PRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIG 7050
            GE G  G TG  G PG  G  GVKG++G +G  G+ G  G  G +G  GP G  G  GT G   P G+ G PG  G  G                     P G  G+ G  GI G  G  G+PG DG RG  G+ G    PG+ GI GP G+                              +G KG  G  GP+G PG  G  GV+G+LG  G PGARG +G  G PG      P G  GS GS+G  G  G PG  G  G+AG+ G                                           PG  GP G  G PG  G            + G  G  GP G+ G  G PG+ GPSG  GN+G  GP G  G  G  G  GP G +G  GD G  GE+G  G  G  G  G+ G PG  G  GE G    +G  G  GP G SG  G +G +G  GP G +GL+G  G
Sbjct:  706 GEAGPAGSTGFAGPPGAAGHTGVKGERGPKGPKGESGSPGALGAVGSHGPAGPNGPAGTTG---PRGDGGAPGANGFPG---------------------PAGRTGAPGPAGIVGPSGATGHPGKDGPRGPRGDSGPVGRPGEQGIGGPQGL------------------------------IGEKGSSGESGPAGPPGASGPSGVLGALGISGLPGARGERGTPGGPGANGESGPAGPAGSAGSRGPSGPVGSPGLTGVHGEAGRDG------------------------------------------NPGNDGPPGRDGLPGVKG------------ERGYPGGTGPAGSLGAVGAPGAVGPSGKSGNRGEPGPVGHAGAVGPAGPRGPSGQQGTRGDKGEAGERGARGLDGRKGHNGLQGLPGPAGSPGETGPAGSNGPSGPRGPAGPSGPPGKEGRSGHNGPIGPVGLRGPAG 1075          

HSP 4 Score: 106.301 bits (264), Expect = 7.749e-22
Identity = 229/600 (38.17%), Postives = 261/600 (43.50%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGV---KGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQ------------GISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHG---------------DPGKAGIDGPSGVKGD---------PGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQG------------PLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGP---------PGNSGQRGLPGSNGPSGT------KGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAK------------GNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDK------GLPGNPGTPGVIGP 7188
             G  G  G  G  G PG KGP G     GDKG +G  G  G  GP GN G QGP   PG  G  G  G  G AG PG Q            G  G  G  G+ G  GP G  G RG  GE G+ G LG  G  G  G PGSDG +G PG  G               + G AG+ GP G KGD         PG+ G  G +G  G  GP G  G  GE G  G  G  GP G+PG RG  G  GS G  G PGA G  G+ G  GP+G  G  GS G +G  G  G  G +G AG  G                              P G  G PG N  PGP G            P G  G PGK G  G  G+ GP G+ G QG  GP          G SG  G PG++GPSG        G  G++G  G PG  G NG SGP GP    G  G+ G  GPVG  G  G+ G  G  G PG DG  G+D + G K            G++G +G+ G  GP G +G +G PG +G  G +G  GP G  G  G  G  G  G  G  G  G K      GLPG  G+PG  GP
Sbjct:  471 AGASGPRGEPGSIGFPGPKGPAGEPGKNGDKGSQGPSGNRGAPGPDGNNGAQGP---PGLAGNTGDKGEQGPAGAPGFQGLPGPGGAAGELGKHGERGAPGDFGPAGPAGPRGERGAPGESGAAGPLGALGPRGPTGAPGSDGAKGEPGAAGLNGALGPSGPGGIPGERGAAGVPGPKGEKGDAGHSGEYGNPGRDGARGPAGASGAPGPAGAAGDRGESGPAGPSGLAGPRGAPGERGEAGPAGSTGFAGPPGAAGHTGVKGERGPKGPKGESGSPGALGAVGSHGPAGPNGPAGTTG------------------------------PRGDGGAPGANGFPGPAGRTGAPGPAGIVGPSGATGHPGKDGPRGPRGDSGPVGRPGEQGIGGPQGLIGEKGSSGESGPAGPPGASGPSGVLGALGISGLPGARGERGTPGGPGANGESGPAGPA---GSAGSRGPSGPVGSPGLTGVHGEAGRDGNPGNDGPPGRDGLPGVKGERGYPGGTGPAGSLGAVGAPGAVGPSGKSGNRGEPGPVGHAGAVGPAGPRGPSGQQGTRGDKGEAGERGARGLDGRKGHNGLQGLPGPAGSPGETGP 1034          

HSP 5 Score: 103.605 bits (257), Expect = 5.038e-21
Identity = 204/571 (35.73%), Postives = 238/571 (41.68%), Query Frame = 1
Query: 5641 TGEPGI---NGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNG------------------------PSGTKGNKGSKGPYGKPGIAG------------------DNGASGPQGPRG---ENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGP------PGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            +G+PG+    G TG  G PG  GP G  G  G+ GR G +G  G  G  G  G  G PG RG  G  G  G  G PG +G SG                             G  G  G  G+ G PG  G RG PG  G  G AG +GP+G +G  G++G  G SG RG            E GS G  GP GP+G PG  G+ G  G  G++G PG  G  G  G PG  G TG KG QG  G  G  G PG  G AG++G                                G  G PG     GP GP GERG PG+SG  G  G +      G +GP G PG+ G +G PG+ G                        P G KG+ G  G YG PG  G                  D G SGP GP G     G  G  GE GP G  G AG  G  G  G+ G+ G  G     G+ G +G +GS G  GP G  G  GP      PG+ G  G  G TG  G  G+ G  G  G  G  GP G +GD G  G PG  G+ GPQ
Sbjct:  336 SGDPGVAGGKGDTGAKGEPGSAGPSGPAGPSGEEGRRGPNGEAGSSGPAGNAGIRGVPGTRGLPGPDGRAGGMGAPGSRGASG---------------------------PAGARGPNGDAGRPGEPGLLGARGLPGFSGSTGPAGKEGPAGPQGIEGRSGPAGASGPRG------------EPGSIGFPGPKGPAGEPGKNGDKGSQGPSGNRGAPGPDGNNGAQGPPGLAGNTGDKGEQGPAGAPGFQGLPGPGGAAGELG------------------------------KHGERGAPGDFGPAGPAGPRGERGAPGESGAAGPLGAL------GPRGPTGAPGSDGAKGEPGAAGLNGALGPSGPGGIPGERGAAGVPGPKGEKGDAGHSGEYGNPGRDGARGPAGASGAPGPAGAAGDRGESGPAGPSGLAGPRGAPGERGEAGPAGSTGFAGPPGAAGHTGVKGERGPKGPKGESGSPGALGAVGSHGPAGPNGPAGTTGPRGDGGAPGANGFPGPAGRTGAPGPAGIVGPSGATGHPGKDGPRGPRGDSGPVGRPGEQGIGGPQ 831          

HSP 6 Score: 103.219 bits (256), Expect = 6.882e-21
Identity = 193/539 (35.81%), Postives = 231/539 (42.86%), Query Frame = 1
Query: 5662 GPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVG------------------NAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILG------------SPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGS---------NGPSGTKGNKGSKGPYGKPGI------AGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGP---------------------------QGMTGIQGPPGSIGLKGDIGSTGP 7062
            G  G  G PG  GP G  G +G+RG  G+ G  GP G LGP+GPTGAPG  G  G PG  G                   AG PG +G  G  G+ GE G  G  G  G  G  G  G  G  G +G  G  G  G  G RGAPGE G+ G AG  G +G  G  G T                        G KG+ GP GP G     G+PG +G++GS G  G  GP G  G             PGP GRTG+ G  G +G +G  G PGKDG  G  G                               +G  G PG+    GPQG +GE+G  G+SG  G PG  GP G  G  G  G PG  G+RG PG           GP+G+ G++G  GP G PG+      AG +G  G  GP G +G  G  GE+G  G  G AG  G  GAPG  G  G++G     G  G+ G +G +G RGP                            G+ G+ GP GS G  G  GS GP
Sbjct:  559 GKHGERGAPGDFGPAGPAGPRGERGAPGESGAAGPLGALGPRGPTGAPGSDGAKGEPGAAGLNGALGPSGPGGIPGERGAAGVPGPKGEKGDAGHSGEYGNPGRDGARGPAGASGAPGPAGAAGDRGESGPAGPSGLAGPRGAPGERGEAGPAGSTGFAGPPGAAGHT------------------------GVKGERGPKGPKGE---SGSPGALGAVGSHGPAGPNGPAGTTGPRGDGGAPGANGFPGPAGRTGAPGPAGIVGPSGATGHPGKDGPRGPRG------------------------------DSGPVGRPGEQGIGGPQGLIGEKGSSGESGPAGPPGASGPSGVLGALGISGLPGARGERGTPGGPGANGESGPAGPAGSAGSRGPSGPVGSPGLTGVHGEAGRDGNPGNDGPPGRDGLPGVKGERGYPGGTGPAGSLGAVGAPGAVGPSGKSGNRGEPGPVGHAGAVGPAGPRGPSGQQGTRGDKGEAGERGARGLDGRKGHNGLQGLPGPAGSPGETGPAGSNGP 1040          

HSP 7 Score: 99.3673 bits (246), Expect = 8.633e-20
Identity = 70/256 (27.34%), Postives = 119/256 (46.48%), Query Frame = -3
Query:  229 EDEDIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCIE--PEVVNYKKTSYTKTISS---WFSVLASLNKQISY-------KIPKEQLVFXXXXXXXXXXXXXXSC-DQIALVSDDSITQDIRYNNSVQLFGDDNQILTVNNEDDLFQYKVVEDTCKDKSNN-GRAVIKVEXXXXXXXXXXXLNFKSIENSRPAMI--------------GIEIGPVCF 912
            +D ++   L  L++ ++ +  P GSK  PAR+C D++  + + S+G ++IDPN G   D+I V C+F   ETCI   P+ +  K    +KT      WF    +   QI Y       K    Q  F++L +  +SQ +T  C + IA +  D  T +++   ++ L G ++  L     +  F + V+ED C   +   GR VI+               +++ + SR  ++              G++IGPVCF
Sbjct: 1118 KDYEVDATLKSLNNQIETILTPEGSKKNPARTCRDLRLSHPDWSSGFYWIDPNQGCTSDSIRVFCDFSTGETCIHANPDSIPQKNWYTSKTKQRKHVWFGETINGGTQIEYNEEGVTSKDMATQFAFMRLLANHASQNITYHCKNSIAYM--DGQTGNLK--KAILLQGSNDVELRAEG-NSRFTFSVLEDGCTQHTGEWGRTVIE---------------YRTNKPSRLPILDIAPLDIGGDDQEFGLDIGPVCF 1353          

HSP 8 Score: 97.4413 bits (241), Expect = 3.216e-19
Identity = 192/494 (38.87%), Postives = 223/494 (45.14%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGH---PGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGF------------------PGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
            TG  G  GP GP G+ G  GP G  G +G+ G +G  G  GP G  G  G  G+ G  G  G+PGP GN G    PG+ G +G  G QG  G  G  GLPG  G  GE G  G  G  G  G  G  G  G+RGAPGE G  G  G  GP G  G PG  G  G  G  G  G  G  G  G  G +G  G  GP G  G  G+ G  G+ G  G                    G  GP G  G  GPRG  G +G  G  G  G  G PG  G  G  G  G  GP G  G  G +G                    G +   GP GP G  GP G  G  G  G  GP G++G  GP G  G SG  G PG +GP   +G +G  GP G+P   G+ G  GPQG  GE G  G +G  GP G  G +G+ G  G  G+PG  GE G     GA G  GP G +G  G +G +G  G PG  G+ G+ G  G
Sbjct:  450 TGPAGKEGPAGPQGIEGRSGPAGASGPRGEPGSIGFPGPKGPAGEPGKNGDKGSQGPSGNRGAPGPDGNNGAQGPPGLAGNTGDKGEQGPAGAPGFQGLPGPGGAAGELGKHGERGAPGDFGPAGPAGPRGERGAPGESGAAGPLGALGPRGPTGAPGSDGAKGEPGAAGLNGALGPSGPGGIPGERGAAGVPGPKGEKGDAGHSGEYGNPGRDGARGPAGASGAPGPAGAAGDRGESGPAGPSGLAGPRGAPGERGEAGPAGSTGFAGPPGAAGHTGVKGERGPKGPKGESGSPGALGAV------------------GSHGPAGPNGPAGTTGPRGDGGAPGANGFPGPAGRTGAPGPAGIVGPSGATGHPGKDGP---RGPRGDSGPVGRP---GEQGIGGPQGLIGEKGSSGESGPAGPPGASGPSGVLGALGISGLPGARGERGTPGGPGANGESGPAGPAGSAGSRGPSGPVGSPGLTGVHGEAGRDG 919          

HSP 9 Score: 86.6557 bits (213), Expect = 6.328e-16
Identity = 200/529 (37.81%), Postives = 237/529 (44.80%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMG---------------------KDGILGPRGNLGP---------------QGPTGAPGRRGTVGSP------------GPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSK---------GPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
            G  G++G  G  GV G+KG  G  G+ G  G+ G                      DG  GP G  GP               +G  G+ G  G+ G+             GPVG AG+PG  G++G  G  G PG+ G PGLPG RG  G  G  G  G +G  G  G  G  G  GA GE   PG AG  GP+G  G+ G+                   G  GE GS G  G  G  G PG RG PG  G  G  G PG+RG  G  G+ GP G  G  G  G +G  G+PG  G  G AG+ G  G  G  GR GP G  G  G PG  G PGP G  G PGKN   G QGP G RG PG                 G  G  GPPG +G  G  G  GP+G  G +G           G +G+ G  GD G +GP GPRGE G  G +G  GP+G +   G RG  GAPG  G  GE G   ++GA G  GP G  G RG  G+ G +G  G  G  G+ G+ G
Sbjct:  172 GHNGLDGQKGGPGVAGVKGETGANGENGSPGQSGARGLPGERGRGGPPGPAGSRGSDGSAGPTGPAGPIGSAGPPGLPGAPGAKGEIGSAGSTGSAGAAGPRGEPGPPGALGPVGPAGNPGANGVNGAKGAAGLPGVGGAPGLPGPRGIPGPPGPSGPAGARGLSGDPGVAGGKGDTGAKGE---PGSAGPSGPAGPSGEEGRR------------------GPNGEAGSSGPAGNAGIRGVPGTRGLPGPDGRAGGMGAPGSRGASGPAGARGPNGDAGRPGEPGLLGARGLPGFSGSTGPAGKEGPAGPQGIEGRSGPAGASGPRGEPGSIGFPGPKGPAGEPGKNGDKGSQGPSGNRGAPGP---------------DGNNGAQGPPGLAGNTGDKGEQGPAGAPGFQGLPGPGGAAGELGKHGERGAPGDFGPAGPAGPRGERGAPGESGAAGPLGAL---GPRGPTGAPGSDGAKGEPGAAGLNGALGPSGPGGIPGERGAAGVPGPKGEKGDAGHSGEYGNPG 661          

HSP 10 Score: 72.0182 bits (175), Expect = 1.838e-11
Identity = 189/486 (38.89%), Postives = 220/486 (45.27%), Query Frame = 1
Query: 5710 VKGDKGQRGRMGKDGILGPRGNL------------GPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGD---PGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNP------GVIGSLGSQGFPGAR------GPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGA------SGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMG 7068
             +G +G  G  G+ G  GP G+             G  G +G PG RGTVGS G  G  G PG+ G                                   GI+G  G D            G+ G PG AG+ G +G  G+   PG++G  G  G RG  GP G  G  G  GS G  GP GP GS G  G P      G IGS GS G  GA       GP G LG  GP G  G+ G  G  G AG+PG  G  G  G  GIPG  GP G  G  G  G PG  G  G  G  G PG+ G +   GP G  G RGP G++G  G  GN G  G  G +G  GP G +G  G PGS G SG  G +G  G  G+PG  G  GA      SG  GP G+ G  G  G +G  G  G +G RG  G+ G PG  G  G+   +G KG+ GP G+ G  GP G  G QGPPG  G  GD G  GP G
Sbjct:  101 AQGFQGHAGEPGEPGQPGPLGSTGPSGPPGKPGEDGHSGKSGRPGERGTVGSQGARGFPGTPGLPGFK---------------------------------GIRGHNGLD------------GQKGGPGVAGVKGETGANGENGSPGQSGARGLPGERGRGGPPGPAGSRGSDGSAGPTGPAGPIGSAGPPGLPGAPGAKGEIGSAGSTGSAGAAGPRGEPGPPGALGPVGPAGNPGANGVNGAKGAAGLPGVGGAPGLPGPRGIPGPPGPSGPAGARGLSGDPGVAGGKGDTGAKGEPGSAGPSGPAGPSGEEGRRGPNGEAGSSGPAGNAGIRGVPGTRGLPGPDGRAGGMGAPGSRGASGPAGARGPNGDAGRPGEPGLLGARGLPGFSGSTGPAGKEGPAGPQGIEGRSGPAGASGPRGEPGSIGFPGPKGPAGEPGKNGDKGSQGPSGNRGAPGPDGNNGAQGPPGLAGNTGDKGEQGPAG 541          

HSP 11 Score: 65.855 bits (159), Expect = 1.369e-9
Identity = 72/176 (40.91%), Postives = 85/176 (48.30%), Query Frame = 1
Query: 6652 GPIGPPGNSGQRGLPGSNGPSGTKGNKG---------------------SKGPYGKPGIA---GDNGA---------SGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSI---GLKGDIGSTGPMGR 7071
            GP+GP GN G  G+ G+ G +G  G  G                     ++G  G PG+A   GD GA         SGP GP GE G  G  GE G  G  GNAGIRGV G  G+PG DG  G     G++G  GP G+   RGP G  G  G PG +   GL G  GSTGP G+
Sbjct:  283 GPVGPAGNPGANGVNGAKGAAGLPGVGGAPGLPGPRGIPGPPGPSGPAGARGLSGDPGVAGGKGDTGAKGEPGSAGPSGPAGPSGEEGRRGPNGEAGSSGPAGNAGIRGVPGTRGLPGPDGRAGGMGAPGSRGASGPAGA---RGPNGDAGRPGEPGLLGARGLPGFSGSTGPAGK 455          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Xenopus
Match: col2a1 (collagen, type II, alpha 1 [Source:NCBI gene;Acc:394828])

HSP 1 Score: 159.844 bits (403), Expect = 3.573e-38
Identity = 88/254 (34.65%), Postives = 129/254 (50.79%), Query Frame = 1
Query: 8512 PVRTVRRDLLN--------DDALAVKYLGSDV--VKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASDVTEYRS-WFGE-ITGTFKFDYQIEAS-------QLMFLKLFSTNARQRITINCSRL-----SVVGNSEHPVILYSDHDEEVLRNGD-LFKYSVIRDGCKNSAEIIDSTELEMDTEAI-RLPIRDIA-LNTGSSKEQQQFGLDIGQVCF 9192
            P+R +R D  +        D    +K L + +  ++ P GTK  PARTC+ L   +P  + G Y+IDPN G   DA +V C  +  E+C+         K+W ++   E +  WFGE I G F+F Y  ++S       Q+ FL+L ST+A Q IT +C           GN +  V+L   +D E+   G+  F Y+ + DGCK        T +E  T+   RLPI DIA ++ G +   Q+FG+DIG VCF
Sbjct: 1170 PMRYMRADQASSSVPQRDVDVEATLKSLNNQIESIRSPDGTKKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTVDAIKVFCNMETGETCVYPNPSKIPKKNWWSAKGKEKKHIWFGETINGGFQFSYGDDSSAPNTANIQMTFLRLLSTDATQNITYHCKNSIAFMDEASGNLKKAVLLQGSNDVEIRAEGNSRFTYNALEDGCKKHTGKWSKTVIEYRTQKTSRLPIVDIAPMDIGGA--DQEFGVDIGPVCF 1421          

HSP 2 Score: 105.916 bits (263), Expect = 8.867e-22
Identity = 186/503 (36.98%), Postives = 222/503 (44.14%), Query Frame = 1
Query: 5698 GPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPG------RRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGL-GIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPG------KTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVP------------------GTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAG------------------DNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
            GPLG KG  G  G  G  G  GP+G +G  GP GAPG      +RG  G PG  G  G PG +G  G  G                         Q GL G KG+ G+ G PG  G +GA G+ G PG+ G+ G  G+ G PG      K G  G SG  G  GP G +G  G+ G  G  GP G +G PG  G  G++G+ G +G PG  G  G  G  GP G  G +G QG  G +G                    G PG+ G  G VG                              P G  G PG+    GPQG  G RG PG  G DG  G  GP G +G QGP G  G  G+RG  G +GP G +G+ G KGP G PG  G                  + G SGP GP G  G  G  G++G  G  G AG  G  GA G  G  G+ G+    G  G  GP G SG  GPQG TG+ GP G+ G +G  G+TG
Sbjct:  382 GPLGPKGQTGDPGVAGFKGEHGPKGEIGSAGPQGAPGPAGEEGKRGARGEPGAAGPLGPPGERGAPGNRGFP----------------------GQDGLAGPKGAPGERGVPGLGGPKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGASGEDGRPGPPGPQGARGQPGVMGFPGPKGANGEPGKAGEKGLLGAPGLRGLPGKDGETGAQGPNGPAGPAGERGEQGPPGPSGFQGLPGPPGSPGEGGKPGDQGVPGEAGAPGLVG------------------------------PRGERGFPGERGSSGPQGLQGPRGLPGTPGTDGPKGATGPSGPNGAQGPPGLQGMPGERGAAGISGPKGDRGDTGEKGPEGAPGKDGSRGLTGPIGPPGPSGPNGEKGESGPSGPAGIVGARGAPGDRGETGPPGPAGFAGPPGADGQAGLKGDQGESGQKGDAGAPGPQGPSGAPGPQGPTGVNGPKGARGAQGPPGATG 832          

HSP 3 Score: 102.834 bits (255), Expect = 9.388e-21
Identity = 208/528 (39.39%), Postives = 247/528 (46.78%), Query Frame = 1
Query: 5743 GKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTK------------------------GNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGN------IGPIGSSGRRGPQGMT---------------GIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            G  G  GP G  GP+G  G  G  GT GSPGP G +G+PG  GI G  G+ G PG+ G PG PG RGP G +G+ G LG KG  G  G  G  G+ G  GE G  G  G  GP+G +G  G  G                     E G+ G +GP G  G+PG RG PG  G  G +G PG RG  G+ G  G  G  G  G  G  G  G+ G PG  G  G+VG  G +G  GRPGP GP G  G PG  G PGP G  G PGK  + G  G  G RG PGK G            ++G QGP GP G +G+RG  G  GPSG +                        G  G  GP G+ G  G+ G+SGPQG +G  G  G  G  GP G  G +G  G  G PG+ G  GE G   + G KG+       GP G+ G+ G +G+T               G  GP G  G+ G  G+ G  G  G PG  G  G  G  G  G KGD+G  G  G  G  GPQ
Sbjct:  307 GSKGEAGPTGARGPEGAQGPRGESGTPGSPGPAGASGNPGTDGIPGAKGSSGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGQTGDPGVAGFKGEHGPKGEIGSAGPQGAPGPAGEEGKRGARG---------------------EPGAAGPLGPPGERGAPGNRGFPGQDGLAGPKGAPGERGVPGLGGPKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGASGEDGRPGPPGPQGARGQPGVMGFPGPKGANGEPGKAGEKGLLGAPGLRGLPGKDG------------ETGAQGPNGPAGPAGERGEQGPPGPSGFQGLPGPPGSPGEGGKPGDQGVPGEAGAPGLVGPRGERGFPGERGSSGPQGLQGPRGLPGTPGTDGPKGATGPSGPNGAQGPPGLQGMPGERGAAGISGPKGDRGDTGEKGPEGAPGKDGSRGLTGPIGPPGPSGPNGEKGESGPSGPAGIVGARGAPGDRGETGPPGPAGFAGPPGADGQAGLKGDQGESGQKGDAGAPGPQ 801          

HSP 4 Score: 96.2857 bits (238), Expect = 9.343e-19
Identity = 190/531 (35.78%), Postives = 231/531 (43.50%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGA---------PGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLG---ERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPY------------------GKPGIAGDNGASGPQG---------------------------------PRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGD 7044
             G PG+ GP G  G PG +G  G +G +G RG  G  G  GP+G  GP GP GA         PG RG  G  GP G+ G  G +G  G PG  G  G+ GP G PG  GP GEKG  G  G  G +G  G PG  G+ G PG  G  G  G DG +G+KGD G++G                     + G  G  GP GPSG+PG +G  GV G  G++G   A+GP G  G PG  GR G  G  G  G +G PG+ GK+G  G  G  G                                   G+   PG QGP G   E+G  G+ G  G  G  GP G SG +G +G PG  G+RG PG  GPSG  G +G  G                    G+PG  G+ G+ GP G                                 P G+ GD G +G QGP+G  G AG R      G+PG  G  G       KG  G  G  G++G +G TG+QG PG  G  GD
Sbjct:  624 AGAPGLVGPRGERGFPGERGSSGPQGLQGPRGLPGTPGTDGPKGATGPSGPNGAQGPPGLQGMPGERGAAGISGPKGDRGDTGEKGPEGAPGKDGSRGLTGPIGPPGPSGPNGEKGESGPSGPAGIVGARGAPGDRGETGPPGPAGFAGPPGADGQAGLKGDQGESG---------------------QKGDAGAPGPQGPSGAPGPQGPTGVNGPKGARG---AQGPPGATGFPGAAGRVGPPGPNGNPGPSGAPGSAGKEGPKGARGDAGPT---------------------------------GRAGDPGLQGPAGVPGEKGESGEDGPSGPDGPPGPQGLSGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGGPGSAGDRGPPGPVGPPGLTGPAGEPGREGNAGSDGPPGRDGATGIKGDRGETGPLGAPGAPGAPGAPGPVGPTGKQGDRGESGPQGPLGPSGPAGAR------GLPGPQGPRGD------KGEAGEAGERGQKGHRGFTGLQGLPGPPGTAGD 1085          

HSP 5 Score: 96.2857 bits (238), Expect = 9.343e-19
Identity = 64/257 (24.90%), Postives = 114/257 (44.36%), Query Frame = -3
Query:  229 KTEKISSIDPNDEDEDIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCIEPEVVNYKKTSYTKTISSWFSVLASLNKQISY-KIPKEQLVFXXXXXXXXXXXXXXSCDQIALVSDDSITQDIRYN--NSVQLF----GDDNQILTVNNEDDL---------FQYKVVEDTCKDKSNNGRAVIKVEXXXXXXXXXXXLNFKSIE-NSRPAMIGIEIGPVCF 948
            + ++ SS  P   D D+   L  L++ ++++  P G+K  PAR+C D++  +    +G ++IDPN G   DAI V CN +  ETC+ P      K        +W+S      K I + +       F      S+  T  +    + L+S D+ TQ+I Y+  NS+       G+  + + +   +D+         F Y  +ED CK  +      + +E    +   +  ++   ++        G++IGPVCF
Sbjct: 1175 RADQASSSVPQ-RDVDVEATLKSLNNQIESIRSPDGTKKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTVDAIKVFCNMETGETCVYPNPSKIPK-------KNWWSAKGKEKKHIWFGETINGGFQFSYGDDSSAPNTANIQMTFLRLLSTDA-TQNITYHCKNSIAFMDEASGNLKKAVLLQGSNDVEIRAEGNSRFTYNALEDGCKKHTGKWSKTV-IEYRTQKTSRLPIVDIAPMDIGGADQEFGVDIGPVCF 1421          

HSP 6 Score: 85.1149 bits (209), Expect = 2.043e-15
Identity = 222/556 (39.93%), Postives = 257/556 (46.22%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLG---------PQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGK---AGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGL------RGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPG---------PQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRG------------VNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
             GE G  G  G  G  G  GP G +G  G RG  G+DG+ GP+G  G         P+G  G PGR G  G PG  G  G PG  G  G+ G  G  G  G PG PG +G  G+ G  G  G KG+ G+ G  G  G  GAPG  G PGK    G  GP+G  G  G+ G  G  G  G +G  G  G  GE G  GD G  G +G+PGL      RG PG  GS G QG  G RG  G  G+ GP+G TG  G  G  G  G+ G PG+ G AG  G                       G  G  G  G  G PGK+   G         P GP GE+G  G SG  G+ G  G PG  G  GP GP G +G  G  G  G  G +G  G KG  G PG  G +GA GPQGP G NG  G  G QGP G  G  G  G             +GAPG  GK+G        GA+G+ GP G +G        G+QGP G  G KG+ G  GP G  G PG  G  G  G  G  G +G++G PG PG  G  G Q
Sbjct:  420 AGEEGKRGARGEPGAAGPLGPPGERGAPGNRGFPGQDGLAGPKGAPGERGVPGLGGPKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGASGEDGRPGPPGPQGARGQPGVMGFPGPKGANGEPGKAGEKGLLGAPGLRGLPGKDGETGAQGPNGPAGPAGERGEQGPPGPSGFQGLPGPPGSPGEGGKPGDQGVPGEAGAPGLVGPRGERGFPGERGSSGPQGLQGPRGLPGTPGTDGPKGATGPSGPNGAQGPPGLQGMPGERGAAGISG---------------------PKGDRGDTGEKGPEGAPGKDGSRGLTGPIGPPGPSGPNGEKGESGPSGPAGIVGARGAPGDRGETGPPGPAGFAGPPGADGQAGLKGDQGESGQKGDAGAPGPQGPSGAPGPQGPTGVNGPKGARGAQGPPGATGFPGAAGRVGPPGPNGNPGPSGAPGSAGKEGPK------GARGDAGPTGRAGD------PGLQGPAGVPGEKGESGEDGPSGPDGPPGPQGLSGQRGIVGLPGQRGERGFPGLPGPSGEPGKQ 942          

HSP 7 Score: 74.7146 bits (182), Expect = 3.207e-12
Identity = 140/459 (30.50%), Postives = 173/459 (37.69%), Query Frame = 1
Query: 6031 GAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFP------------------GARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKG---------SKGPYGKPGIAGDNGASGPQGPRGEN---------------GDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQ------------------------------GPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            GAPG  G+ G  G  GP G +G  G                        E G+ G  GP G SG+PG  G PG  GS G+ G                    G  GP+G  G PG  G  G  G +G IG AG  G PG  G+ G+ G                                      G+    GP GP GERG PG  G  G         Q GL GP G PG   +RG+PG  GP G  G+ G         ++G  G+PG AG  G  GP G  GE+               G +G  G +G  GE G AG +G+ GAPG+ G  G++G+    G  G  GP G  G +GP G +G Q                              GP G  G  G+ GS+GP                     +G +G +GLPG   TPG  GP+
Sbjct:  304 GAPGSKGEAGPTGARGPEGAQGPRG------------------------ESGTPGSPGPAGASGNPGTDGIPGAKGSSGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGQTGDPGVAGFKGEHGPKGEIGSAGPQGAPGPAGEEGKRGAR------------------------------------GEPGAAGPLGPPGERGAPGNRGFPG---------QDGLAGPKGAPG---ERGVPGLGGPKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGASGEDGRPGPPGPQGARGQPGVMGFPGPKGANGEPGKAGEKGLLGAPGLRGLPGKDGETGAQGPNGPAGPAGERGEQGPPGPSGFQGLPGPPGSPGEGGKPGDQGVPGEAGAPGLVGPRGERGFPGERGSSGP---------------------QGLQGPRGLPG---TPGTDGPK 666          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Xenopus
Match: col2a1 (collagen, type II, alpha 1 [Source:NCBI gene;Acc:394828])

HSP 1 Score: 157.532 bits (397), Expect = 2.066e-37
Identity = 88/254 (34.65%), Postives = 129/254 (50.79%), Query Frame = 1
Query: 8512 PVRTVRRDLLN--------DDALAVKYLGSDV--VKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASDVTEYRS-WFGE-ITGTFKFDYQIEAS-------QLMFLKLFSTNARQRITINCSRL-----SVVGNSEHPVILYSDHDEEVLRNGD-LFKYSVIRDGCKNSAEIIDSTELEMDTEAI-RLPIRDIA-LNTGSSKEQQQFGLDIGQVCF 9192
            P+R +R D  +        D    +K L + +  ++ P GTK  PARTC+ L   +P  + G Y+IDPN G   DA +V C  +  E+C+         K+W ++   E +  WFGE I G F+F Y  ++S       Q+ FL+L ST+A Q IT +C           GN +  V+L   +D E+   G+  F Y+ + DGCK        T +E  T+   RLPI DIA ++ G +   Q+FG+DIG VCF
Sbjct: 1240 PMRYMRADQASSSVPQRDVDVEATLKSLNNQIESIRSPDGTKKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTVDAIKVFCNMETGETCVYPNPSKIPKKNWWSAKGKEKKHIWFGETINGGFQFSYGDDSSAPNTANIQMTFLRLLSTDATQNITYHCKNSIAFMDEASGNLKKAVLLQGSNDVEIRAEGNSRFTYNALEDGCKKHTGKWSKTVIEYRTQKTSRLPIVDIAPMDIGGA--DQEFGVDIGPVCF 1491          

HSP 2 Score: 107.842 bits (268), Expect = 2.318e-22
Identity = 187/503 (37.18%), Postives = 223/503 (44.33%), Query Frame = 1
Query: 5698 GPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPG------RRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGL-GIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPG------KTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVP------------------GTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAG------------------DNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
            GPLG KG  G  G  G  G  GP+G +G  GP GAPG      +RG  G PG  G  G PG +G  G  G  G                      Q GL G KG+ G+ G PG  G +GA G+ G PG+ G+ G  G+ G PG      K G  G SG  G  GP G +G  G+ G  G  GP G +G PG  G  G++G+ G +G PG  G  G  G  GP G  G +G QG  G +G                    G PG+ G  G VG                              P G  G PG+    GPQG  G RG PG  G DG  G  GP G +G QGP G  G  G+RG  G +GP G +G+ G KGP G PG  G                  + G SGP GP G  G  G  G++G  G  G AG  G  GA G  G  G+ G+    G  G  GP G SG  GPQG TG+ GP G+ G +G  G+TG
Sbjct:  452 GPLGPKGQTGDPGVAGFKGEHGPKGEIGSAGPQGAPGPAGEEGKRGARGEPGAAGPLGPPGERGAPGNRGFPG----------------------QDGLAGPKGAPGERGVPGLGGPKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGASGEDGRPGPPGPQGARGQPGVMGFPGPKGANGEPGKAGEKGLLGAPGLRGLPGKDGETGAQGPNGPAGPAGERGEQGPPGPSGFQGLPGPPGSPGEGGKPGDQGVPGEAGAPGLVG------------------------------PRGERGFPGERGSSGPQGLQGPRGLPGTPGTDGPKGATGPSGPNGAQGPPGLQGMPGERGAAGISGPKGDRGDTGEKGPEGAPGKDGSRGLTGPIGPPGPSGPNGEKGESGPSGPAGIVGARGAPGDRGETGPPGPAGFAGPPGADGQAGLKGDQGESGQKGDAGAPGPQGPSGAPGPQGPTGVNGPKGARGAQGPPGATG 902          

HSP 3 Score: 104.76 bits (260), Expect = 2.390e-21
Identity = 208/528 (39.39%), Postives = 247/528 (46.78%), Query Frame = 1
Query: 5743 GKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTK------------------------GNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGN------IGPIGSSGRRGPQGMT---------------GIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            G  G  GP G  GP+G  G  G  GT GSPGP G +G+PG  GI G  G+ G PG+ G PG PG RGP G +G+ G LG KG  G  G  G  G+ G  GE G  G  G  GP+G +G  G  G                     E G+ G +GP G  G+PG RG PG  G  G +G PG RG  G+ G  G  G  G  G  G  G  G+ G PG  G  G+VG  G +G  GRPGP GP G  G PG  G PGP G  G PGK  + G  G  G RG PGK G            ++G QGP GP G +G+RG  G  GPSG +                        G  G  GP G+ G  G+ G+SGPQG +G  G  G  G  GP G  G +G  G  G PG+ G  GE G   + G KG+       GP G+ G+ G +G+T               G  GP G  G+ G  G+ G  G  G PG  G  G  G  G  G KGD+G  G  G  G  GPQ
Sbjct:  377 GSKGEAGPTGARGPEGAQGPRGESGTPGSPGPAGASGNPGTDGIPGAKGSSGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGQTGDPGVAGFKGEHGPKGEIGSAGPQGAPGPAGEEGKRGARG---------------------EPGAAGPLGPPGERGAPGNRGFPGQDGLAGPKGAPGERGVPGLGGPKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGASGEDGRPGPPGPQGARGQPGVMGFPGPKGANGEPGKAGEKGLLGAPGLRGLPGKDG------------ETGAQGPNGPAGPAGERGEQGPPGPSGFQGLPGPPGSPGEGGKPGDQGVPGEAGAPGLVGPRGERGFPGERGSSGPQGLQGPRGLPGTPGTDGPKGATGPSGPNGAQGPPGLQGMPGERGAAGISGPKGDRGDTGEKGPEGAPGKDGSRGLTGPIGPPGPSGPNGEKGESGPSGPAGIVGARGAPGDRGETGPPGPAGFAGPPGADGQAGLKGDQGESGQKGDAGAPGPQ 871          

HSP 4 Score: 98.2117 bits (243), Expect = 2.415e-19
Identity = 192/534 (35.96%), Postives = 230/534 (43.07%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGA---------PGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIG---PMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLG---ERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPY------------------GKPGIAGDNGASGPQG---------------------------------PRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGD 7044
             G PG+ GP G  G PG +G  G +G +G RG  G  G  GP+G  GP GP GA         PG RG  G  GP G+ G  G +G  G PG  G  G+ GP G PG  GP GEKG  G  G  G +G  G PG  G+ G PG  G  G  G DG +G+KGD G                        E G KGD G   P GPSG+PG +G  GV G  G++G   A+GP G  G PG  GR G  G  G  G +G PG+ GK+G  G  G  G                                   G+   PG QGP G   E+G  G+ G  G  G  GP G SG +G +G PG  G+RG PG  GPSG  G +G  G                    G+PG  G+ G+ GP G                                 P G+ GD G +G QGP+G  G AG R      G+PG  G  G       KG  G  G  G++G +G TG+QG PG  G  GD
Sbjct:  694 AGAPGLVGPRGERGFPGERGSSGPQGLQGPRGLPGTPGTDGPKGATGPSGPNGAQGPPGLQGMPGERGAAGISGPKGDRGDTGEKGPEGAPGKDGSRGLTGPIGPPGPSGPNGEKGESGPSGPAGIVGARGAPGDRGETGPPGPAGFAGPPGADGQAGLKGDQG------------------------ESGQKGDAGAPGPQGPSGAPGPQGPTGVNGPKGARG---AQGPPGATGFPGAAGRVGPPGPNGNPGPSGAPGSAGKEGPKGARGDAGPT---------------------------------GRAGDPGLQGPAGVPGEKGESGEDGPSGPDGPPGPQGLSGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGGPGSAGDRGPPGPVGPPGLTGPAGEPGREGNAGSDGPPGRDGATGIKGDRGETGPLGAPGAPGAPGAPGPVGPTGKQGDRGESGPQGPLGPSGPAGAR------GLPGPQGPRGD------KGEAGEAGERGQKGHRGFTGLQGLPGPPGTAGD 1155          

HSP 5 Score: 93.9745 bits (232), Expect = 3.888e-18
Identity = 64/257 (24.90%), Postives = 114/257 (44.36%), Query Frame = -3
Query:  229 KTEKISSIDPNDEDEDIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCIEPEVVNYKKTSYTKTISSWFSVLASLNKQISY-KIPKEQLVFXXXXXXXXXXXXXXSCDQIALVSDDSITQDIRYN--NSVQLF----GDDNQILTVNNEDDL---------FQYKVVEDTCKDKSNNGRAVIKVEXXXXXXXXXXXLNFKSIE-NSRPAMIGIEIGPVCF 948
            + ++ SS  P   D D+   L  L++ ++++  P G+K  PAR+C D++  +    +G ++IDPN G   DAI V CN +  ETC+ P      K        +W+S      K I + +       F      S+  T  +    + L+S D+ TQ+I Y+  NS+       G+  + + +   +D+         F Y  +ED CK  +      + +E    +   +  ++   ++        G++IGPVCF
Sbjct: 1245 RADQASSSVPQ-RDVDVEATLKSLNNQIESIRSPDGTKKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTVDAIKVFCNMETGETCVYPNPSKIPK-------KNWWSAKGKEKKHIWFGETINGGFQFSYGDDSSAPNTANIQMTFLRLLSTDA-TQNITYHCKNSIAFMDEASGNLKKAVLLQGSNDVEIRAEGNSRFTYNALEDGCKKHTGKWSKTV-IEYRTQKTSRLPIVDIAPMDIGGADQEFGVDIGPVCF 1491          

HSP 6 Score: 87.4261 bits (215), Expect = 4.601e-16
Identity = 222/556 (39.93%), Postives = 257/556 (46.22%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLG---------PQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGK---AGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGL------RGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPG---------PQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRG------------VNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
             GE G  G  G  G  G  GP G +G  G RG  G+DG+ GP+G  G         P+G  G PGR G  G PG  G  G PG  G  G+ G  G  G  G PG PG +G  G+ G  G  G KG+ G+ G  G  G  GAPG  G PGK    G  GP+G  G  G+ G  G  G  G +G  G  G  GE G  GD G  G +G+PGL      RG PG  GS G QG  G RG  G  G+ GP+G TG  G  G  G  G+ G PG+ G AG  G                       G  G  G  G  G PGK+   G         P GP GE+G  G SG  G+ G  G PG  G  GP GP G +G  G  G  G  G +G  G KG  G PG  G +GA GPQGP G NG  G  G QGP G  G  G  G             +GAPG  GK+G        GA+G+ GP G +G        G+QGP G  G KG+ G  GP G  G PG  G  G  G  G  G +G++G PG PG  G  G Q
Sbjct:  490 AGEEGKRGARGEPGAAGPLGPPGERGAPGNRGFPGQDGLAGPKGAPGERGVPGLGGPKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGASGEDGRPGPPGPQGARGQPGVMGFPGPKGANGEPGKAGEKGLLGAPGLRGLPGKDGETGAQGPNGPAGPAGERGEQGPPGPSGFQGLPGPPGSPGEGGKPGDQGVPGEAGAPGLVGPRGERGFPGERGSSGPQGLQGPRGLPGTPGTDGPKGATGPSGPNGAQGPPGLQGMPGERGAAGISG---------------------PKGDRGDTGEKGPEGAPGKDGSRGLTGPIGPPGPSGPNGEKGESGPSGPAGIVGARGAPGDRGETGPPGPAGFAGPPGADGQAGLKGDQGESGQKGDAGAPGPQGPSGAPGPQGPTGVNGPKGARGAQGPPGATGFPGAAGRVGPPGPNGNPGPSGAPGSAGKEGPK------GARGDAGPTGRAGD------PGLQGPAGVPGEKGESGEDGPSGPDGPPGPQGLSGQRGIVGLPGQRGERGFPGLPGPSGEPGKQ 1012          

HSP 7 Score: 75.8702 bits (185), Expect = 1.235e-12
Identity = 140/459 (30.50%), Postives = 173/459 (37.69%), Query Frame = 1
Query: 6031 GAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFP------------------GARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKG---------SKGPYGKPGIAGDNGASGPQGPRGEN---------------GDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQ------------------------------GPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            GAPG  G+ G  G  GP G +G  G                        E G+ G  GP G SG+PG  G PG  GS G+ G                    G  GP+G  G PG  G  G  G +G IG AG  G PG  G+ G+ G                                      G+    GP GP GERG PG  G  G         Q GL GP G PG   +RG+PG  GP G  G+ G         ++G  G+PG AG  G  GP G  GE+               G +G  G +G  GE G AG +G+ GAPG+ G  G++G+    G  G  GP G  G +GP G +G Q                              GP G  G  G+ GS+GP                     +G +G +GLPG   TPG  GP+
Sbjct:  374 GAPGSKGEAGPTGARGPEGAQGPRG------------------------ESGTPGSPGPAGASGNPGTDGIPGAKGSSGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGQTGDPGVAGFKGEHGPKGEIGSAGPQGAPGPAGEEGKRGAR------------------------------------GEPGAAGPLGPPGERGAPGNRGFPG---------QDGLAGPKGAPG---ERGVPGLGGPKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGASGEDGRPGPPGPQGARGQPGVMGFPGPKGANGEPGKAGEKGLLGAPGLRGLPGKDGETGAQGPNGPAGPAGERGEQGPPGPSGFQGLPGPPGSPGEGGKPGDQGVPGEAGAPGLVGPRGERGFPGERGSSGP---------------------QGLQGPRGLPG---TPGTDGPK 736          

HSP 8 Score: 53.5286 bits (127), Expect = 7.153e-6
Identity = 84/176 (47.73%), Postives = 99/176 (56.25%), Query Frame = -3
Query: 3067 GSKGNVGPLGPKGEPGFQGNRGGRGSPGATGASGKRGSIGPQGENGFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDTGLQGSQGMPGLEGAKGKRGERGSIGMPGELGKRGVRGSPGIDGSIGYAGGRGLSGMRXXXXXXXXXXXXGLQGDSGPPGAIGNKGSQGD 3594
            GSKG  GP G +G  G QG RG  G+PG+ G +G  G+ G  G  G KG  G  G  G PG  G RGPPG +G  G  GP G  GD G+ G +G  G +G  G  G +G+ G  GE GKRG RG PG  G +G  G RG  G RG PG +G  GP G  G+ G PG  G KG+ GD
Sbjct:  377 GSKGEAGPTGARGPEGAQGPRGESGTPGSPGPAGASGNPGTDGIPGAKGSSGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGQTGDPGVAGFKGEHGPKGEIGSAGPQGAPGPAGEEGKRGARGEPGAAGPLGPPGERGAPGNRGFPGQDGLAGPKGAPGERGVPGLGGPKGANGD 552          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Xenopus
Match: col1a2 (collagen type I alpha 2 [Source:NCBI gene;Acc:780175])

HSP 1 Score: 156.377 bits (394), Expect = 3.234e-37
Identity = 83/238 (34.87%), Postives = 119/238 (50.00%), Query Frame = 1
Query: 8530 RDLLNDDALAVKYLGSDVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASDVTEYRS-WFGE-ITGTFKFDYQIE-------ASQLMFLKLFSTNARQRITINCSRLSV-----VGNSEHPVILYSDHDEEVLRNGD-LFKYSVIRDGCKNSAEIIDSTELEMDT-EAIRLPIRDIA-LNTGSSKEQQQFGLDIGQVCF 9192
            +D   D  L       + +  P G+K  PARTC+ L  ++P+   GFY+IDPN G   D+ RV C     E+CI +   S   K+W  S   + +  WFGE I G  + +Y  E       A+Q  F++L + +A Q IT +C           GN +  ++L   +D E+   G+  F +SV+ DGC         T +E  T +  RLPI DIA L+ G   + Q+FGLDIG VCF
Sbjct:  945 KDYEVDATLKSLNNQIETILTPEGSKKNPARTCRDLRLSHPDWSSGFYWIDPNQGCTSDSIRVFCDFSTGETCIHANPDSIPQKNWYTSKTKQRKHVWFGETINGGTQIEYNEEGVTSKDMATQFAFMRLLANHASQNITYHCKNSIAYMDGQTGNLKKAILLQGSNDVELRAEGNSRFTFSVLEDGCTQHTGEWGRTVIEYRTNKPSRLPILDIAPLDIGG--DDQEFGLDIGPVCF 1180          

HSP 2 Score: 112.079 bits (279), Expect = 1.137e-23
Identity = 218/596 (36.58%), Postives = 257/596 (43.12%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXX------------------XXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHG---------------DPGKAGIDGPSGVKGDPGKTXXXXX--XXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQG------------PLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGP---------PGNSGQRGLPGSNGPSGT------KGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAK------------GNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDK------GLPGNPGTPGVIGP 7188
            TG  G  GP GP G+ G  GP G  G +G+ G +G  G  GP G  G  G  G+ G  G  G+PGP GN G  G  G++G  G++GE G  G                    G  G RG  GE G+ G LG  G  G  G PGSDG +G PG  G               + G AG+ GP G KGD G +G  G                   GE G  G  G  GP G+PG RG  G  GS G  G PGA G  G+ G  GP+G  G  GS G +G  G  G  G +G AG  G                              P G  G PG N  PGP G            P G  G PGK G  G  G+ GP G+ G QG  GP          G SG  G PG++GPSG        G  G++G  G PG  G NG SGP GP    G  G+ G  GPVG  G  G+ G  G  G PG DG  G+D + G K            G++G +G+ G  GP G +G +G PG +G  G +G  GP G  G  G  G  G  G  G  G  G K      GLPG  G+PG  GP
Sbjct:  299 TGPAGKEGPAGPQGIEGRSGPAGASGPRGEPGSIGFPGPKGPAGEPGKNGDKGSQGPSGNRGAPGPDGNNGAQGPPGLAGNTGDKGEQGPAGAPGFQGLPGPGGAAGELGKHGERGERGAPGESGAAGPLGALGPRGPTGAPGSDGAKGEPGAAGLNGALGPSGPGGIPGERGAAGVPGPKGEKGDAGHSGEYGNPGRDGARVSRLHYLYAHRGESGPAGPSGLAGPRGAPGERGEAGPAGSTGFAGPPGAAGHTGVKGERGPKGPKGESGSPGALGAVGSHGPAGPNGPAGTTG------------------------------PRGDGGAPGANGFPGPAGRTGAPGPAGIVGPSGATGHPGKDGPRGPRGDSGPVGRPGEQGIGGPQGLIGEKGSSGESGPAGPPGASGPSGVLGALGISGLPGARGERGTPGGPGANGESGPAGPA---GSAGSRGPSGPVGSPGLTGVHGEAGRDGNPGNDGPPGRDGLPGVKGERGYPGGTGPAGSLGAVGAPGAVGPSGKSGNRGEPGPVGHAGAVGPAGPRGPSGQQGTRGDKGEAGERGARGLDGRKGHNGLQGLPGPAGSPGETGP 861          

HSP 3 Score: 111.309 bits (277), Expect = 1.887e-23
Identity = 187/486 (38.48%), Postives = 216/486 (44.44%), Query Frame = 1
Query: 5671 GPTGVPGMKGPLGVKGDKGQRGRMGKDG--------ILGPRGNLGPQGPTG------APGRRGTVGSPGPVGNAGHPGV---QGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXX---XXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPG------PRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIG 7050
            G  GVPG KG  G  G  G+ G  G+DG        +   RG  GP GP+G      APG RG  G  G  G AG PG     G+ G  G +G  G  G PG  G  G  G  G  G  G  G  G  G PG++G  G  G  G PG AGI GPSG  G PGK G  G  G  G     G +G  G  G +G KG  G  GP+G PG  G  GV+G+LG  G PGARG +G  G PG      P G  GS GS+G  G  G PG  G  G+AG+ G                                           PG  GP G  G PG  G            + G  G  GP G+ G  G PG+ GPSG  GN+G  GP G  G  G  G  GP G +G  GD G  GE+G  G  G  G  G+ G PG  G  GE G    +G  G  GP G SG  G +G +G  GP G +GL+G  G
Sbjct:  471 GAAGVPGPKGEKGDAGHSGEYGNPGRDGARVSRLHYLYAHRGESGPAGPSGLAGPRGAPGERGEAGPAGSTGFAGPPGAAGHTGVKGERGPKGPKGESGSPGALGAVGSHGPAGPNGPAGTTGPRGDGGAPGANGFPGPAGRTGAPGPAGIVGPSGATGHPGKDGPRGPRGDSGPVGRPGEQGIGGPQGLIGEKGSSGESGPAGPPGASGPSGVLGALGISGLPGARGERGTPGGPGANGESGPAGPAGSAGSRGPSGPVGSPGLTGVHGEAGRDG------------------------------------------NPGNDGPPGRDGLPGVKG------------ERGYPGGTGPAGSLGAVGAPGAVGPSGKSGNRGEPGPVGHAGAVGPAGPRGPSGQQGTRGDKGEAGERGARGLDGRKGHNGLQGLPGPAGSPGETGPAGSNGPSGPRGPAGPSGPPGKEGRSGHNGPIGPVGLRGPAG 902          

HSP 4 Score: 105.531 bits (262), Expect = 1.269e-21
Identity = 204/540 (37.78%), Postives = 239/540 (44.26%), Query Frame = 1
Query: 5641 TGEPGI---NGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPG--------------IAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGP------PGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            +G+PG+    G TG  G PG  GP G  G  G+ GR G +G  G  G  G  G  G PG RG  G  G  G  G PG +G SG                             G  G  G  G+ G PG  G RG PG  G  G AG +GP+G +G  G++G  G SG RG            E GS G  GP GP+G PG  G+ G  G  G++G PG  G  G  G PG  G TG KG QG  G  G  G PG  G AG++G                           K G  G  G PG++   GP G LG RGP G  G DG  G  G  G +G  GP GP G  G+RG  G  GP G KG+ G  G YG PG                G++G +GP G  G  G  G  GE GP G  G AG  G  G  G+ G+ G  G     G+ G +G +GS G  GP G  G  GP      PG+ G  G  G TG  G  G+ G  G  G  G  GP G +GD G  G PG  G+ GPQ
Sbjct:  185 SGDPGVAGGKGDTGAKGEPGSAGPSGPAGPSGEEGRRGPNGEAGSSGPAGNAGIRGVPGTRGLPGPDGRAGGMGAPGSRGASG---------------------------PAGARGPNGDAGRPGEPGLLGARGLPGFSGSTGPAGKEGPAGPQGIEGRSGPAGASGPRG------------EPGSIGFPGPKGPAGEPGKNGDKGSQGPSGNRGAPGPDGNNGAQGPPGLAGNTGDKGEQGPAGAPGFQGLPGPGGAAGELG---------------------------KHGERGERGAPGESGAAGPLGALGPRGPTGAPGSDGAKGEPGAAGLNGALGPSGPGGIPGERGAAGVPGPKGEKGDAGHSGEYGNPGRDGARVSRLHYLYAHRGESGPAGPSGLAGPRGAPGERGEAGPAGSTGFAGPPGAAGHTGVKGERGPKGPKGESGSPGALGAVGSHGPAGPNGPAGTTGPRGDGGAPGANGFPGPAGRTGAPGPAGIVGPSGATGHPGKDGPRGPRGDSGPVGRPGEQGIGGPQ 658          

HSP 5 Score: 105.531 bits (262), Expect = 1.291e-21
Identity = 198/552 (35.87%), Postives = 237/552 (42.93%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGI---LGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPR------------GRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGD------LGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGR------RGPQGMT---------GIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGP 7188
            +GE G  GP G  G  G  G  G++G  G RG  G DG    +G  G+ G  GP GA G  G  G PG  G  G  G+ G SG                           S G  G +G  G  G  G  G  GA G  G+PG  G  GP G  G+PGK                         G KG  GP G  G+PG  GN G  G  G  G  G +G QG  G+PG +            G+ G +G +G  G +G  G  G  G  G  G PG +G  G PG  G  G  G  G  G PG  G  G PG   + G  G  GE G PG+     V          G  GP GP G +G RG PG  G +G  G+ G  GP G  G  G  G  GP+GP+GE+G       +G+ G  GP G  G  G RG  GAPG  G  G  G+    G  G +GP G++G       RGP+G +         GI GP G IG KG  G +GP G  G  G  G  G +G  G  G +G++G PG PG  G  GP
Sbjct:  215 SGEEGRRGPNGEAGSSGPAGNAGIRGVPGTRGLPGPDGRAGGMGAPGSRGASGPAGARGPNGDAGRPGEPGLLGARGLPGFSG---------------------------STGPAGKEGPAGPQGIEGRSGPAGASGPRGEPGSIGFPGPKGPAGEPGKN------------------------GDKGSQGPSGNRGAPGPDGNNGAQGPPGLAGNTGDKGEQGPAGAPGFQGLPGPGGAAGELGKHGERGERGAPGESGAAGPLGALGPRGPTGAPGSDGAKGEPGAAGLNGALGPSGPGGIPGERGAAGVPGPKGEKGDAGHSGEYGNPGRD-GARVSRLHYLYAHRGESGPAGPSGLAGPRGAPGERGEAGPAGSTGFAGPPGAAGHTGVKGERGPKGPKGESGSPGALGAVGSHGPAGPNGPAGTTGPRGDGGAPGANGFPGPAGRTGAPGPAGIVGPSGATGHPGKDGPRGPRGDSGPVGRPGEQGIGGPQGLIGEKGSSGESGPAGPPGASGPSGVLGALGISGLPGARGERGTPGGPGANGESGP 714          

HSP 6 Score: 103.99 bits (258), Expect = 3.742e-21
Identity = 188/567 (33.16%), Postives = 228/567 (40.21%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKG---------PLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPG---------------------------RRGTVGSPGPVG---NAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILG------------SPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGS---------NGPSGTKGNKGSKGPYGKPGI------AGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGP---------------------------QGMTGIQGPPGSIGLKGDIGSTGP 7062
             G  G  G  GP G PG +G          LG  G++G+RG  G+ G  GP G LGP+GPTGAPG                            RG  G PGP G   +AGH G  G  GR G +                             +G  G  G  G  G RGAPGE G+ G AG  G +G  G  G T                        G KG+ GP GP G     G+PG +G++GS G  G  GP G  G             PGP GRTG+ G  G +G +G  G PGKDG  G  G                               +G  G PG+    GPQG +GE+G  G+SG  G PG  GP G  G  G  G PG  G+RG PG           GP+G+ G++G  GP G PG+      AG +G  G  GP G +G  G  GE+G  G  G AG  G  GAPG  G  G++G     G  G+ G +G +G RGP                            G+ G+ GP GS G  G  GS GP
Sbjct:  377 AGNTGDKGEQGPAGAPGFQGLPGPGGAAGELGKHGERGERGAPGESGAAGPLGALGPRGPTGAPGSDGAKGEPGAAGLNGALGPSGPGGIPGERGAAGVPGPKGEKGDAGHSGEYGNPGRDGARVSRLHYL-------------------YAHRGESGPAGPSGLAGPRGAPGERGEAGPAGSTGFAGPPGAAGHT------------------------GVKGERGPKGPKGE---SGSPGALGAVGSHGPAGPNGPAGTTGPRGDGGAPGANGFPGPAGRTGAPGPAGIVGPSGATGHPGKDGPRGPRG------------------------------DSGPVGRPGEQGIGGPQGLIGEKGSSGESGPAGPPGASGPSGVLGALGISGLPGARGERGTPGGPGANGESGPAGPAGSAGSRGPSGPVGSPGLTGVHGEAGRDGNPGNDGPPGRDGLPGVKGERGYPGGTGPAGSLGAVGAPGAVGPSGKSGNRGEPGPVGHAGAVGPAGPRGPSGQQGTRGDKGEAGERGARGLDGRKGHNGLQGLPGPAGSPGETGPAGSNGP 867          

HSP 7 Score: 96.6709 bits (239), Expect = 6.093e-19
Identity = 70/256 (27.34%), Postives = 119/256 (46.48%), Query Frame = -3
Query:  229 EDEDIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCIE--PEVVNYKKTSYTKT---ISSWFSVLASLNKQISY-------KIPKEQLVFXXXXXXXXXXXXXXSC-DQIALVSDDSITQDIRYNNSVQLFGDDNQILTVNNEDDLFQYKVVEDTCKDKSNN-GRAVIKVEXXXXXXXXXXXLNFKSIENSRPAMI--------------GIEIGPVCF 912
            +D ++   L  L++ ++ +  P GSK  PAR+C D++  + + S+G ++IDPN G   D+I V C+F   ETCI   P+ +  K    +KT      WF    +   QI Y       K    Q  F++L +  +SQ +T  C + IA +  D  T +++   ++ L G ++  L     +  F + V+ED C   +   GR VI+               +++ + SR  ++              G++IGPVCF
Sbjct:  945 KDYEVDATLKSLNNQIETILTPEGSKKNPARTCRDLRLSHPDWSSGFYWIDPNQGCTSDSIRVFCDFSTGETCIHANPDSIPQKNWYTSKTKQRKHVWFGETINGGTQIEYNEEGVTSKDMATQFAFMRLLANHASQNITYHCKNSIAYM--DGQTGNLK--KAILLQGSNDVELRAEG-NSRFTFSVLEDGCTQHTGEWGRTVIE---------------YRTNKPSRLPILDIAPLDIGGDDQEFGLDIGPVCF 1180          

HSP 8 Score: 92.4337 bits (228), Expect = 1.273e-17
Identity = 131/356 (36.80%), Postives = 149/356 (41.85%), Query Frame = 1
Query: 6034 APGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPG---------------KDGENGKDAVDGAKGNIGPIGSSGRRGPQGM---TGIQGPPGSIGLKGDI 7047
            A G  GDPG AG  G +G KG+PG                           S G  GP GPSG  G RG  G  GS G  G  G RG  G  G PGP GR G  G+ G+ G +G  G  G +G AG+                                             PG  G LG RG PG SG  G  G  GP G  G++G  GP G SG RG PGS       G  G KGP G+PG  GD G+ GP G RG  G  GN G QGP G  GN G +G  G  G PG               K GE G+    G  G  GP+G+ G RGP G     G +G PG+ GL G +
Sbjct:  181 ARGLSGDPGVAGGKGDTGAKGEPG---------------------------SAGPSGPAGPSGEEGRRGPNGEAGSSGPAGNAGIRGVPGTRGLPGPDGRAGGMGAPGSRGASGPAGARGPNGDAGR---------------------------------------------PGEPGLLGARGLPGFSGSTGPAGKEGPAGPQGIEGRSGPAGASGPRGEPGS------IGFPGPKGPAGEPGKNGDKGSQGPSGNRGAPGPDGNNGAQGPPGLAGNTGDKGEQGPAGAPGFQGLPGPGGAAGELGKHGERGERGAPGESGAAGPLGALGPRGPTGAPGSDGAKGEPGAAGLNGAL 458          

HSP 9 Score: 81.6481 bits (200), Expect = 1.998e-14
Identity = 143/358 (39.94%), Postives = 166/358 (46.37%), Query Frame = 1
Query: 5995 GQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQ---GPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
            G  G PG  G +G  G  G+PG AG  GP+G  G+ G+ G  G                  E GS G  G  G  G PG RG PG  G  G  G PG+RG  G  G+ GP G  G  G  G +G  G+PG  G  G AG+ G  G  G  GR GP G  G  G PG  G PGP G  G PGKN   G QGP G RG PG                        P GN+G +G PG    +G  G+KG +GP G PG  G  G  G     G  GE G+ G  GE G  G +G  G RG  GAPG  G  GE G   ++GA G  GP G  G RG  G+ G +G  G  G  G+ G+ G
Sbjct:  183 GLSGDPGVAGGKGDTGAKGEPGSAGPSGPAGPSGEEGRRGPNG------------------EAGSSGPAGNAGIRGVPGTRGLPGPDGRAGGMGAPGSRGASGPAGARGPNGDAGRPGEPGLLGARGLPGFSGSTGPAGKEGPAGPQGIEGRSGPAGASGPRGEPGSIGFPGPKGPAGEPGKNGDKGSQGPSGNRGAPG------------------------PDGNNGAQGPPGL---AGNTGDKGEQGPAGAPGFQGLPGPGGAAGELGKHGERGERGAPGESGAAGPLGALGPRGPTGAPGSDGAKGEPGAAGLNGALGPSGPGGIPGERGAAGVPGPKGEKGDAGHSGEYGNPG 495          

HSP 10 Score: 71.2478 bits (173), Expect = 2.894e-11
Identity = 223/620 (35.97%), Postives = 263/620 (42.42%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVP---------------------------------GMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRR------GTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPP---GKSXXXXXXXXXXXXXQSGLQGPIGPP------------------GNSGQRGLPGSN---------GPSGTKGNKGSKGPYGKPGIAGDN---------------GASGPQGPRGENGDLGNTGE--------------------QGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            G PG  G  G  G P                                 G K  + +   +G    +  +  L  +G +G  G TG+ G        G  G+ GPVG AG+PG  G++G  G  G PG+ G PGLPG RG  G  G  G  G +G  G  G  G  G  GA GE   PG AG  GP+G  G+ G+                   G  GE GS G  G  G  G PG RG PG  G  G  G PG+RG  G  G+ GP G  G  G  G +G  G+PG  G  G AG+ G  G  G  GR GP G  G  G PG  G PGP G  G PGKN   G QGP G RG P   G +G  G PG  G  G  G QGP G P                  G  G+RG PG +         GP G  G  GS G  G+PG AG N               GA+G  GP+GE GD G++GE                    +G  G  G +G+ G  GAPG  G+ G  G     G  G  G  G  G RGP+G  G  G PG++G    +GS GP G  G  G  G  G  G PG  GF G  G  G PG  G++GP 
Sbjct:   30 GPPGAPGRDGVDGEPGLPGPPGPPGLGGVRNSYFYTIIKFQPLEQIACGQKSLVNLVYSRGNIQELNYNSPLLLQGEIGSAGSTGSAGAAGPRGEPGPPGALGPVGPAGNPGANGVNGAKGAAGLPGVGGAPGLPGPRGIPGPPGPSGPAGARGLSGDPGVAGGKGDTGAKGE---PGSAGPSGPAGPSGEEGRR------------------GPNGEAGSSGPAGNAGIRGVPGTRGLPGPDGRAGGMGAPGSRGASGPAGARGPNGDAGRPGEPGLLGARGLPGFSGSTGPAGKEGPAGPQGIEGRSGPAGASGPRGEPGSIGFPGPKGPAGEPGKNGDKGSQGPSGNRGAPGPDGNNGAQGPPGLAGNTGDKGEQGPAGAPGFQGLPGPGGAAGELGKHGERGERGAPGESGAAGPLGALGPRGPTGAPGSDGAKGEPGAAGLNGALGPSGPGGIPGERGAAGVPGPKGEKGDAGHSGEYGNPGRDGARVSRLHYLYAHRGESGPAGPSGLAGPRGAPGERGEAGPAGSTGFAGPPGAAGHTGVKGERGPKGPKGESGSPGALGA---VGSHGPAGPNGPAGTTGPRGDGGAPGANGFPGPAGRTGAPGPAGIVGPS 625          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Xenopus
Match: col1a2 (collagen type I alpha 2 [Source:NCBI gene;Acc:780175])

HSP 1 Score: 155.992 bits (393), Expect = 3.434e-37
Identity = 83/238 (34.87%), Postives = 119/238 (50.00%), Query Frame = 1
Query: 8530 RDLLNDDALAVKYLGSDVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASDVTEYRS-WFGE-ITGTFKFDYQIE-------ASQLMFLKLFSTNARQRITINCSRLSV-----VGNSEHPVILYSDHDEEVLRNGD-LFKYSVIRDGCKNSAEIIDSTELEMDT-EAIRLPIRDIA-LNTGSSKEQQQFGLDIGQVCF 9192
            +D   D  L       + +  P G+K  PARTC+ L  ++P+   GFY+IDPN G   D+ RV C     E+CI +   S   K+W  S   + +  WFGE I G  + +Y  E       A+Q  F++L + +A Q IT +C           GN +  ++L   +D E+   G+  F +SV+ DGC         T +E  T +  RLPI DIA L+ G   + Q+FGLDIG VCF
Sbjct:  845 KDYEVDATLKSLNNQIETILTPEGSKKNPARTCRDLRLSHPDWSSGFYWIDPNQGCTSDSIRVFCDFSTGETCIHANPDSIPQKNWYTSKTKQRKHVWFGETINGGTQIEYNEEGVTSKDMATQFAFMRLLANHASQNITYHCKNSIAYMDGQTGNLKKAILLQGSNDVELRAEGNSRFTFSVLEDGCTQHTGEWGRTVIEYRTNKPSRLPILDIAPLDIGG--DDQEFGLDIGPVCF 1080          

HSP 2 Score: 122.865 bits (307), Expect = 4.998e-27
Identity = 233/569 (40.95%), Postives = 276/569 (48.51%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQ--DGYPGSDGKRGAPGEHGDPGKAGIDGP---------SGVKGDPGKTXXXXXXXXXXXXXXXXXXXXX------------------XELGSKGDIGP---MGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGP---PGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAK------------GNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDK------GLPGNPGTPGVIGP 7188
            TG  G  GP GP G+ G  GP G  G +G+ G +G  G  GP G  G  G  G+ G  G  G+PGP GN G  G  G++G  G++GE G  G PG  GL GP G  G  G  G + S     + Y G  G+RGAPGE G  G  G  GP          G KG+PG  G  G  G  GP G  G RG                     +LG  G  GP    GP G+PG RG  G  GS G  G PGA G  G+ G  GP+G  G  GS G +G  G  G  G +G AG  G  G  G PG  G  GP G  G PG  G  GP+G  G PGK+   GP+GP G+ GP   PG+ G  G  G +G  G SG  GP GPPG SG  G+ G+ G SG  G +G +   G PG  G NG SGP GP    G  G+ G  GPVG  G  G+ G  G  G PG DG  G+D + G K            G++G +G+ G  GP G +G +G PG +G  G +G  GP G  G  G  G  G  G  G  G  G K      GLPG  G+PG  GP
Sbjct:  202 TGPAGKEGPAGPQGIEGRSGPAGASGPRGEPGSIGFPGPKGPAGEPGKNGDKGSQGPSGNRGAPGPDGNNGAQGPPGLAGNTGDKGEQGPAGAPGFQGLPGPGGAAGELGKHGERVSFTHCRESYGGVWGERGAPGESGAAGPLGALGPRGPTGAPGSDGAKGEPGAAGLNGALGPSGPGGIPGERGAAGVPGPKGEKVPIMAIINKYQLGESGPAGPSGLAGPRGAPGERGEAGPAGSTGFAGPPGAAGHTGVKGERGPKGPKGESGSPGALGAVGSHGPAGPNGPAGTTGPRGDGGAPGANGFPGPAGRTGAPGPAGIVGPSGATGHPGKD---GPRGPRGDSGPVGRPGEQGIGGPQGLIGEKGSSGESGPAGPPGASGPSGVLGALGISGLPGARGER---GTPGGPGANGESGPAGPA---GSAGSRGPSGPVGSPGLTGVHGEAGRDGNPGNDGPPGRDGLPGVKGERGYPGGTGPAGSLGAVGAPGAVGPSGKSGNRGEPGPVGHAGAVGPAGPRGPSGQQGTRGDKGEAGERGARGLDGRKGHNGLQGLPGPAGSPGETGP 761          

HSP 3 Score: 112.079 bits (279), Expect = 1.245e-23
Identity = 169/478 (35.36%), Postives = 200/478 (41.84%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHG---DPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPG------PRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIG 7050
            GE G  G TG  G PG  G  GVKG++G +G  G+ G  G  G +G  GP G  G  GT G   P G+ G PG  G  G                     P G  G+ G  GI G  G  G+PG DG RG  G+ G    PG+ GI GP G+                              +G KG  G  GP+G PG  G  GV+G+LG  G PGARG +G  G PG      P G  GS GS+G  G  G PG  G  G+AG+ G                                           PG  GP G  G PG  G            + G  G  GP G+ G  G PG+ GPSG  GN+G  GP G  G  G  G  GP G +G  GD G  GE+G  G  G  G  G+ G PG  G  GE G    +G  G  GP G SG  G +G +G  GP G +GL+G  G
Sbjct:  433 GEAGPAGSTGFAGPPGAAGHTGVKGERGPKGPKGESGSPGALGAVGSHGPAGPNGPAGTTG---PRGDGGAPGANGFPG---------------------PAGRTGAPGPAGIVGPSGATGHPGKDGPRGPRGDSGPVGRPGEQGIGGPQGL------------------------------IGEKGSSGESGPAGPPGASGPSGVLGALGISGLPGARGERGTPGGPGANGESGPAGPAGSAGSRGPSGPVGSPGLTGVHGEAGRDG------------------------------------------NPGNDGPPGRDGLPGVKG------------ERGYPGGTGPAGSLGAVGAPGAVGPSGKSGNRGEPGPVGHAGAVGPAGPRGPSGQQGTRGDKGEAGERGARGLDGRKGHNGLQGLPGPAGSPGETGPAGSNGPSGPRGPAGPSGPPGKEGRSGHNGPIGPVGLRGPAG 802          

HSP 4 Score: 98.9821 bits (245), Expect = 1.083e-19
Identity = 199/557 (35.73%), Postives = 242/557 (43.45%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGI---LGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPR------------GRTGSKGS-----QGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGD------LGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGR------RGPQGMT---------GIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGP 7188
            +GE G  GP G  G  G  G  G++G  G RG  G DG    +G  G+ G  GP GA G  G  G PG  G  G  G+ G SG                           S G  G +G  G  G  G  G  GA G  G+PG  G  GP G  G+PGK                         G KG  GP G  G+PG  GN G  G  G  G  G +G QG  G+PG +            G+ G + S     +   G+ G  G PG+ G AG +G  G  GP G PG  G  G PG  G +G  GP+G  G PG+    G  GP GE+ P            +    Q G  GP GP G +G RG PG  G +G  G+ G  GP G  G  G  G  GP+GP+GE+G       +G+ G  GP G  G  G RG  GAPG  G  G  G+    G  G +GP G++G       RGP+G +         GI GP G IG KG  G +GP G  G  G  G  G +G  G  G +G++G PG PG  G  GP
Sbjct:  118 SGEEGRRGPNGEAGSSGPAGNAGIRGVPGTRGLPGPDGRAGGMGAPGSRGASGPAGARGPNGDAGRPGEPGLLGARGLPGFSG---------------------------STGPAGKEGPAGPQGIEGRSGPAGASGPRGEPGSIGFPGPKGPAGEPGKN------------------------GDKGSQGPSGNRGAPGPDGNNGAQGPPGLAGNTGDKGEQGPAGAPGFQGLPGPGGAAGELGKHGERVSFTHCRESYGGVWGERGAPGESGAAGPLGALGPRGPTGAPGSDGAKGEPGAAGLNGALGPSGPGGIPGERGAAGVPGPKGEKVP---------IMAIINKYQLGESGPAGPSGLAGPRGAPGERGEAGPAGSTGFAGPPGAAGHTGVKGERGPKGPKGESGSPGALGAVGSHGPAGPNGPAGTTGPRGDGGAPGANGFPGPAGRTGAPGPAGIVGPSGATGHPGKDGPRGPRGDSGPVGRPGEQGIGGPQGLIGEKGSSGESGPAGPPGASGPSGVLGALGISGLPGARGERGTPGGPGANGESGP 614          

HSP 5 Score: 95.9005 bits (237), Expect = 8.524e-19
Identity = 70/256 (27.34%), Postives = 119/256 (46.48%), Query Frame = -3
Query:  229 EDEDIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCIE--PEVVNYKKTSYTKT---ISSWFSVLASLNKQISY-------KIPKEQLVFXXXXXXXXXXXXXXSC-DQIALVSDDSITQDIRYNNSVQLFGDDNQILTVNNEDDLFQYKVVEDTCKDKSNN-GRAVIKVEXXXXXXXXXXXLNFKSIENSRPAMI--------------GIEIGPVCF 912
            +D ++   L  L++ ++ +  P GSK  PAR+C D++  + + S+G ++IDPN G   D+I V C+F   ETCI   P+ +  K    +KT      WF    +   QI Y       K    Q  F++L +  +SQ +T  C + IA +  D  T +++   ++ L G ++  L     +  F + V+ED C   +   GR VI+               +++ + SR  ++              G++IGPVCF
Sbjct:  845 KDYEVDATLKSLNNQIETILTPEGSKKNPARTCRDLRLSHPDWSSGFYWIDPNQGCTSDSIRVFCDFSTGETCIHANPDSIPQKNWYTSKTKQRKHVWFGETINGGTQIEYNEEGVTSKDMATQFAFMRLLANHASQNITYHCKNSIAYM--DGQTGNLK--KAILLQGSNDVELRAEG-NSRFTFSVLEDGCTQHTGEWGRTVIE---------------YRTNKPSRLPILDIAPLDIGGDDQEFGLDIGPVCF 1080          

HSP 6 Score: 91.2781 bits (225), Expect = 2.343e-17
Identity = 188/547 (34.37%), Postives = 232/547 (42.41%), Query Frame = 1
Query: 5641 TGEPGI---NGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGT------------KGNKGSKGPYGK--PGIA-------GDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGP------PGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            +G+PG+    G TG  G PG  GP G  G  G+ GR G +G  G  G  G  G  G PG RG  G  G  G  G PG +G SG                             G  G  G  G+ G PG  G RG PG  G  G AG +GP+G +G  G++                        G  G  GP G  GS G  G  G  G  G  G  G++GP G  G+PGP    G+ G+QG  G+AG  G  G+ G AG  G  G  GP G  G +G  G                      + +    G  GERG PG+SG  G  G +      G +GP G PG+ G +G PG+ G +G             +G  G  GP G+  P +A       G++G +GP G  G  G  G  GE GP G  G AG  G  G  G+ G+ G  G     G+ G +G +GS G  GP G  G  GP      PG+ G  G  G TG  G  G+ G  G  G  G  GP G +GD G  G PG  G+ GPQ
Sbjct:   88 SGDPGVAGGKGDTGAKGEPGSAGPSGPAGPSGEEGRRGPNGEAGSSGPAGNAGIRGVPGTRGLPGPDGRAGGMGAPGSRGASG---------------------------PAGARGPNGDAGRPGEPGLLGARGLPGFSGSTGPAGKEGPAGPQGIEGRS------------------------GPAGASGPRGEPGSIGFPGPKGPAGEPGKNGDKGSQGPSGNRGAPGP---DGNNGAQGPPGLAGNTGDKGEQGPAGAPGFQGLPGPGGAAGELGKHGERVSF----------------THCRESYGGVWGERGAPGESGAAGPLGAL------GPRGPTGAPGSDGAKGEPGAAGLNGALGPSGPGGIPGERGAAGVPGPKGEKVPIMAIINKYQLGESGPAGPSGLAGPRGAPGERGEAGPAGSTGFAGPPGAAGHTGVKGERGPKGPKGESGSPGALGAVGSHGPAGPNGPAGTTGPRGDGGAPGANGFPGPAGRTGAPGPAGIVGPSGATGHPGKDGPRGPRGDSGPVGRPGEQGIGGPQ 558          

HSP 7 Score: 82.4185 bits (202), Expect = 1.227e-14
Identity = 128/367 (34.88%), Postives = 154/367 (41.96%), Query Frame = 1
Query: 6028 RGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIP---------------GKDGE-----NGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGP---PGSIGLKGDIGSTG 7059
             GA G  GDPG AG  G +G KG+PG  G  G +G                 G +G  GP G +GS G  GN G+ G  G++G PG  G  G +G+PG RG +G  G++G  G AG PG PG  G  G  G                                            G  GP G+ GP G                 G++G  GP G SG RG PGS       G  G KGP G+PG  GD G+ GP G RG  G  GN G QGP G  GN G +G  G  G P               GK GE     + +++  G  G  G  G SG  GP G  G +GP   PGS G KG+ G+ G
Sbjct:   82 AGARGLSGDPGVAGGKGDTGAKGEPGSAGPSGPAGPS---------------GEEGRRGPNGEAGSSGPAGNAGIRGVPGTRGLPGPDGRAGGMGAPGSRGASGPAGARGPNGDAGRPGEPGLLGARGLPGFS------------------------------------------GSTGPAGKEGPAGP---------------QGIEGRSGPAGASGPRGEPGS------IGFPGPKGPAGEPGKNGDKGSQGPSGNRGAPGPDGNNGAQGPPGLAGNTGDKGEQGPAGAPGFQGLPGPGGAAGELGKHGERVSFTHCRESYGGVWGERGAPGESGAAGPLGALGPRGPTGAPGSDGAKGEPGAAG 370          

HSP 8 Score: 70.0922 bits (170), Expect = 6.629e-11
Identity = 63/129 (48.84%), Postives = 73/129 (56.59%), Query Frame = 1
Query: 6685 RGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGR 7071
            RGL G  G +G KG+ G+KG   +PG AG    SGP GP GE G  G  GE G  G  GNAGIRGV G  G+PG DG  G     G++G  GP G+ G  G  G  G  G  G+ GL G  GSTGP G+
Sbjct:   85 RGLSGDPGVAGGKGDTGAKG---EPGSAGP---SGPAGPSGEEGRRGPNGEAGSSGPAGNAGIRGVPGTRGLPGPDGRAGGMGAPGSRGASGPAGARGPNGDAGRPGEPGLLGARGLPGFSGSTGPAGK 207          

HSP 9 Score: 60.077 bits (144), Expect = 7.352e-8
Identity = 104/278 (37.41%), Postives = 121/278 (43.53%), Query Frame = 1
Query: 6262 LGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGE---RGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGA------SGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMG 7068
            L  QG PG  G  G+ G  G  G  G  G  G  G++G PG  G  G  G  G                                     PG     GP GP GE   RGP G++G  G  GN G  G  G +G  GP G +G  G PGS G SG  G +G  G  G+PG  G  GA      SG  GP G+ G  G  G +G  G  G +G RG  G+ G PG  G  G+   +G KG+ GP G+ G  GP G  G QGPPG  G  GD G  GP G
Sbjct:   52 LSLQGLPGVGGAPGLPGPRGIPGPPGPSGPAGARGLSGDPGVAGGKGDTGAKG------------------------------------EPGSAGPSGPAGPSGEEGRRGPNGEAGSSGPAGNAGIRGVPGTRGLPGPDGRAGGMGAPGSRGASGPAGARGPNGDAGRPGEPGLLGARGLPGFSGSTGPAGKEGPAGPQGIEGRSGPAGASGPRGEPGSIGFPGPKGPAGEPGKNGDKGSQGPSGNRGAPGPDGNNGAQGPPGLAGNTGDKGEQGPAG 293          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Mouse
Match: Col2a1 (collagen, type II, alpha 1 [Source:MGI Symbol;Acc:MGI:88452])

HSP 1 Score: 150.984 bits (380), Expect = 1.269e-35
Identity = 79/243 (32.51%), Postives = 124/243 (51.03%), Query Frame = 1
Query: 8521 TVRRDLLNDDALAVKYLGSDV--VKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASDVTEYRS-WFGE-ITGTFKFDY-------QIEASQLMFLKLFSTNARQRITINCSRL-----SVVGNSEHPVILYSDHDEEVLRNGD-LFKYSVIRDGCKNSAEIIDSTELEMDTEAI-RLPIRDIA-LNTGSSKEQQQFGLDIGQVCF 9192
            T+R+  +  DA  +K L + +  ++ P G++  PARTC+ L   +P  + G Y+IDPN G   DA +V C  +  E+C+     +   K+W +S   E +  WFGE + G F F Y            Q+ FL+L ST   Q IT +C           GN +  +++   +D E+   G+  F Y+ ++DGC         T +E  ++   RLPI DIA ++ G +  +Q+FG+DIG VCF
Sbjct: 1179 TLRQHDVEVDAT-LKSLNNQIESIRSPDGSRKNPARTCQDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETGETCVYPNPATVPRKNWWSSKSKEKKHIWFGETMNGGFHFSYGDGNLAPNTANVQMTFLRLLSTEGSQNITYHCKNSIAYLDEAAGNLKKALLIQGSNDVEMRAEGNSRFTYTALKDGCTKHTGKWGKTVIEYRSQKTSRLPIIDIAPMDIGGA--EQEFGVDIGPVCF 1418          

HSP 2 Score: 97.0561 bits (240), Expect = 3.257e-19
Identity = 230/584 (39.38%), Postives = 268/584 (45.89%), Query Frame = 1
Query: 5752 GILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXX---------------XXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQG---------------------------ILGSPGPRGRTGSKGSQGTIGIAGVPGT---PGKDGKAGQVGIXXXXXXXXXXXXXXX------XXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSG---------------------------QRGLPGSNGPSGTKGNKGSKGPYGKPG------------------IAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGI---------QGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGP 7188
            G  GP G  GP+G  G+ G  G  GSPGP G +G+PG  GI G  G+ G PG+ G PG PG RGP G +G+ G LG KG  G+ G  G  G +G  GE G  G  G  GP+G +G  G  G PG +G  GP G RG                +G  GE G  G  GP G +G PG  G PG+ G+ G  G PG  GPQG                           ++G PGP+G  G  G  G  G+AG PG    PGKDG+ G  G PG +GP G  G  G        GLPG PG  G+ G  G  G PG+   PG  GP GERG PG+ G  G           GLQGP G PG  G                           +RG  G  GP G +G+ G KGP G PG                    G+ G  GP GP G  G  G  GE+G  G  G AG  G  GA G PG  G+ G+    G  G  GP G SG  GPQG TG+         QGPPG+ G  G  G  GP G  G PG  G PG  G  GP+G +GD G PG  G PG+ GP
Sbjct:  307 GEAGPTGARGPEGAQGSRGEPGNPGSPGPAGASGNPGTDGIPGAKGSAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGQAGEPGIAGFKGDQGPKGETGPAGPQGAPGPAGEEGKRGARGEPGGAGPIGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLTGPKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMGFPGPKGANGEPGKAGEKGLAGAPGLRGLPGKDGETGAAGPPGPSGPAGERGEQGAPGPSGFQGLPGPPGPPGEGGKQGDQGIPGEAGAPGLVGPRGERGFPGERGSPGA---------QGLQGPRGLPGTPGTDGPKGAAGPDGPPGAQGPPGLQGMPGERGAAGIAGPKGDRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPSGSTGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGDQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGANGNPGPAGPPGPAGKDGPKGVRGDSGPPGRAGDPGLQGP 881          

HSP 3 Score: 90.8929 bits (224), Expect = 2.952e-17
Identity = 210/588 (35.71%), Postives = 255/588 (43.37%), Query Frame = 1
Query: 5653 GINGPTGPTGVPGMKGPLGVKGDK------------------GQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGP------------------SGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAG------------VPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNG------------PSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGK---------------DGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            G  GP GP G PG  G  G +G +                  G RG  G+DG+ GP+G  G +GP+G  G +G  G PG  G  G PG +G++GRPG+ G  G  GP G PG  G  G  G QG  G  G +G   +PG  G  G PG+ G+ G AG  G  G+ G  G+TG  G  G  GP G         E G +G  GP G                    G PG  G PG++G  G +GFPG RG  G  G  GPRG  G+ G+ G  G AG            + G PG+ G AG  G  G                                   G   + GP+G  G+ G  G +G  G PG  G  G+ G  GP GP G++G RG PG  G            P G  G  G+KG  G+ G  GD GA GPQGP G  G  G TG  GP G  G  G  G  G PG  G+                G  GKD   G +G+ GP G +G        G+QGP G+ G KG+ G  GP G  G PG  G  G  G  G  G +G++G PG PG  G  G Q
Sbjct:  403 GETGPAGPQGAPGPAGEEGKRGARGEPGGAGPIGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLTGPKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMG---FPGPKGANGEPGKAGEKGLAGAPGLRGLPGKDGETGAAGPPGPSGPAG---------ERGEQGAPGPSGFQGLPGPPGPPGEGGKQGDQGIPGEAGAPGLVGPRGERGFPGERGSPGAQGLQGPRGLPGTPGTDGPKGAAGPDGPPGAQGPPGLQGMPGERGAAGIAGPKGDR---------------------------------GDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPSGSTGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGDQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGANGNPGPAGPPGPAGKDGPKGVRGDSGPPGRAGD------PGLQGPAGAPGEKGEPGDDGPSGLDGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQ 939          

HSP 4 Score: 90.8929 bits (224), Expect = 3.002e-17
Identity = 62/270 (22.96%), Postives = 109/270 (40.37%), Query Frame = -3
Query:  229 EDEDIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCIEPEVVNYKKTSYTKTISS-----WFSVLASLNKQISY-------KIPKEQLVFXXXXXXXXXXXXXXSCDQIALVSDDSITQDIRYN--NSVQLF----GDDNQILTVNNEDDL---------FQYKVVEDTC-KDKSNNGRAVIKVEXXXXXXXXXXXLNFKSIENSRPAMI--------------GIEIGPVCF 912
             D ++   L  L++ ++++  P GS+  PAR+C D++  +    +G ++IDPN G   DA+ V CN +  ETC+ P      + ++  + S      WF    +     SY            Q+ F                  + L+S +  +Q+I Y+  NS+       G+  + L +   +D+         F Y  ++D C K     G+ VI+               ++S + SR  +I              G++IGPVCF
Sbjct: 1183 HDVEVDATLKSLNNQIESIRSPDGSRKNPARTCQDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETGETCVYPNPATVPRKNWWSSKSKEKKHIWFGETMNGGFHFSYGDGNLAPNTANVQMTF------------------LRLLSTEG-SQNITYHCKNSIAYLDEAAGNLKKALLIQGSNDVEMRAEGNSRFTYTALKDGCTKHTGKWGKTVIE---------------YRSQKTSRLPIIDIAPMDIGGAEQEFGVDIGPVCF 1418          

HSP 5 Score: 75.0998 bits (183), Expect = 1.648e-12
Identity = 201/542 (37.08%), Postives = 240/542 (44.28%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAG------DNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAP---GIPGKDGENGKDAVDGAKGNIGPIGSSGRRGP---------------------QGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPG 7176
            +GE G+ GP G  G PG  G  GV   KG RG  G DG  G  G  G +G +G+PG     GSPGP+G  G PG +G +G  G  G  G  G PG  G  GP G  G  G  G  G+ G+ G  G+ G  GA G  G+PG  G  GP+G  G+PG  G PG  G  G  G  G  G  G  G  G  G  GP G  G  G PG+ G  G QG  G  GP G  G+PGP G  G +G++G  G AG  G PG+ G  G  G                                     PG++   GP+G  GERGP                  SGL GP G  G+ G+ G PG  G  G  G  G  GP GK G +G        G  GPQG RG+ G +G  G +G  GE G AG +G+ GAP   G+PGKDGE G     G  G  G  G  G  GP                     QG+ G  G PG +G +G+ G  G  G                PG +G +G +GLPG PGT G
Sbjct:  195 SGERGLPGPQGARGFPGTPGLPGV---KGHRGYPGLDGAKGEAGAPGVKGESGSPGEN---GSPGPMGPRGLPGERGRTGPAGAAGARGNDGQPGPAGPPGPVGPAGGPGFPGAPGAKGEAGPTGARGPEGAQGSRGEPGNPGSPGPAGASGNPGTDGIPGAKGSAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGQAGEPGIAGFKGDQGPKGETGPAGPQGAPGPAGEEGKRGARGEPGGAGPIGPPGERGAPGNRGF------------------------------------PGQDGLAGPKGAPGERGP------------------SGLTGPKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMGFPGPKGANGEPGKAGEKGLAGAPGLRGLPGKDGETGAAGPPGPSGPAGERGEQGAPGPSGFQGLPGPPGPPGEGGKQGDQGIPGEAGAPGLVGPRGERGFPGERG---------------SPGAQGLQGPRGLPGTPGTDG 661          

HSP 6 Score: 70.8626 bits (172), Expect = 3.744e-11
Identity = 181/518 (34.94%), Postives = 214/518 (41.31%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGP---------TGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGD---PGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIG---PMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRT---------------------GSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSG------LQGPIGPPGNSGQRGLPGSN------------------GPSGTKGNKGSKGPYGKPGIAGDNGASGPQ------------------GPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIG 6960
             G PG+ GP G  G PG +G  G +G +G RG  G  G  GP+G  GP GP          G PG RG  G  GP G+ G  G +G  G PG  G  G+ GP G PG  G           G KG +G  G  GS G RGAPGE G+   PG AG  GP G  G PG  G+ G                  E G KGD G   P GPSG+PG +G  GV G  G++G   A+GP G  G PG  GR                      G KG +G  G  G  G PG  G AG                                        PG+  +PG  GP G  GPPG  G  G  G VG PGQ G      L GP G P   G++G PG++                  G  G +G+ G+ GP G+ G AG  G  G                    GP G+ GD G  G QGP+G  G AG RG+ G  G  G  GE+G+    G KG+ G
Sbjct:  621 AGAPGLVGPRGERGFPGERGSPGAQGLQGPRGLPGTPGTDGPKGAAGPDGPPGAQGPPGLQGMPGERGAAGIAGPKGDRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGAN---------GEKGEVGPPGPSGSTGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGDQG------------------EAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARG---AQGPPGATGFPGAAGRVGPPGANGNPGPAGPPGPAGKDGPKGVRGDSGPPGRAGDPGLQGPAG---------------------------------------APGEKGEPGDDGPSGLDGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEP---GKQGAPGASGDRGPPGPVGPPGLTGPAGEPGREGSPGADGPPGRDGAAGVKGDRGETGALGAPGAPGPPGSPGPAGPTGKQGDRGEAGAQGPMGPSGPAGARGIAGPQGPRGDKGESGEQGERGLKGHRG 1066          

HSP 7 Score: 66.6254 bits (161), Expect = 6.020e-10
Identity = 189/514 (36.77%), Postives = 234/514 (45.53%), Query Frame = 1
Query: 5641 TGEPGINGP---TGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPR------GNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXX------------XXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASG---------------PQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVD------GAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGST 7056
            TG PG  GP    GP+G PG  G  G  G +G RG+ G  G  GP+      G  G +G  GAPG RG  G  G  G AG PG  G +G  G QG PG  G  GLPG  GP GE G QG  GI G  G  G  G  G+RG PGE G PG  G+ GP G+ G PG  G  G +G  GP G             RG  GI G  G +GD+G  GP G+PG  G  G+ G +G  G  GA G +G +G PGP G TG++G+ G  G  G PG  G  G                                           PG + QPG +G  GE                     +G +G  G PG  G  G PG  GP+G  G KG++G  G PG  G  GA+G               P GP G++G  G  G+ GP G  G+ G++G  GAPG  G+ G++G   +D      G  G  G +G  G+RG +G  G+ GP G  G +G  G++
Sbjct:  495 TGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMGFPGPKGANGEPGKAGEKGLAGAPGLRGLPGKDGETGAAGPPGPSGPAGERGEQGAPGPSGFQGLPGPPGPPGEGGKQGDQGIPGEAGAPGLVGPRGERGFPGERGSPGAQGLQGPRGLPGTPGTDGPKGAAGPDGPPGAQGPPGLQGMPGERGAAGIAGPKGDRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPSGSTGARGAPGERGETGPPGPAGFAG------------------------------------------PPGADGQPGAKGDQGE---------------------AGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGANGNPGPAGPPGPAGKDGPKGVRGDSGPPGRAGDPGLQGPAGAPGEKGEPGDDGPSGLDGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGAS 945          

HSP 8 Score: 66.6254 bits (161), Expect = 6.660e-10
Identity = 175/499 (35.07%), Postives = 214/499 (42.89%), Query Frame = 1
Query: 5671 GPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRG---NLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAP------------GEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIG---SLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGN---------------AGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMG 7068
            G  G PG+ GP G +G  G+RG  G  G+ GPRG     G  GP GA G  G  G+ GP G  G PG +G +G                          G +G  G  G  G +G PG DG RG              GE G+ G  G  G +G +G PG                        E G  G  GP G +G PG  G PG  G     G +G  GA GPQG  G+PGP+G TG  G +G  G  G PG  G  G AG+VG PG NG PG  GP G                           + GP+G  G+ GPPG++G              GLQGP G PG   ++G PG +GPSG  G  G +G  G+ GI G  G  G +G  G  G  G  G+QG  G  G+               AG  G  G+PG  G  G +G   V G +G  G +G+ G  GP G  G  GP G  G +G+ G+ GPMG
Sbjct:  619 GEAGAPGLVGPRGERGFPGERGSPGAQGLQGPRGLPGTPGTDGPKGAAGPDGPPGAQGPPGLQGMPGERGAAG------------------------IAGPKGDRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPSGSTGARGAPG------------------------ERGETGPPGPAGFAGPPGADGQPGAKGDQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGANGNPGPAGPPG------------------------PAGKDGPKGVRGDSGPPGRAG------------DPGLQGPAGAPG---EKGEPGDDGPSGLDGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPPGPVGPPGLTGPAGEPGREGSPGADGPPGRDGAAGVKGDRGETGALGAPGAPGPPGSPGPAGPTGKQGDRGEAGAQGPMG 1030          

HSP 9 Score: 64.3142 bits (155), Expect = 3.268e-9
Identity = 133/349 (38.11%), Postives = 159/349 (45.56%), Query Frame = 1
Query: 6184 GSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNG------------ASGPQGPRGENGD---LGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIG 7185
            G  G+ G  GP G+ G  G PG+ G  G +G+PG  G +G  G+PG +G +GS G           G+PG  G  G  G  G+ GP G  G  G  G PG  G  G  GPAG PG PG     G  GP G RGP                   G QG  G PGN G  G  G++G  GT G  G+KG  G PGIAG  G            A+GP GP+G+ G+    G  G+QGP GE G AG +G  G  G  GK G  G+    G  G  G  G+ G RG  G  G+ GP G+ G +G  G TGP                     +G  GD G PG PG PG  G
Sbjct:  193 GKSGERGLPGPQGARGFPGTPGLPGVKGHRGYPGLDGAKGEAGAPGVKGESGSPGEN---------GSPGPMGPRGLPGERGRTGPAGAAGARGNDGQPGPAGPPGPVGPAGGPGFPGAPGAKGEAGPTGARGP------------------EGAQGSRGEPGNPGSPGPAGASGNPGTDGIPGAKGSAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGQAGEPGIAGFKGDQGPKGETGPAGPQGAPGPAGEEGKRGARGEPGGAGPIGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLTGP---------------------KGANGDPGRPGEPGLPGARG 493          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Mouse
Match: Col2a1 (collagen, type II, alpha 1 [Source:MGI Symbol;Acc:MGI:88452])

HSP 1 Score: 148.288 bits (373), Expect = 1.074e-34
Identity = 79/243 (32.51%), Postives = 124/243 (51.03%), Query Frame = 1
Query: 8521 TVRRDLLNDDALAVKYLGSDV--VKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASDVTEYRS-WFGE-ITGTFKFDY-------QIEASQLMFLKLFSTNARQRITINCSRL-----SVVGNSEHPVILYSDHDEEVLRNGD-LFKYSVIRDGCKNSAEIIDSTELEMDTEAI-RLPIRDIA-LNTGSSKEQQQFGLDIGQVCF 9192
            T+R+  +  DA  +K L + +  ++ P G++  PARTC+ L   +P  + G Y+IDPN G   DA +V C  +  E+C+     +   K+W +S   E +  WFGE + G F F Y            Q+ FL+L ST   Q IT +C           GN +  +++   +D E+   G+  F Y+ ++DGC         T +E  ++   RLPI DIA ++ G +  +Q+FG+DIG VCF
Sbjct: 1247 TLRQHDVEVDAT-LKSLNNQIESIRSPDGSRKNPARTCQDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETGETCVYPNPATVPRKNWWSSKSKEKKHIWFGETMNGGFHFSYGDGNLAPNTANVQMTFLRLLSTEGSQNITYHCKNSIAYLDEAAGNLKKALLIQGSNDVEMRAEGNSRFTYTALKDGCTKHTGKWGKTVIEYRSQKTSRLPIIDIAPMDIGGA--EQEFGVDIGPVCF 1486          

HSP 2 Score: 97.4413 bits (241), Expect = 2.668e-19
Identity = 230/584 (39.38%), Postives = 268/584 (45.89%), Query Frame = 1
Query: 5752 GILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXX---------------XXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQG---------------------------ILGSPGPRGRTGSKGSQGTIGIAGVPGT---PGKDGKAGQVGIXXXXXXXXXXXXXXX------XXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSG---------------------------QRGLPGSNGPSGTKGNKGSKGPYGKPG------------------IAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGI---------QGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGP 7188
            G  GP G  GP+G  G+ G  G  GSPGP G +G+PG  GI G  G+ G PG+ G PG PG RGP G +G+ G LG KG  G+ G  G  G +G  GE G  G  G  GP+G +G  G  G PG +G  GP G RG                +G  GE G  G  GP G +G PG  G PG+ G+ G  G PG  GPQG                           ++G PGP+G  G  G  G  G+AG PG    PGKDG+ G  G PG +GP G  G  G        GLPG PG  G+ G  G  G PG+   PG  GP GERG PG+ G  G           GLQGP G PG  G                           +RG  G  GP G +G+ G KGP G PG                    G+ G  GP GP G  G  G  GE+G  G  G AG  G  GA G PG  G+ G+    G  G  GP G SG  GPQG TG+         QGPPG+ G  G  G  GP G  G PG  G PG  G  GP+G +GD G PG  G PG+ GP
Sbjct:  375 GEAGPTGARGPEGAQGSRGEPGNPGSPGPAGASGNPGTDGIPGAKGSAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGQAGEPGIAGFKGDQGPKGETGPAGPQGAPGPAGEEGKRGARGEPGGAGPIGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLTGPKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMGFPGPKGANGEPGKAGEKGLAGAPGLRGLPGKDGETGAAGPPGPSGPAGERGEQGAPGPSGFQGLPGPPGPPGEGGKQGDQGIPGEAGAPGLVGPRGERGFPGERGSPGA---------QGLQGPRGLPGTPGTDGPKGAAGPDGPPGAQGPPGLQGMPGERGAAGIAGPKGDRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPSGSTGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGDQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGANGNPGPAGPPGPAGKDGPKGVRGDSGPPGRAGDPGLQGP 949          

HSP 3 Score: 91.2781 bits (225), Expect = 2.219e-17
Identity = 210/588 (35.71%), Postives = 255/588 (43.37%), Query Frame = 1
Query: 5653 GINGPTGPTGVPGMKGPLGVKGDK------------------GQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGP------------------SGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAG------------VPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNG------------PSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGK---------------DGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            G  GP GP G PG  G  G +G +                  G RG  G+DG+ GP+G  G +GP+G  G +G  G PG  G  G PG +G++GRPG+ G  G  GP G PG  G  G  G QG  G  G +G   +PG  G  G PG+ G+ G AG  G  G+ G  G+TG  G  G  GP G         E G +G  GP G                    G PG  G PG++G  G +GFPG RG  G  G  GPRG  G+ G+ G  G AG            + G PG+ G AG  G  G                                   G   + GP+G  G+ G  G +G  G PG  G  G+ G  GP GP G++G RG PG  G            P G  G  G+KG  G+ G  GD GA GPQGP G  G  G TG  GP G  G  G  G  G PG  G+                G  GKD   G +G+ GP G +G        G+QGP G+ G KG+ G  GP G  G PG  G  G  G  G  G +G++G PG PG  G  G Q
Sbjct:  471 GETGPAGPQGAPGPAGEEGKRGARGEPGGAGPIGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLTGPKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMG---FPGPKGANGEPGKAGEKGLAGAPGLRGLPGKDGETGAAGPPGPSGPAG---------ERGEQGAPGPSGFQGLPGPPGPPGEGGKQGDQGIPGEAGAPGLVGPRGERGFPGERGSPGAQGLQGPRGLPGTPGTDGPKGAAGPDGPPGAQGPPGLQGMPGERGAAGIAGPKGDR---------------------------------GDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPSGSTGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGDQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGANGNPGPAGPPGPAGKDGPKGVRGDSGPPGRAGD------PGLQGPAGAPGEKGEPGDDGPSGLDGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQ 1007          

HSP 4 Score: 88.5817 bits (218), Expect = 1.333e-16
Identity = 62/270 (22.96%), Postives = 109/270 (40.37%), Query Frame = -3
Query:  229 EDEDIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCIEPEVVNYKKTSYTKTISS-----WFSVLASLNKQISY-------KIPKEQLVFXXXXXXXXXXXXXXSCDQIALVSDDSITQDIRYN--NSVQLF----GDDNQILTVNNEDDL---------FQYKVVEDTC-KDKSNNGRAVIKVEXXXXXXXXXXXLNFKSIENSRPAMI--------------GIEIGPVCF 912
             D ++   L  L++ ++++  P GS+  PAR+C D++  +    +G ++IDPN G   DA+ V CN +  ETC+ P      + ++  + S      WF    +     SY            Q+ F                  + L+S +  +Q+I Y+  NS+       G+  + L +   +D+         F Y  ++D C K     G+ VI+               ++S + SR  +I              G++IGPVCF
Sbjct: 1251 HDVEVDATLKSLNNQIESIRSPDGSRKNPARTCQDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETGETCVYPNPATVPRKNWWSSKSKEKKHIWFGETMNGGFHFSYGDGNLAPNTANVQMTF------------------LRLLSTEG-SQNITYHCKNSIAYLDEAAGNLKKALLIQGSNDVEMRAEGNSRFTYTALKDGCTKHTGKWGKTVIE---------------YRSQKTSRLPIIDIAPMDIGGAEQEFGVDIGPVCF 1486          

HSP 5 Score: 76.2554 bits (186), Expect = 7.198e-13
Identity = 201/542 (37.08%), Postives = 240/542 (44.28%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAG------DNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAP---GIPGKDGENGKDAVDGAKGNIGPIGSSGRRGP---------------------QGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPG 7176
            +GE G+ GP G  G PG  G  GV   KG RG  G DG  G  G  G +G +G+PG     GSPGP+G  G PG +G +G  G  G  G  G PG  G  GP G  G  G  G  G+ G+ G  G+ G  GA G  G+PG  G  GP+G  G+PG  G PG  G  G  G  G  G  G  G  G  G  GP G  G  G PG+ G  G QG  G  GP G  G+PGP G  G +G++G  G AG  G PG+ G  G  G                                     PG++   GP+G  GERGP                  SGL GP G  G+ G+ G PG  G  G  G  G  GP GK G +G        G  GPQG RG+ G +G  G +G  GE G AG +G+ GAP   G+PGKDGE G     G  G  G  G  G  GP                     QG+ G  G PG +G +G+ G  G  G                PG +G +G +GLPG PGT G
Sbjct:  263 SGERGLPGPQGARGFPGTPGLPGV---KGHRGYPGLDGAKGEAGAPGVKGESGSPGEN---GSPGPMGPRGLPGERGRTGPAGAAGARGNDGQPGPAGPPGPVGPAGGPGFPGAPGAKGEAGPTGARGPEGAQGSRGEPGNPGSPGPAGASGNPGTDGIPGAKGSAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGQAGEPGIAGFKGDQGPKGETGPAGPQGAPGPAGEEGKRGARGEPGGAGPIGPPGERGAPGNRGF------------------------------------PGQDGLAGPKGAPGERGP------------------SGLTGPKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMGFPGPKGANGEPGKAGEKGLAGAPGLRGLPGKDGETGAAGPPGPSGPAGERGEQGAPGPSGFQGLPGPPGPPGEGGKQGDQGIPGEAGAPGLVGPRGERGFPGERG---------------SPGAQGLQGPRGLPGTPGTDG 729          

HSP 6 Score: 71.2478 bits (173), Expect = 2.551e-11
Identity = 192/515 (37.28%), Postives = 219/515 (42.52%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGP---------TGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGD---PGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIG---PMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRT---------------------GSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSG------LQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
             G PG+ GP G  G PG +G  G +G +G RG  G  G  GP+G  GP GP          G PG RG  G  GP G+ G  G +G  G PG  G  G+ GP G PG  G           G KG +G  G  GS G RGAPGE G+   PG AG  GP G  G PG  G+ G                  E G KGD G   P GPSG+PG +G  GV G  G++G   A+GP G  G PG  GR                      G KG +G  G  G  G PG  G AG                                        PG+  +PG  GP G  GPPG  G  G  G VG PGQ G      L GP G PG  G  G  G  GP G  G  G  GP G+PG  G  GA GP G  G  G  G+ GE G +G  G  G  G  G  G  GK G+ G+    G  G  GP G+ G  GPQG  G +G  G  G +G  G  G
Sbjct:  689 AGAPGLVGPRGERGFPGERGSPGAQGLQGPRGLPGTPGTDGPKGAAGPDGPPGAQGPPGLQGMPGERGAAGIAGPKGDRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGAN---------GEKGEVGPPGPSGSTGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGDQG------------------EAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARG---AQGPPGATGFPGAAGRVGPPGANGNPGPAGPPGPAGKDGPKGVRGDSGPPGRAGDPGLQGPAG---------------------------------------APGEKGEPGDDGPSGLDGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPPGPVGPPGLTGPAGEPGREGSPGADGPPGRDGAAGVKGDRGETGALGAPGAPGPPGSPGPAGPTGKQGDRGEAGAQGPMGPSGPAGARGIAGPQGPRGDKGESGEQGERGLKGHRG 1134          

HSP 7 Score: 67.3958 bits (163), Expect = 3.736e-10
Identity = 189/514 (36.77%), Postives = 234/514 (45.53%), Query Frame = 1
Query: 5641 TGEPGINGP---TGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPR------GNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXX------------XXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASG---------------PQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVD------GAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGST 7056
            TG PG  GP    GP+G PG  G  G  G +G RG+ G  G  GP+      G  G +G  GAPG RG  G  G  G AG PG  G +G  G QG PG  G  GLPG  GP GE G QG  GI G  G  G  G  G+RG PGE G PG  G+ GP G+ G PG  G  G +G  GP G             RG  GI G  G +GD+G  GP G+PG  G  G+ G +G  G  GA G +G +G PGP G TG++G+ G  G  G PG  G  G                                           PG + QPG +G  GE                     +G +G  G PG  G  G PG  GP+G  G KG++G  G PG  G  GA+G               P GP G++G  G  G+ GP G  G+ G++G  GAPG  G+ G++G   +D      G  G  G +G  G+RG +G  G+ GP G  G +G  G++
Sbjct:  563 TGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMGFPGPKGANGEPGKAGEKGLAGAPGLRGLPGKDGETGAAGPPGPSGPAGERGEQGAPGPSGFQGLPGPPGPPGEGGKQGDQGIPGEAGAPGLVGPRGERGFPGERGSPGAQGLQGPRGLPGTPGTDGPKGAAGPDGPPGAQGPPGLQGMPGERGAAGIAGPKGDRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPSGSTGARGAPGERGETGPPGPAGFAG------------------------------------------PPGADGQPGAKGDQGE---------------------AGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGANGNPGPAGPPGPAGKDGPKGVRGDSGPPGRAGDPGLQGPAGAPGEKGEPGDDGPSGLDGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGAS 1013          

HSP 8 Score: 67.0106 bits (162), Expect = 4.689e-10
Identity = 175/499 (35.07%), Postives = 214/499 (42.89%), Query Frame = 1
Query: 5671 GPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRG---NLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAP------------GEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIG---SLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGN---------------AGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMG 7068
            G  G PG+ GP G +G  G+RG  G  G+ GPRG     G  GP GA G  G  G+ GP G  G PG +G +G                          G +G  G  G  G +G PG DG RG              GE G+ G  G  G +G +G PG                        E G  G  GP G +G PG  G PG  G     G +G  GA GPQG  G+PGP+G TG  G +G  G  G PG  G  G AG+VG PG NG PG  GP G                           + GP+G  G+ GPPG++G              GLQGP G PG   ++G PG +GPSG  G  G +G  G+ GI G  G  G +G  G  G  G  G+QG  G  G+               AG  G  G+PG  G  G +G   V G +G  G +G+ G  GP G  G  GP G  G +G+ G+ GPMG
Sbjct:  687 GEAGAPGLVGPRGERGFPGERGSPGAQGLQGPRGLPGTPGTDGPKGAAGPDGPPGAQGPPGLQGMPGERGAAG------------------------IAGPKGDRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPSGSTGARGAPG------------------------ERGETGPPGPAGFAGPPGADGQPGAKGDQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGANGNPGPAGPPG------------------------PAGKDGPKGVRGDSGPPGRAG------------DPGLQGPAGAPG---EKGEPGDDGPSGLDGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPPGPVGPPGLTGPAGEPGREGSPGADGPPGRDGAAGVKGDRGETGALGAPGAPGPPGSPGPAGPTGKQGDRGEAGAQGPMG 1098          

HSP 9 Score: 64.6994 bits (156), Expect = 2.339e-9
Identity = 133/349 (38.11%), Postives = 159/349 (45.56%), Query Frame = 1
Query: 6184 GSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNG------------ASGPQGPRGENGD---LGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIG 7185
            G  G+ G  GP G+ G  G PG+ G  G +G+PG  G +G  G+PG +G +GS G           G+PG  G  G  G  G+ GP G  G  G  G PG  G  G  GPAG PG PG     G  GP G RGP                   G QG  G PGN G  G  G++G  GT G  G+KG  G PGIAG  G            A+GP GP+G+ G+    G  G+QGP GE G AG +G  G  G  GK G  G+    G  G  G  G+ G RG  G  G+ GP G+ G +G  G TGP                     +G  GD G PG PG PG  G
Sbjct:  261 GKSGERGLPGPQGARGFPGTPGLPGVKGHRGYPGLDGAKGEAGAPGVKGESGSPGEN---------GSPGPMGPRGLPGERGRTGPAGAAGARGNDGQPGPAGPPGPVGPAGGPGFPGAPGAKGEAGPTGARGP------------------EGAQGSRGEPGNPGSPGPAGASGNPGTDGIPGAKGSAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGQAGEPGIAGFKGDQGPKGETGPAGPQGAPGPAGEEGKRGARGEPGGAGPIGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLTGP---------------------KGANGDPGRPGEPGLPGARG 561          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Mouse
Match: Col1a1 (collagen, type I, alpha 1 [Source:MGI Symbol;Acc:MGI:88467])

HSP 1 Score: 146.747 bits (369), Expect = 2.621e-34
Identity = 85/245 (34.69%), Postives = 122/245 (49.80%), Query Frame = 1
Query: 8515 VRTVR-RDLLNDDALAVKYLGSDVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASDVTEYRS--WFGE-ITGTFKFDYQIEAS-------QLMFLKLFSTNARQRITINCSRLSV-----VGNSEHPVILYSDHDEEVLRNGD-LFKYSVIRDGCKNSAEIIDSTELEMD-TEAIRLPIRDIA-LNTGSSKEQQQFGLDIGQVCF 9192
               VR RDL  D  L       + ++ P G++  PARTC+ L   + + + G Y+IDPN G   DA +V C  +  ++C+    PS   K+W  S   + +   WFGE +T  F F+Y  E S       QL FL+L ST A Q IT +C           GN +  ++L   ++ E+   G+  F YS + DGC +       T +E   T+  RLPI D+A L+ G+    Q+FGLDIG  CF
Sbjct: 1210 ANVVRDRDLEVDTTLKSLSQQIENIRSPEGSRKNPARTCRDLKMCHSDWKSGEYWIDPNQGCNLDAIKVYCNMETGQTCVFPTQPSVPQKNWYISPNPKEKKHVWFGESMTDGFPFEYGSEGSDPADVAIQLTFLRLMSTEASQNITYHCKNSVAYMDQQTGNLKKALLLQGSNEIELRGEGNSRFTYSTLVDGCTSHTGTWGKTVIEYKTTKTSRLPIIDVAPLDIGAP--DQEFGLDIGPACF 1452          

HSP 2 Score: 86.6557 bits (213), Expect = 5.044e-16
Identity = 65/259 (25.10%), Postives = 112/259 (43.24%), Query Frame = -3
Query:  229 DEDEDIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCIEPEVVNYKKTSY------TKTISSWFSVLASLNKQISYKIPKE---------QLVFXXXXXXXXXXXXXXSCDQIALVSDDSITQDIRYNNSVQLFGDDNQILTVNNEDDLFQYKVVEDTCKDKSNN-GRAVIKVEXXXXXXXXXXXLNFKSIENSRPAMI--------------GIEIGPVCF 915
            D D ++   L  LS  ++N+  P GS+  PAR+C D++  + +  +G ++IDPN G   DAI V+CN +  +TC+ P   +  + ++       +    WF    S+     ++   E         QL FL+L S  +SQ +T  C + ++   D  T +++      L    N+I      +  F Y  + D C   +   G+ VI+               +K+ + SR  +I              G++IGP CF
Sbjct: 1215 DRDLEVDTTLKSLSQQIENIRSPEGSRKNPARTCRDLKMCHSDWKSGEYWIDPNQGCNLDAIKVYCNMETGQTCVFPTQPSVPQKNWYISPNPKEKKHVWFG--ESMTDGFPFEYGSEGSDPADVAIQLTFLRLMSTEASQNITYHC-KNSVAYMDQQTGNLK---KALLLQGSNEIELRGEGNSRFTYSTLVDGCTSHTGTWGKTVIE---------------YKTTKTSRLPIIDVAPLDIGAPDQEFGLDIGPACF 1452          

HSP 3 Score: 83.5741 bits (205), Expect = 4.354e-15
Identity = 198/571 (34.68%), Postives = 232/571 (40.63%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGE------------------HGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGS---KGDIGPMGPSGSPGLRGNPGVIGSLG------------------------SQGFPGA------RGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGP------PGNSGQRGLPG---SNGPSGTKGN---------------KGSKGPYGKPG---------------------IAGDNGASGPQGPRGENGDLGNTGEQGPV---------GEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKG 7041
            G PG  GP GP G  G+ G  G+ G KG RG  G DG  G  G  GP+G  G+PG  G  G  GP G  G  G  G  G  G +G  G  G  G PG  GP G  G  G +G KG  G  G  GS+G +G  GE                   G PG  G +G  G+ G PG  G  G SG +GP GP G +G  GE G+   KGD G  G  G+ G++G PG  G  G                        S+GFPGA      +GP G  G+PGP G  GS G  G  G AG+PG  G  G  G                                              PGP G  G  GP G+ G  G  G  G  GQ+G+ G  GP      PG +G+RGLPG   + GP+G  G                +G +GP G PG                     + GD GA GP G RGE G  G  G QGP          G  GN G +G  GAPG PG  G  G   + G +G  G  G  G RG  G  G  G PG  G +G
Sbjct:  228 GRPGERGPPGPQGARGLPGTAGLPGMKGHRGFSGLDGAKGDAGPAGPKGEPGSPGENGAPGQMGPRGLPGERGRPGPPGTAGARGNDGAVGAAGPPGPTGPTGPPGFPGAVGAKGEAGPQGARGSEGPQGVRGEPGPPGPAGAAGPAGNPGADGQPGAKGANGAPGIAGAPGFPGARGPSGPQGPSGPPGPKGNSGEPGAPGNKGDTGAKGEPGATGVQGPPGPAGEEGKRGARGEPGPSGLPGPPGERGGPGSRGFPGADGVAGPKGPSGERGAPGPAGPKGSPGEAGRPGEAGLPGAKGLTGSPGS---------------------------------------------PGPDGKTGPPGPAGQDGRPGPAGPPGARGQAGVMGFPGPKGTAGEPGKAGERGLPGPPGAVGPAGKDGEAGAQGAPGPAGPAGERGEQGPAGSPGFQGLPGPAGPPGEAGKPGEQGVPGDLGAPGPSGARGERGFPGERGVQGPPGPAGPRGNNGAPGNDGAKGDTGAPGAPGSQGAPGLQGMPGERGAAGLPGPKGDRGDAGPKGADGSPGKDGARG 753          

HSP 4 Score: 72.7886 bits (177), Expect = 8.351e-12
Identity = 179/520 (34.42%), Postives = 215/520 (41.35%), Query Frame = 1
Query: 5725 GQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGS------------------------------PGLRGNPGVIGSLGSQGFPGARGP---------------QGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGEN---------------GDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQG------------PPGSIGLKGDIGSTGPMG 7068
            G  G  GK G  G RG  GPQG  G PG   T G PG  G+ G  G+ G  G                        + G  G  G  GS G++G PG  G RG PGE G PG      P G  G  G  G  G +G  GP GP G  G  G +G+KG+ GP G  GS                              PG +G  G  G  G+ GFPGARGP                G  G+PG +G TG+KG  G  G+ G PG  G++GK G                 G  G  G PG  G+ G  G  G PG +   GP+GP GERG P                     GP GP G+ G+ G PG  G  G KG  GS      PG  G +G +GP GP G++               G +G  G +G  GE G AG RG+ G PG  G  G++G+    GA G  GP G  G +GP G  G QG             PG  G+ GD+G+ GP G
Sbjct:  219 GDDGEAGKPGRPGERGPPGPQGARGLPG---TAGLPGMKGHRGFSGLDGAKG------------------------DAGPAGPKGEPGSPGENGAPGQMGPRGLPGERGRPG------PPGTAGARGNDGAVGAAGPPGPTGPTGPPGFPGAVGAKGEAGPQGARGSEGPQGVRGEPGPPGPAGAAGPAGNPGADGQPGAKGANGAPGIAGAPGFPGARGPSGPQGPSGPPGPKGNSGEPGAPGNKGDTGAKGEPGATGVQGPPGPAGEEGKRG---------------ARGEPGPSGLPGPPGERGGPGSRGFPGADGVAGPKGPSGERGAP---------------------GPAGPKGSPGEAGRPGEAGLPGAKGLTGS------PGSPGPDGKTGPPGPAGQDGRPGPAGPPGARGQAGVMGFPGPKGTAGEPGKAGERGLPGPPGAVGPAGKDGEAGAQGAPGPAGPAGERGEQGPAGSPGFQGLPGPAGPPGEAGKPGEQGVPGDLGAPGPSG 663          

HSP 5 Score: 57.7658 bits (138), Expect = 3.167e-7
Identity = 131/317 (41.32%), Postives = 151/317 (47.63%), Query Frame = 1
Query: 6184 GSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGT---IGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGS------------------NGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGR 7071
            G  G+ GP GP G+ GL G  G+ G  G +GF G  G +G  G  GP+G  GS G  G    +G  G+PG  G+ G  G  G  G +G  G  GP GP G  G PG  G  G  G  G  G     GPQG  GE GPPG +G  G  GN G  GQ G +G  G PG +G  G PG+                  +G  G  GNKG  G  G+PG     G  GP GP GE G  G  GE GP G  G  G RG  G+ G PG DG  G     G +G  GP G  G  G  G  G  G PG+ GL G  GS GP G+
Sbjct:  228 GRPGERGPPGPQGARGLPGTAGLPGMKGHRGFSGLDGAKGDAGPAGPKGEPGSPGENGAPGQMGPRGLPGERGRPGPPGTAGARGNDGAVGAAGPPGPTGPTGPPGFPGAVGAKGEAGPQGARGSEGPQGVRGEPGPPGPAGAAGPAGNPGADGQPGAKGANGAPGIAGAPGFPGARGPSGPQGPSGPPGPKGNSGEPGAPGNKGDTGAKGEPGA---TGVQGPPGPAGEEGKRGARGEPGPSGLPGPPGERGGPGSRGFPGADGVAGPKGPSGERGAPGPAGPKGSPGEAGRPGEAGLPGAKGLTGSPGSPGPDGK 541          

HSP 6 Score: 56.225 bits (134), Expect = 8.333e-7
Identity = 209/580 (36.03%), Postives = 247/580 (42.59%), Query Frame = 1
Query: 5653 GINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTV------------------------GSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIG---------------------QDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELG---SKGDIGPMGPSGSPGL------RGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKG------------------SQGTIGIAGVPGTPGKDGKAGQVGIXX---XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNS---GQRGLPGSNG------------PSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGK------------------DGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSI---GLKGDIGSTG 7059
            G++G  G  G  G KG  G  G+ G  G+MG  G+ G RG  GP G  GA G  G V                        G  GP G  G  G QG+ G PG  G  G  GP G PG  G  G KG+ G  GI G+ G                       G PG+ G +G  G  G+PG  G+ GP G  G+ GK G  G  G  G  GP G RG  G  G   + G  GP GPSG  G       +G+PG  G  G  G PGA+G  G  GSPGP G+TG  G                    G +G  G  GT G+ GKAG+ G+PG     GP G+ G  G  G PG  G  G+ G  G  G+PG    PGP GP GE G PG               + G+ G +G PG S   G+RG PG  G             +G  GN G+KG  G PG  G  GA G QG  GE    G  G  GP G+ G+AG +G +G+PG  G                    GE G     G  G  G  G  G  GP G  G  GPPG+    G KG+ G TG
Sbjct:  261 GLDGAKGDAGPAGPKGEPGSPGENGAPGQMGPRGLPGERGRPGPPGTAGARGNDGAVGAAGPPGPTGPTGPPGFPGAVGAKGEAGPQGARGSEGPQGVRGEPGPPGPAGAAGPAGNPGADGQPGAKGANGAPGIAGAPGFPGARGPSGPQGPSGPPGPKGNSGEPGAPGNKGDTGAKGEPGATGVQGPPGPAGEEGKRGARGEPGPSGLPGPPGERGGPGSRGFPGADGVAGPKGPSGERGAPGPAGPKGSPGEAGRPGEAGLPGAKGLTGSPGSPGPDGKTGPPGPAGQDGRPGPAGPPGARGQAGVMGFPGPKGTAGEPGKAGERGLPGPPGAVGPAGKDGEAGAQGAPGPAGPAGERGEQGPAGSPGFQGLPGPAGPPGEAGKPG---------------EQGVPGDLGAPGPSGARGERGFPGERGVQGPPGPAGPRGNNGAPGNDGAKGDTGAPGAPGSQGAPGLQGMPGER---GAAGLPGPKGDRGDAGPKGADGSPGKDGARGLTGPIGPPGPAGAPGDKGEAGPSGPPGPTGARGAPGDRGEAGPPGPAGFAGPPGADGQPGAKGEPGDTG 822          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Mouse
Match: Col5a2 (collagen, type V, alpha 2 [Source:MGI Symbol;Acc:MGI:88458])

HSP 1 Score: 144.821 bits (364), Expect = 1.137e-33
Identity = 79/231 (34.20%), Postives = 121/231 (52.38%), Query Frame = 1
Query: 8554 LAVKYLGSDV--VKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASDVTEYR-SWFG-EITGTFKF---DYQ---IEASQLMFLKLFSTNARQRITINCSRL-----SVVGNSEHPVILYSDHDEEVLRNGDL-FKYSVIRDGCKNSAEIIDSTELEMDTEAI-RLPIRDIA-LNTGSSKEQQQFGLDIGQVCF 9192
            + +K L S +  ++ P G+K  PARTC  L   +P  Q G Y+IDPN G A+DA +V C  +  E+CI +   S   K W AS   + +  W+G ++    +F   DYQ      +Q+ FL+L S  A Q +T  C            N +  V+L   +D E+   G++ F+Y+V++D C      +  T  E  T+ + RLPI D+  ++ G++   Q+FGLDIG VCF
Sbjct: 1268 VTLKSLSSQIETMRSPDGSKKHPARTCDDLKLCHPTKQSGEYWIDPNQGSAEDAIKVYCNMETGETCISANPASVPRKTWWASKSPDNKPVWYGLDMNRGSQFTYGDYQSPNTAITQMTFLRLLSKEASQNLTYICRNTVGYMDDQAKNLKKAVVLKGSNDLEIKGEGNIRFRYTVLQDTCSKRNGNVGKTIFEYRTQNVARLPIIDVGPVDIGNA--DQEFGLDIGPVCF 1496          

HSP 2 Score: 113.235 bits (282), Expect = 4.001e-24
Identity = 81/259 (31.27%), Postives = 127/259 (49.03%), Query Frame = -3
Query:  229 FQNDQPKTEKISSIDPNDEDEDIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCIEPEVVNYKKTSYTKTISS-----WFSVLASLNKQISY------KIPKEQLVFXXXXXXXXXXXXXXSCDQIALVSDDSITQDIRYNNSVQLFGDDNQILTVNNEDDL-FQYKVVEDTCKDKSNN-GRAVIKVEXXXXXXXXXXXLNFKSIENSRPAMIGIEIGPVCF 966
            F  DQ      +  D N  D  I   L  LSS ++ +  P GSK +PAR+C D++  +  K +G ++IDPN G  +DAI V+CN +  ETCI     +  + ++  + S      W+ +  +   Q +Y           Q+ FL+L S+ +SQ LT  C       DD   Q      +V L G ++  L +  E ++ F+Y V++DTC  ++ N G+ + +       RLPI D+    I N+     G++IGPVCF
Sbjct: 1249 FTEDQ-----AAPDDTNKTDPGIHVTLKSLSSQIETMRSPDGSKKHPARTCDDLKLCHPTKQSGEYWIDPNQGSAEDAIKVYCNMETGETCISANPASVPRKTWWASKSPDNKPVWYGLDMNRGSQFTYGDYQSPNTAITQMTFLRLLSKEASQNLTYICRNTVGYMDD---QAKNLKKAVVLKGSND--LEIKGEGNIRFRYTVLQDTCSKRNGNVGKTIFEYRTQNVARLPIIDVGPVDIGNAD-QEFGLDIGPVCF 1496          

HSP 3 Score: 112.079 bits (279), Expect = 1.081e-23
Identity = 195/526 (37.07%), Postives = 241/526 (45.82%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPG---TPGKDGKAGQVG------IXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQ---------------------------------------GPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGI------QGPPGSIGLKGDIGST 7056
            TG  GI G +G  GVPG KG  G KG+ G  G  G    +GP G  G +GP G PG   TVG PGP+G  G PG +G  G                           S G  G KG+ G+ G  GS G +G  G+ G PG+ G+ G  G+ G+PG                            +G  G +GP G+PG  G PG  GS+G +G PG+      +G PGP+G +G  G  G  G AGVPG    PGKDG+ G  G      + G+ G  G PGP G  GLPG PG  G+ G AG  G PG+    GP GP GERG PG+ G+ G+ G  G  G +G  GP GP GN G  G  G  GP G +G  G +G  G PG  GD G  G +                                       GP G  G+ G+ GE GP G VG AG +G +G PG+ G+ GE G+    G+ G  G  GS G  GP G+ G+      QGPPG+ G  G  G  
Sbjct:  456 TGPQGIRGQSGDPGVPGFKGEAGPKGEPGPHGIQGP---IGPPGEEGKRGPRGDPG---TVGPPGPMGERGAPGNRGFPG---------------------------SDGLPGPKGAQGERGPVGSSGPKGGQGDPGRPGEPGLPGARGLTGNPG---------------------------VQGPEGKLGPLGAPGEDGRPGPPGSIGIRGQPGS------MGLPGPKGSSGDLGKPGEAGNAGVPGQRGAPGKDGEVGPSGPVGPPGLAGERGEQGPPGPTGFQGLPGPPGPPGEGGKAGDQGVPGEPGAVGPLGPRGERGNPGERGEPGITGLPGEKGMAGGHGPDGPKGNPGPTGTIGDTGPPGLQGMPGERGIAGTPGPKGDRGGIGEKGAEGTAGNDGARGLPGPLGPPGPAGPTGEKGEPGPRGLVGPPGSRGNPGSRGENGPTGAVGFAGPQGPDGQPGVKGEPGEPGQKGDAGSPGPQGLAGSPGPHGPHGVPGLKGGRGTQGPPGATGFPGSAGRV 915          

HSP 4 Score: 110.538 bits (275), Expect = 3.179e-23
Identity = 195/541 (36.04%), Postives = 235/541 (43.44%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXX---XSQGGLGIKGSIGQDGYPGSDGKRGAP---------------------------GEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVI---------GSLGSQGFPGAR---GPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGP---------------------RGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGP---QGMTGIQGPPGSIGLKGDIGSTGPMG 7068
            G  G+ GP G  G PG KG  G  G  G  G +G  G+ G RG LGPQG  G  G  G  G PGP+G  G PG  G  G PG +GE G  G  G  G +G  GE    G  G  G+ G++G DG PG+ G  G+                            G+ GDPG  G  G +G KG+PG                          G +G IGP G  G  G RG+PG +         G+ G++GFPG+    GP+G  G  GP G +G KG QG  G  G PG PG  G  G  G+                         G  G  G  G PG++ +PGP G +G RG PG  G  G           G  G +G PG +G  G+PG  G  G  G  G  GP G PG+AG+ G  GP GP                     +G  G+ G  G  GP GE GN G RG  G  G+PG+ G  G    DG KGN GP G+ G  GP   QGM G +G  G+ G KGD G  G  G
Sbjct:  301 GHKGLEGPKGEIGAPGAKGEAGPTGPMGAMGPLGPRGMPGERGRLGPQGAPGKRGAHGMPGKPGPMGPLGIPGSSGFPGNPGMKGEAGPTGARGPEGPQGQRGETGPPGPAGSQGLPGAVGTDGTPGAKGPTGSAGTSGPPGLAGPPGSPGPQGSTGPQGIRGQSGDPGVPGFKGEAGPKGEPGPH------------------------GIQGPIGPPGEEGKRGPRGDPGTVGPPGPMGERGAPGNRGFPGSDGLPGPKGAQGERGPVGSSGPKGGQGDPGRPGEPGLPGARGLTGNPGV------------------------QGPEGKLGPLGAPGEDGRPGPPGSIGIRGQPGSMGLPGP---------KGSSGDLGKPGEAGNAGVPGQRGAPGKDGEVGPSGPVGPPGLAGERGEQGPPGPTGFQGLPGPPGPPGEGGKAGDQGVPGEPGAVGPLGPRGERGNPGERGEPGITGLPGEKGMAGGHGPDGPKGNPGPTGTIGDTGPPGLQGMPGERGIAGTPGPKGDRGGIGEKG 784          

HSP 5 Score: 109.383 bits (272), Expect = 6.397e-23
Identity = 170/444 (38.29%), Postives = 204/444 (45.95%), Query Frame = 1
Query: 5749 DGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGS---SGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGR 7071
            DG  G  GN G  G +G+PG RG  G+PG  G  GH G +G+ G                     P+GE G+ G  G  G  G  G  G  G RG PGE G  G  G  G  G  G PGK                            G +GP+G  GS G  GNPG+ G  G  G  G  GPQG  G  GP G  GS+G  G +G  G PG  G  G AG  G PG  GPPG PGP G                             GPQG  G+ G PG  G  G  G  G PG  G+QGPIGPPG  G+RG  G  G  G  G  G +G  G  G  G +G  GP+G +GE G +G++G +G  G+ G        G PG+PG  G  G   V G +G +GP+G+    GR GP G  GI+G PGS+GL G  GS+G +G+
Sbjct:  264 DGEPGRNGNTGEVGFSGSPGARGFPGAPGLPGLKGHRGHKGLEG---------------------PKGEIGAPGAKGEAGPTGPMGAMGPLGPRGMPGERGRLGPQGAPGKRGAHGMPGKP---------------------------GPMGPLGIPGSSGFPGNPGMKGEAGPTGARGPEGPQGQRGETGPPGPAGSQGLPGAVGTDGTPGAKGPTGSAGTSGPPGLAGPPGSPGPQGST---------------------------GPQGIRGQSGDPGVPGFKGEAGPKGEPGPHGIQGPIGPPGEEGKRGPRGDPGTVGPPGPMGERGAPGNRGFPGSDGLPGPKGAQGERGPVGSSGPKGGQGDPGRP------GEPGLPGARGLTGNPGVQGPEGKLGPLGAPGEDGRPGPPGSIGIRGQPGSMGLPGPKGSSGDLGK 626          

HSP 6 Score: 103.605 bits (257), Expect = 3.772e-21
Identity = 223/564 (39.54%), Postives = 257/564 (45.57%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPG---------KNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPG---------------------NSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAG------DNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGP------------IGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            G PG  G  G  G PG  GPLG+ G  G  G  G  G  GP G  GP+GP G   +RG  G PGP G+ G PG  G  G PG +G  G  G  G PGL GP G  G QG  G +G  GQ G PG  G +G  G  G+PG  GI GP G  G+ GK                         G +GD G +GP G  G RG PG  G  GS G PG   P+G  G  GP G +G KG QG  G  G PG PG  G  G  G+ G  G  G  G  G  G PG PG  G  G  G  G PG         K  + G  G  G+RG PGK G+ G  G VGPPG +G +G  GPPG                     + G  G PG+ GP G +G +G+ G  G+PGI G        G  GP GP+G  G  G  G+ GP G  G  G RG+ G PG  G  G  G+   +G  GN G              G +G +G  G  G+ GPPGS G  G  G  GP G        G  G  GP G  G KG+ G PG  G  G  GPQ
Sbjct:  349 GAPGKRGAHGMPGKPGPMGPLGIPGSSGFPGNPGMKGEAGPTGARGPEGPQG---QRGETGPPGPAGSQGLPGAVGTDGTPGAKGPTGSAGTSGPPGLAGPPGSPGPQGSTGPQGIRGQSGDPGVPGFKGEAGPKGEPGPHGIQGPIGPPGEEGKR------------------------GPRGDPGTVGPPGPMGERGAPGNRGFPGSDGLPG---PKGAQGERGPVGSSGPKGGQGDPGRPGEPGLPGARGLTGNPGVQGPEGKLGPLGAPGEDGRPGPPGSIGIRGQPGSMGLPGPKGSSGDLGKPGEAGNAGVPGQRGAPGKDGEVGPSGPVGPPGLAGERGEQGPPGPTGFQGLPGPPGPPGEGGKAGDQGVPGEPGAVGPLGPRGERGNPGERGEPGITGLPGEKGMAGGHGPDGPKGNPGPTGTIGDTGPPGLQGMPGERGIAGTPGPKGDRGGIGEKGAEGTAGNDGARGLPGPLGPPGPAGPTGEKGEPGPRGLVGPPGSRGNPGSRGENGPTG------AVGFAGPQGPDGQPGVKGEPGEPGQKGDAGSPGPQ 876          

HSP 7 Score: 98.2117 bits (243), Expect = 1.534e-19
Identity = 200/531 (37.66%), Postives = 241/531 (45.39%), Query Frame = 1
Query: 5680 GVPGMKGPLGVKGDKGQRGRMGKDGILG------PRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPG------------EHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGER------------GPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGI------------AGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDK 7146
            G PG  GPLG +G++G  G  G+ GI G        G  GP GP G PG  GT+G  GP G  G PG +GI+G                       G KG +GG+G KG+   +G  G+DG RG PG            E G+PG  G+ GP G +G+PG  G  G                    G+ G  GP GP G PG++G PG  G  G  G PG   PQG+ GSPGP G  G  G +G  G  G PG  G  G AG+V               GP G  G PG  G  G  G  G PG    PG  G +G+R            G PG+ G  G  G  GP G +G +G +G PG  G+RG+PG  GP+GT G  G  G  G  G              G+ G  GP G  G  G  G  GE+G  G+ G AG+ G  GAPG PG  G  G     G  G+ GP+G  GR G +G+ G QGP G  G  GD G  G  G  G  G+ G PG  GP G +G  G  
Sbjct:  697 GEPGAVGPLGPRGERGNPGERGEPGITGLPGEKGMAGGHGPDGPKGNPGPTGTIGDTGPPGLQGMPGERGIAG---------------------TPGPKGDRGGIGEKGA---EGTAGNDGARGLPGPLGPPGPAGPTGEKGEPGPRGLVGPPGSRGNPGSRGENGP------------------TGAVGFAGPQGPDGQPGVKGEPGEPGQKGDAGSPG---PQGLAGSPGPHGPHGVPGLKGGRGTQGPPGATGFPGSAGRV---------------GPPGPAGAPGPAGPAGEPGKEGPPGLRGDPGSHGRVGDRGPAGPPGSPGDKGDPGEDGQPGPDGPPGPAGTTGQRGIVGMPGQRGERGMPGLPGPAGTPGKVGPTGATGDKGPPGPVGPPGSNGPVGEPGPEGPAGNDGTPGRDGAVGERGDRGDPGPAGLPGSQGAPGTPGPVGAPGDAGQRGEPGSRGPVGPPGRAGKRGLPGPQGPRGDKGDNGDRGDRGQKGHRGFTGLQGLPGPPGPNGEQGSAGIP 1167          

HSP 8 Score: 88.5817 bits (218), Expect = 1.478e-16
Identity = 207/560 (36.96%), Postives = 239/560 (42.68%), Query Frame = 1
Query: 5653 GINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDG------------ILGPRGNLGPQGPT---------------------GAPGRRGTVGSPGPVGNAGH------PGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGID------------------------GPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGER------------GPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPY------------GKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGR 7071
            G+ GP G +G  G  G  G  G  GQRG  GKDG            + G RG  GP GPT                     G PG  G VG  GP G  G+      PG+ G+ G  G  G  G  GP G PG  G  G+ G  G  G+ G  G  G PG  G RG  GE G  G AG D                        GP G+ G PG  GNPG  G  GP             G+ G  GP GP G PG++G PG  G  G  G P   GPQG+ GSPGP G  G  G +G  G  G PG  G  G AG+V               GP G  G PG  G  G  G  G PG    PG  G +G+R            G PG+ G  G  G  GP G +G +G +G PG  G+RG+PG  GP+GT G  G  G              G  G  G+ G  GP G  G  G  G  GE+G  G+ G AG+ G  GAPG PG  G  G     G  G+ GP+G  GR G +G+ G QGP G  G  GD G  G  G 
Sbjct:  613 GLPGPKGSSGDLGKPGEAGNAGVPGQRGAPGKDGEVGPSGPVGPPGLAGERGEQGPPGPTGFQGLPGPPGPPGEGGKAGDQGVPGEPGAVGPLGPRGERGNPGERGEPGITGLPGEKGMAGGHGPDGPKGNPGPTGTIGDTGPPGLQGMPGERGIAGTPGPKGDRGGIGEKGAEGTAGNDGARGLPGPLGPPGPAGPTGEKGEPGPRGLVGPPGSRGNPGSRGENGP------------TGAVGFAGPQGPDGQPGVKGEPGEPGQKGDAGSP---GPQGLAGSPGPHGPHGVPGLKGGRGTQGPPGATGFPGSAGRV---------------GPPGPAGAPGPAGPAGEPGKEGPPGLRGDPGSHGRVGDRGPAGPPGSPGDKGDPGEDGQPGPDGPPGPAGTTGQRGIVGMPGQRGERGMPGLPGPAGTPGKVGPTGATGDKGPPGPVGPPGSNGPVGEPGPEGPAGNDGTPGRDGAVGERGDRGDPGPAGLPGSQGAPGTPGPVGAPGDAGQRGEPGSRGPVGPPGRAGKRGLPGPQGPRGDKGDNGDRGDRGQKGH 1142          

HSP 9 Score: 87.8113 bits (216), Expect = 2.252e-16
Identity = 218/580 (37.59%), Postives = 255/580 (43.97%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGA---------PGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAG------------IDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSG---SPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGR---TGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGS---------NGPSGTKGNKGSKGPYGKPGIAGDNGASG------------------------PQGPRGENGDLGNTGEQ---------------------------------GPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAK------------GNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMG 7068
            GE G  GP G  G  G  GP+G +G  G RG  G DG+ GP+G  G +GP G+         PGR G  G PG  G  G+PGVQG  G+ G  G PG  G PG PG  G  G+ GS G  G KGS G  G PG  G  G PG+ G PGK G            + G  G +G PG TG  G  G  GP G  G  G  G  G  G +GP+GP G   +PG RG PG+ G  G +G  G  GP G  G+PGP G    TG  G QG  G  G+ GTPG  G  G +G  G  G  G  G  G  G  G PG  G  G  G PG  G    PG +G  G RG  G +G  G  G  GP GQ G++G  G PG  G  G PG          +GP G  G KG +G  G PG  G  G++G                        P G RG+ G  G  G++                                 G  G VG  G RG  G PG+PG  G  GK    GA             G+ GP+G  G  GP G  G  G  G++G +GD G  GP G
Sbjct:  496 GEEGKRGPRGDPGTVGPPGPMGERGAPGNRGFPGSDGLPGPKGAQGERGPVGSSGPKGGQGDPGRPGEPGLPGARGLTGNPGVQGPEGKLGPLGAPGEDGRPGPPGSIGIRGQPGSMGLPGPKGSSGDLGKPGEAGNAGVPGQRGAPGKDGEVGPSGPVGPPGLAGERGEQGPPGPTGFQGLPGPPGPPGEGGKAGDQGVPGEPGAVGPLGPRGERGNPGERGEPGITGLPGEKGMAGGHGPDGPKGNPGPTGTIGDTGPPGLQGMPGERGIAGTPGPKGDRGGIGEKGAEGTAGNDGARGLPGPLGPPGPAGPTGEKGEPGPRGLVGPPGSRGNPGSRGENGPTGAVGFAGPQGPDGQPGVKGEPGEPGQKGDAGSPGPQGLAGSPGPHGPHGVPGLKGGRGTQGPPGATGFPGSAGRVGPPGPAGAPGPAGPAGEPGKEGPPGLRGDPGSHGRVGDRGPAGPPGSPGDKGDPGEDGQPGPDGPPGPAGTTGQRGIVGMPGQRGERGMPGLPGPAGTPGKVGPTGATGDKGPPGPVGPPGSNGPVGEPGPEGPAGNDGTPGRDGAVGERGDRGDPGPAG 1075          

HSP 10 Score: 83.9593 bits (206), Expect = 3.415e-15
Identity = 137/360 (38.06%), Postives = 168/360 (46.67%), Query Frame = 1
Query: 6178 ELGSKGDIGPMGPSGSPGLRG---NPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGP------PGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGA------------SGPQGPRGENGD---LGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIG 7185
            E G  G+ G +G SGSPG RG    PG+ G  G +G  G  GP+G +G+PG +G  G  G  G +G  G  G PG+ G+ G  G PGK G  G                            PGK   PGP GPLG  G       PG  G+ G  G  GP G  G +G  GPPG +G +GLPG+    GT G  G+KGP G  G +G  G             +GPQG RG++GD    G  GE GP GE G  GI+G  G PG  GK G  G     G  G +G  G+ G RG  G  G+ GP G+ G +G +GS+GP                     +G +GD G PG PG PG  G
Sbjct:  266 EPGRNGNTGEVGFSGSPGARGFPGAPGLPGLKGHRGHKGLEGPKGEIGAPGAKGEAGPTGPMGAMGPLGPRGMPGERGRLGPQGAPGKRGAHG---------------------------MPGK---PGPMGPLGIPGSSGFPGNPGMKGEAGPTGARGPEGPQGQRGETGPPGPAGSQGLPGA---VGTDGTPGAKGPTGSAGTSGPPGLAGPPGSPGPQGSTGPQGIRGQSGDPGVPGFKGEAGPKGEPGPHGIQGPIGPPGEEGKRGPRGDPGTVGPPGPMGERGAPGNRGFPGSDGLPGPKGAQGERGPVGSSGP---------------------KGGQGDPGRPGEPGLPGARG 571          

HSP 11 Score: 79.337 bits (194), Expect = 8.506e-14
Identity = 125/367 (34.06%), Postives = 148/367 (40.33%), Query Frame = 1
Query: 6220 GSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGE------------------------------------------VGNAGIRGVNGAPGIPGKDGE---NGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIG 7185
            G PG  GN G +G  GS   PGARG  G  G PG +G  G KG +G  G  G PG  G+ G  G +G                                               GPLG RG PG               + G  GP G PG  G  G+PG  GP G  G  GS G  G PG+ G+ G +G +GP G  G  G TG  GP G                                            G  GIRG +G PG+PG  GE    G+    G +G IGP G  G+RGP+G  G  GPPG +G +G  G+ G  G  G+PG  G  G  GP G  G KG +G PG PG PG+ G
Sbjct:  265 GEPGRNGNTGEVGFSGS---PGARGFPGAPGLPGLKGHRGHKGLEGPKGEIGAPGAKGEAGPTGPMGA---------------------------------------------MGPLGPRGMPG---------------ERGRLGPQGAPGKRGAHGMPGKPGPMGPLGIPGSSGFPGNPGMKGEAGPTGARGPEGPQGQRGETGPPGPAGSQGLPGAVGTDGTPGAKGPTGSAGTSGPPGLAGPPGSPGPQGSTGPQGIRGQSGDPGVPGFKGEAGPKGEPGPHGIQGPIGPPGEEGKRGPRGDPGTVGPPGPMGERGAPGNRGFPGSDGLPGPKGAQGERGPVGSSGPKGGQGDPGRPGEPGLPG 568          

HSP 12 Score: 72.7886 bits (177), Expect = 9.793e-12
Identity = 178/465 (38.28%), Postives = 216/465 (46.45%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGV---PGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTG---------APGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGA------------------------RGPQGILGSPGPRGRTGSK---------------------------------GSQGTIGI------AGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNM---------QPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGAS 6786
            GEPG  GP GP G    PG +G  G+ G  G++G  G  G  GP+GN GP G  G          PG RG  G+PGP G+ G  G +G  G  GN G  G+ GP G PG  GP GEKG  G  G+ G  G  G PGS G+ G  G  G  G  G DG  GVKG+PG+ G  G +G  GP+            G  G  GP GP G PGL+G  G  G  G+ GFPG+                         GP G+ G PG  GR G +                                 G +G +G+       G+PG PG  G  G+VG  G  G  G PGPVGP G  G  G+ G  GPAG  GTPG++           PGP G  G +G PG  G  G PG+ G  G+ G +GP+GPPG +G+RGLPG  GP   +G+KG  G  G  G  G  G +
Sbjct:  697 GEPGAVGPLGPRGERGNPGERGEPGITGLPGEKGMAGGHGPDGPKGNPGPTGTIGDTGPPGLQGMPGERGIAGTPGPKGDRGGIGEKGAEGTAGNDGARGLPGPLGPPGPAGPTGEKGEPGPRGLVGPPGSRGNPGSRGENGPTGAVGFAGPQGPDGQPGVKGEPGEPGQKGDAGSPGPQ------------GLAGSPGPHGPHGVPGLKGGRGTQGPPGATGFPGSAGRVGPPGPAGAPGPAGPAGEPGKEGPPGLRGDPGSHGRVGDRGPAGPPGSPGDKGDPGEDGQPGPDGPPGPAGTTGQRGIVGMPGQRGERGMPGLPGPAGTPGKVGPTGATGDKGPPGPVGPPGSNGPVGEPGPEGPAGNDGTPGRDGAVGERGDRGDPGPAGLPGSQGAPGTPGPVGAPGDAGQRGEPGSRGPVGPPGRAGKRGLPGPQGP---RGDKGDNGDRGDRGQKGHRGFT 1146          

HSP 13 Score: 70.4774 bits (171), Expect = 4.529e-11
Identity = 162/484 (33.47%), Postives = 191/484 (39.46%), Query Frame = 1
Query: 5671 GPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGT------------------VGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGA------------------------RGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKD------------GKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIG 6960
            GPTG  G  GP G++G  G+RG  G  G  G RG +G +G  G  G  G                    G PGP G  G PG +G  G                       GE G  G +G  G  G DG PG  G+ G PG+ GD   AG  GP G+ G P                                 GP GP G PGL+G  G  G  G+ GFPG+                         GP G+ G PG  GR G +G  G  G  G  G PG+D            G  GQ GI G  G  G                             G    PGP G  G+ GP G +GD G PG VGPPG +G  G  GP G +G  G PG +G  G +G++G  GP G PG  G  G  GP G  G+ G  G  G +GPVG  G AG RG+ G  G  G  G+NG     G KG+ G
Sbjct:  745 GPTGTIGDTGPPGLQGMPGERGIAGTPGPKGDRGGIGEKGAEGTAGNDGARGLPGPLGPPGPAGPTGEKGEPGPRGLVGPPGSRGNPG---------------------SRGENGPTGAVGFAGPQGPDGQPGVKGEPGEPGQKGD---AGSPGPQGLAGSP---------------------------------GPHGPHGVPGLKGGRGTQGPPGATGFPGSAGRVGPPGPAGAPGPAGPAGEPGKEGPPGLRGDPGSHGRVGDRGPAGPPGSPGDKGDPGEDGQPGPDGPPGPAGTTGQRGIVGMPGQRGER---------------------------GMPGLPGPAGTPGKVGPTGATGDKGPPGPVGPPGSNGPVGEPGPEGPAGNDGTPGRDGAVGERGDRGDPGPAGLPGSQGAPGTPGPVGAPGDAGQRGEPGSRGPVGPPGRAGKRGLPGPQGPRGDKGDNGDRGDRGQKGHRG 1144          

HSP 14 Score: 59.3066 bits (142), Expect = 1.211e-7
Identity = 85/176 (48.30%), Postives = 98/176 (55.68%), Query Frame = -3
Query: 3067 GSKGNVGPLGPKGEPGFQGNRGGRGSPGATGASGKRGSIGPQGENGFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDTGLQGSQGMPGLEGAKGKRGERGSIGMPGELGKRGVRGSPGIDGSIGYAGGRGLSGMRXXXXXXXXXXXXGLQGDSGPPGAIGNKGSQGD 3594
            G KG  GP G +G  G QG RG  G PG  G+ G  G++G  G  G KG  G+ G  G PG  G  G PG +G  G  G  G  GD G+ G +G  G +G  G  G +G IG PGE GKRG RG PG  G  G  G RG  G RG PG +G PGP G QG+ GP G+ G KG QGD
Sbjct:  382 GMKGEAGPTGARGPEGPQGQRGETGPPGPAGSQGLPGAVGTDGTPGAKGPTGSAGTSGPPGLAGPPGSPGPQGSTGPQGIRGQSGDPGVPGFKGEAGPKGEPGPHGIQGPIGPPGEEGKRGPRGDPGTVGPPGPMGERGAPGNRGFPGSDGLPGPKGAQGERGPVGSSGPKGGQGD 557          

HSP 15 Score: 54.6842 bits (130), Expect = 2.697e-6
Identity = 74/176 (42.05%), Postives = 88/176 (50.00%), Query Frame = 1
Query: 6568 LGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGA---------KGNIGPIGSSGRRGPQGMTGIQGPP---GSIGLKGDIGSTG 7059
            +G RGP G  G  G  G  G  G +G  G  G PG  G  G PG  G  G +G+KG +GP G+ G  G  G +GP GP G  G LG  G  G  G +G  G  G  GA G+PGK G  G   + G+         KG  GP G+ G  GPQG  G  GPP   GS GL G +G+ G
Sbjct:  249 IGSRGPEGPPGKPGEDGEPGRNGNTGEVGFSGSPGARGFPGAPGLPGLKGHRGHKGLEGPKGEIGAPGAKGEAGPTGPMGAMGPLGPRGMPGERGRLGPQGAPGKRGAHGMPGKPGPMGPLGIPGSSGFPGNPGMKGEAGPTGARGPEGPQGQRGETGPPGPAGSQGLPGAVGTDG 424          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Mouse
Match: Col1a2 (collagen, type I, alpha 2 [Source:MGI Symbol;Acc:MGI:88468])

HSP 1 Score: 144.05 bits (362), Expect = 1.973e-33
Identity = 74/237 (31.22%), Postives = 115/237 (48.52%), Query Frame = 1
Query: 8530 RDLLNDDALAVKYLGSDVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASDVTEYRSWFGE-ITGTFKFDYQIE-------ASQLMFLKLFSTNARQRITINCSRLSV-----VGNSEHPVILYSDHDEEVLRNGD-LFKYSVIRDGCKNSAEIIDSTELEMDT-EAIRLPIRDIA-LNTGSSKEQQQFGLDIGQVCF 9192
            +D   D  L       + +  P G++  PARTC+ L  ++P     +Y+IDPN G   DA +V C     E+CI+++  +   K+  +        W GE I G  +F+Y +E       A+QL F++L +  A Q IT +C           G+    V+L   +D E++  G+  F YSV+ DGC         T +E  T +  RLP  DIA L+ G +   Q+F +++G VCF
Sbjct: 1137 KDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWNSDYYWIDPNQGCTMDAIKVYCDFSTGETCIQAQPVNTPAKNSYSRAQANKHVWLGETINGGSQFEYNVEGVSSKEMATQLAFMRLLANRASQNITYHCKNSIAYLDEETGSLNKAVLLQGSNDVELVAEGNSRFTYSVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGA--DQEFRVEVGPVCF 1371          

HSP 2 Score: 115.546 bits (288), Expect = 9.171e-25
Identity = 79/275 (28.73%), Postives = 133/275 (48.36%), Query Frame = -3
Query:  229 DLFQNDQPKTEKISSIDPNDEDEDIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCIEPEVVNY-KKTSYTKTISS---WFSVLASLNKQISYKIP-------KEQLVFXXXXXXXXXXXXXXSC-DQIALVSDDSITQDIRYNNSVQLFGDDNQILTVNNEDDLFQYKVVEDTCKDKSNN-GRAVIKVEXXXXXXXXXXXLNFKSIENSR-------PAMIG-------IEIGPVCF 972
            D ++ DQP+++   S+ P D + D    L  L++ ++ L  P GS+  PAR+C D++  +   ++  ++IDPN G   DAI V+C+F   ETCI+ + VN   K SY++  ++   W     +   Q  Y +          QL F++L +  +SQ +T  C + IA + +++ +     N +V L G  N +  V   +  F Y V+ D C  K+N  G+ +I+               +K+ + SR       P  IG       +E+GPVCF
Sbjct: 1121 DFYRADQPRSQP--SLRPKDYEVDA--TLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWNSDYYWIDPNQGCTMDAIKVYCDFSTGETCIQAQPVNTPAKNSYSRAQANKHVWLGETINGGSQFEYNVEGVSSKEMATQLAFMRLLANRASQNITYHCKNSIAYLDEETGS----LNKAVLLQG-SNDVELVAEGNSRFTYSVLVDGCSKKTNEWGKTIIE---------------YKTNKPSRLPFLDIAPLDIGGADQEFRVEVGPVCF 1371          

HSP 3 Score: 102.834 bits (255), Expect = 5.757e-21
Identity = 193/568 (33.98%), Postives = 239/568 (42.08%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSG---------------------SPGLRGNPGVIGSLGSQGFPGARGPQGI---------------LGSPGP---RGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGE---NGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQ---------GPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            TG  G             +GP G  G  G+ G  GK G  G RG +GPQG  G P   GT G PG  G  GH G+ G+ G+                         G+QG  G  G+ G++G PG  G RG PGE G  G  G  G  G  G  G  G  G  G  GP G  G  G  GELG  G+ GP GP+G                     + GL G  G  G  G  G PG  GP+GI               +G PGP   +G +G+KG  G++G  G PG  G++GK G                                       +PG+    GP GP G RG PG        G  G  G++G+ GP G  G++G  G+ G NG +G  G  G  GP G PG  G+ G SG +GP G    +G  G  G  GP GE GN G  G  G  G PGK GE G   + GA+G  GP G++G +GP G  G+Q         GPPG  GL G  G+TG +G+                      G++GLPG  G PG  GP+
Sbjct:  132 TGPAGP------------RGPAGSPGKAGEDGHPGKPGRPGERGVVGPQGARGFP---GTPGLPGFKGVKGHSGMDGLKGQ------------------------PGAQGVKGEPGAPGENGTPGQAGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEVGLPGLSGPVGPPGNPGTNGLTGAKGATGLPGVAGAPGLPGPRGIPGPAGAAGATGARGLVGEPGPAGSKGESGNKGEPGSVGAQGPPGPSGEEGKRG---------------------------------------SPGEAGSAGPAGPPGLRGSPGSR------GLPGADGRAGVMGPPGNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPSGKEGPVGLPGIDGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGERGHPGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPSGTTGEVGK---------------------PGERGLPGEFGLPGPAGPR 594          

HSP 4 Score: 101.679 bits (252), Expect = 1.570e-20
Identity = 193/504 (38.29%), Postives = 230/504 (45.63%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGS---PGPVGNA------------------GHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEH------------GDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGST 7056
            G  G++G  G  G  G+KG  G  G+ G  G+ G  G+ G RG +G  GP GA G  G+VG     GP+G+A                  G+PG  G +G  G  G PG+ GP G PG  G  G  G++G  G+ G  G  G P   G RG PG              G+PG AG  G SG KG+PG           G +GP G  G  G+ GS G+ G  GP+G PGLRG+P      GS+G PGA G  G++G PG RG TG  G +G  G AG PG PG  G  G  G                      PG  G  G  G  G PG + +PGP GP G RG  G  G              G +GP G PG  G+RG PG  G  G  G  G+ G  G PG  G  G  G QGP G  G  G  G  G  GEVG  G RG+ G  G+PG  G  G+    G  G  GP G  G RGP G       PG  G KG+ G+ 
Sbjct:  187 GHSGMDGLKGQPGAQGVKGEPGAPGENGTPGQAGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEVGLPGLSGPVGPPGNPGTNGLTGAKGATGLPGVAGAPGLP---GPRGIPGPAGAAGATGARGLVGEPGPAGSKGESGNKGEPGSV---------GAQGPPGPSGEEGKRGSPGEAGSAGPAGPPGLRGSP------GSRGLPGADGRAGVMGPPGNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPG---------------------SPGNVGPSGKEGPVGLPGIDGRPGPIGPAGPRGEAGNIGF------------PGPKGPSGDPGKPGERGHPGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPSGTTGEVGKPGERGLPGEFGLPGPAGPRGERGTPGESGAAGPSGPIGSRGPSGA------PGPDGNKGEAGAV 633          

HSP 5 Score: 90.1225 bits (222), Expect = 4.256e-17
Identity = 200/585 (34.19%), Postives = 234/585 (40.00%), Query Frame = 1
Query: 5689 GMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPG------KTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQ------------RGLPGSNGPSGT------------KGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPG------------IPGKDGENGKDAVDGAKGNIGPIGSSGRR------------------GPQGMTGIQGPPGSI---------------------GLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGT---PGVIGPQ 7191
            G  GP G KG+ G +G  G  G  GP G  G +G  G+PG  G+ G  GP G  G PG +G+ G                           + G  G+ G  G  G  G  G RG  G+ G PG+ G+ GP G+ G PG      K G  G  G  G  GP G  G  GE G+ G  GP GPSG PG  G  G  G  G++G PG  G  G  G PGP+G  G KG QG  G  G  G PG  G  G+VG                                G  G PG+   PGP GP GERG PG+SG  G  G +G  G SG  GP G  G +G              GLPG  G +G             +G+ G+ G  G  GI G  GA GP G  G+ G+ G  G  GP G  G+ G RG  G  G             PG  GE G     G  G +GP GS G                    GP GMTG  G  G                       G++G  G  GP+GR G  G  G           GF G+KG  G PGT   PG  GPQ
Sbjct:  352 GEPGPAGSKGESGNKGEPGSVGAQGPPGPSGEEGKRGSPGEAGSAGPAGPPGLRGSPGSRGLPG---------------------------ADGRAGVMGPPGNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPSGKEGPVGLPGIDGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGERGHPGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPSGTTGEVG------------------------------KPGERGLPGEFGLPGPAGPRGERGTPGESGAAGPSGPIGSRGPSGAPGPDGNKGEAGAVGAPGSAGASGPGGLPGERGAAGIPGGKGEKGETGLRGDTGNTGRDGARGIPGAVGAPGPAGASGDRGEAGAAGPSGPAGPRGSPGERGEVGPAGPNGFAGPAGAAGQPGAKGEKGTKGPKGENGIVGPTGSVGAAGPSGPNGPPGPVGSRGDGGPPGMTGFPGAAGRTGPPGPSGIAGPPGPPGAAGKEGIRGPRGDQGPVGRTGETGASGP---------PGFVGEKGPSGEPGTAGAPGTAGPQ 870          

HSP 6 Score: 85.8853 bits (211), Expect = 9.451e-16
Identity = 188/527 (35.67%), Postives = 213/527 (40.42%), Query Frame = 1
Query: 5641 TGEPGINGPTGP---TGVPGM------------KGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVG------NAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGA---PGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNA------------GIRGVNGAPGIP---------------GKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMG 7068
             G PG  GP GP    G+PG+             G  G KG  G  G  G  G+ GPRG  GP G  GA G RG VG PGP G      N G PG  G  G       PG  G  G  G  G  G  G  G  G++GS G  G PG+DG+ G    PG  G  G AGI GP+G  G P                              G+ G MGP G PG  GN G  G  G  G PG  G  G +G  GPRG  G+ G  G  G +G PG PG+ G  G  G  G                                        PGP G  G +GPPG  G  G  G  GP G  G QG  GP G +G+ G PG  G  G  G  G  GP G+ G  G++GA+GP GP G  G  G  G  G  GE G              G+ G  GA GIP               G  G +G   + GA G  GP G+SG RG  G  G  GP G  G  G+ G  GP G
Sbjct:  276 VGNPGPAGPAGPRGEVGLPGLSGPVGPPGNPGTNGLTGAKGATGLPGVAGAPGLPGPRGIPGPAGAAGATGARGLVGEPGPAGSKGESGNKGEPGSVGAQG------PPGPSGEEGKRGSPGEAGSAGPAGPPGLRGSPGSRGLPGADGRAGVMGPPGNRGSTGPAGIRGPNGDAGRP------------------------------GEPGLMGPRGLPGSPGNVGPSGKEGPVGLPGIDGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGERGHPGLAGARG---------------------------------------APGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPSGTTGEVGKPGERGLPGEFGLPGPAGPRGERGTPGESGAAGPSGPIGSRGPSGAPGPDGNKGEAGAVGAPGSAGASGPGGLPGERGAAGIPGGKGEKGETGLRGDTGNTGRDGARGIPGAVGAPGPAGASGDRGEAGAAGPSGPAGPRGSPGERGEVGPAG 727          

HSP 7 Score: 85.1149 bits (209), Expect = 1.748e-15
Identity = 174/489 (35.58%), Postives = 207/489 (42.33%), Query Frame = 1
Query: 5656 INGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDP------GKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQ------------RGLPGSNGPSGT------------KGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIG 7032
            + G  GP          G KG+ G +G  G  G  GP G  G +G  G+PG  G+ G  GP G  G PG +G+ G                           + G  G+ G  G  G  G  G RG  G+ G PG+ G+ GP G+ G P      GK G  G  G  G  GP G  G  GE G+ G  GP GPSG PG  G  G  G  G++G PG  G  G  G PGP+G  G KG QG  G  G  G PG  G  G+VG                                G  G PG+   PGP GP GERG PG+SG  G  G +G  G SG  GP G  G +G              GLPG  G +G             +G+ G+ G  G  GI G  GA GP G  G+ G+ G  G  GP G  G+ G RG        G  G NG     GA G  G  G  G +GP+G  GI GP GS+G
Sbjct:  350 LVGEPGPA---------GSKGESGNKGEPGSVGAQGPPGPSGEEGKRGSPGEAGSAGPAGPPGLRGSPGSRGLPG---------------------------ADGRAGVMGPPGNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPSGKEGPVGLPGIDGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGERGHPGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPSGTTGEVG------------------------------KPGERGLPGEFGLPGPAGPRGERGTPGESGAAGPSGPIGSRGPSGAPGPDGNKGEAGAVGAPGSAGASGPGGLPGERGAAGIPGGKGEKGETGLRGDTGNTGRDGARGIPGAVGAPGPAGASGDRGEAGAAGPSGPAGPRGSPGERGEV------GPAGPNGFAGPAGAAGQPGAKGEKGTKGPKGENGIVGPTGSVG 766          

HSP 8 Score: 80.8777 bits (198), Expect = 2.963e-14
Identity = 188/509 (36.94%), Postives = 216/509 (42.44%), Query Frame = 1
Query: 5686 PGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNG------PSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGP---VGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIG 7185
            PG  G +G +G  G  G  G  G  GP G  G  G TG  G RG  GSPG  G  GHPG  G  G                            +G +G +G+ G  G PG  G +G  G  G  G  G  G  GVKG+PG  G                     E G+ G  G  G  G  G  G PG  G+ GS G  G  GP G +GS GP G  G+ G +G +G  G PG  G  G  G+VG+PG +GP G PG  G  GL G                 G    PG  G  G  GP G  G  G  G  G  G  G  GP G  G SG +G PGS G      PSG +G +GS G  G  G AG  G  G  G RG  G  G  G  GP    G  G AGIRG NG  G PG+ G  G   + G+ GN+GP   SG+ GP G+ GI G PG IG  G  G  G +                     GF G KG  G+PG PG  G
Sbjct:   96 PGPMGLMGPRGPPGAVGAPGPQGFQGPAGEPGEPGQTGPAGPRGPAGSPGKAGEDGHPGKPGRPGE---------------------------RGVVGPQGARGFPGTPGLPGFKGVKGHSGMDGLKGQPGAQGVKGEPGAPG---------------------ENGTPGQAGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEVGLPGLSGPVGPPGNPGTNGLTGAK---------------GATGLPGVAGAPGLPGPRGIPGPAGAAGATGARGLVGEPGPAGSKGESGNKGEPGSVGAQGPPGPSGEEGKRGSPGEAGSAGPAGPPGLRGSPGSRGLPGADGRAGVMGPPGNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGSPGNVGP---SGKEGPVGLPGIDGRPGPIGPAGPRGEAGNI---------------------GFPGPKGPSGDPGKPGERG 517          

HSP 9 Score: 79.7221 bits (195), Expect = 7.357e-14
Identity = 195/549 (35.52%), Postives = 240/549 (43.72%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGH---------PGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGP------MGPSGS------------------------PGLRGNPGVIGS---------------------------------LGSQGFPGARGPQGILGSPGPRGRTGSKGS------QGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGS 7053
             G+PG  G  G  G+PG  GP      +G+RG  G+ G  GP G +G +GP+GAPG  G  G  G VG  G          PG +G +G             PG  G +G  G +G  G  G  G+ G  G  G+ G  GA G+ G+ G AG  GP+G +G PG+ G  G +G  G  GP G  G  G  G KG  GP      +GP+GS                        PG+ G PG  G                                  +G  G  GA GP G +G  GP G  G+ G+      QG +G  G+ G PG  G+ G  GI G  G PG  G  GP G  G PG  G PG  G PG  G++  PG  GP G  G PG              G+ G  G IGP G +G  G  GS GP+G  GN+G  GP G  G  G  G  GP GP+G  GD G  G++G  G  G  G  G+ G PG+ G  G+ G     G  G  GP G SG  G  G +G  GP G  G++G  GS
Sbjct:  573 VGKPGERGLPGEFGLPGPAGP------RGERGTPGESGAAGPSGPIGSRGPSGAPGPDGNKGEAGAVGAPGSAGASGPGGLPGERGAAG------------IPGGKGEKGETGLRGDTGNTGRDGARGIPGAVGAPGPAGASGDRGEAGAAGPSGPAGPRGSPGERGEVGPAGPNGFAGPAGAAGQPGAKGEKGTKGPKGENGIVGPTGSVGAAGPSGPNGPPGPVGSRGDGGPPGMTGFPGAAGRTGPPGPSGIAGPPGPPGAAGKEGIRGPRGDQGPVGRTGETGASGPPGFVGEKGPSGEPGTAGAPGTAGPQGLLGAPGILGLPGSRGERGLPGIAGALGEPGPLGISGPPGARGPPGAVGSPGVNGAPGEAGRDGNPGSDGPPGRDGQPGHK------------GERGYPGSIGPTGAAGAPGPHGSVGPAGKHGNRGEPGPAGSVGPVGAVGPRGPSGPQGIRGDKGEPGDKGHRGLPGLKGYSGLQGLPGLAGLHGDQGAPGPVGPAGPRGPAGPSGPVGKDGRSGQPGPVGPAGVRGSQGS 1091          

HSP 10 Score: 76.6406 bits (187), Expect = 5.460e-13
Identity = 200/517 (38.68%), Postives = 236/517 (45.65%), Query Frame = 1
Query: 5695 KGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGN-AGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGP---PGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNG---------------PSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGP 7188
            KGP G +G +GQRG  G  G  G  G +GP GP G+PG  G+   PG  GN A     +G+S                           G  G +G +G  G  G PG  G +G  GE G+PG+ G  GP G  G PGK                G  G  G+ G  G+ G +GP G+ G  G PG+ G  G +G  G  G +G  G+ G +G  G+ G  GT G AG  G PG+ G+ G  G  G  G  G  GPVGP G  G  G  G PG  G  G  G    PGP GP G RG    PG SG  G PGN G  G +G +G  G PG +G  GLPG  G                 G  G  GSKG  G  G  G  GA GP GP GE G  G+ GE G  G  G  G+RG  G+ G+PG DG  G   V G  GN G  G +G RGP G  G  G PG +G +G  GS G +G                  P G +G  GLPG  G PG IGP
Sbjct:   32 KGPTGDRGPRGQRGPAGPRGRDGVDGPMGPPGPPGSPGPPGSPAPPGLTGNFAAQYSDKGVS------------------------SGPGPMGLMGPRGPPGAVGAPGPQGFQGPAGEPGEPGQTGPAGPRGPAGSPGKA---------------GEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGVKGHSGMDGLKGQPGAQGVKGEPGAPGENGTPGQAGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEVGLPGLSGPVGPPGNPGTNGLTGAKGATGLPGVAGAPGLPGPRGIPGPAGAAGATGARGLVGEPGPAGSKGESGNKGEPGSVGAQGPPGPSGEEGKRGSPGEAGSAGPAGPPGLRGSPGSRGLPGADGRAG---VMGPPGNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGSPGNVG------------------PSGKEGPVGLPGIDGRPGPIGP 488          

HSP 11 Score: 71.2478 bits (173), Expect = 2.354e-11
Identity = 195/493 (39.55%), Postives = 233/493 (47.26%), Query Frame = 1
Query: 5710 VKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLG------SQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGT 7170
            ++GD G  GR G  GI G  G  GP G +G  G  G  G  GP G  G PG +G  G  G  G  G  G  G PG +G +G KG +G  GI G  G  G  G  G  G PG  G  G  G  G +G  G  G+TG PG SG  GP GP G  G  G  G +GD GP+G +G  G  G PG +G  G      + G PG  GPQG+LG+PG  G  GS+G +G  GIAG  G PG       +GI G  G  G PG VG  G+ G PG+ G+ G  G  G PG++ QPG +G   ERG PG                      IGP G +G  G  GS GP+G  GN+G  GP G  G  G  G  GP GP+G  GD G  G++G  G  G  G  G+ G PG+ G  G+ G     G  G  GP G SG  G  G +G  GP G  G++G  GS                        +G  G  G PG PG 
Sbjct:  668 LRGDTGNTGRDGARGIPGAVGAPGPAGASGDRGEAGAAGPSGPAGPRGSPGERGEVGPAGPNGFAGPAGAAGQPGAKGEKGTKGPKGENGIVGPTGSVGAAGPSGPNGPPGPVGSRGDGGPPGMTGFPGAAGRTGPPGPSGIAGPPGPPGAAGKEGIRGPRGDQGPVGRTGETGASGPPGFVGEKGPSGEPGTAGAPGTAGPQGLLGAPGILGLPGSRGERGLPGIAGALGEPGP------LGISGPPGARGPPGAVGSPGVNGAPGEAGRDGNPGSDGPPGRDGQPGHKG---ERGYPGS---------------------IGPTGAAGAPGPHGSVGPAGKHGNRGEPGPAGSVGPVGAVGPRGPSGPQGIRGDKGEPGDKGHRGLPGLKGYSGLQGLPGLAGLHGDQGAPGPVGPAGPRGPAGPSGPVGKDGRSGQPGPVGPAGVRGSQGS------------------------QGPAGPPGPPGPPGP 1106          

HSP 12 Score: 54.299 bits (129), Expect = 3.686e-6
Identity = 83/213 (38.97%), Postives = 96/213 (45.07%), Query Frame = 1
Query: 6661 GPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQG---------PVGEVGNAGIR---------------GVNGAPGI------------PGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            GP G+ G  G  G  G SG  G  G KGP G+PG AG  G +GPQG  G  G LG  G +G          +GE G  GI                GVNGAPG             PG+DG+ G     G  G+IGP G++G  GP G  G  G  G+ G  G  GS GP+G     G  G  G  G  G +G  GDKG  G PG  G  G Q
Sbjct:  826 GPRGDQGPVGRTGETGASGPPGFVGEKGPSGEPGTAGAPGTAGPQGLLGAPGILGLPGSRGERGLPGIAGALGEPGPLGISGPPGARGPPGAVGSPGVNGAPGEAGRDGNPGSDGPPGRDGQPGHKGERGYPGSIGPTGAAGAPGPHGSVGPAGKHGNRGEPGPAGSVGPVG---AVGPRGPSGPQGIRGDKGEPGDKGHRGLPGLKGYSGLQ 1035          
BLAST of Collagen alpha-1(XXVII) chain B vs. UniProt/SwissProt
Match: sp|O42350|CO1A2_LITCT (Collagen alpha-2(I) chain OS=Lithobates catesbeianus OX=8400 GN=COL1A2 PE=2 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 6.019e-38
Identity = 85/239 (35.56%), Postives = 117/239 (48.95%), Query Frame = 1
Query: 8530 RDLLNDDALAVKYLGSDVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHW--DASDVTEYRSWFGEI-TGTFKFDYQIE-------ASQLMFLKLFSTNARQRITINCSRL-----SVVGNSEHPVILYSDHDEEVLRNGDL-FKYSVIRDGCKNSAEIIDSTELEMDT-EAIRLPIRDIA-LNTGSSKEQQQFGLDIGQVCF 9192
            +D   D  L       +V+  P G++  PARTC+ L  ++P    GFY+IDPN G   DA RV C     E+CI +       K+W  + S+  +   WFGEI  G  +F+Y  E       A+QL F++L +  A Q IT +C           GN +  VIL   +D E+   G+  F YSV+ DGC         T +E  T +  RLPI DIA L+ G     Q+ G +IG VCF
Sbjct: 1118 KDYEVDATLKSLNQQIEVILTPEGSRKNPARTCRDLRLSHPEWTSGFYWIDPNQGCTSDAIRVFCDFSSGETCIHANPDEITQKNWYINTSNKDKKHLWFGEILNGGTQFEYHDEGLTAKDMATQLAFMRLLANQASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELRAEGNTRFTYSVLEDGCTKHTGEWGKTVIEYRTNKPSRLPILDIAPLDIGG--HDQEIGFEIGPVCF 1354          

HSP 2 Score: 100.908 bits (250), Expect = 1.650e-19
Identity = 219/538 (40.71%), Postives = 264/538 (49.07%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRR------GTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSD---------GKRGAP---GEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGF---KGDKGLPGNPGTPGVIGPQ 7191
            +GE G  GP G  G  G  G  G++G  G RG  G DG  G  G  G +G +G PG R      G  G PG +G  G PG  G +G  G +G  G QG  G  G  GP G +G  G +G  G  G +G PG +         G RGAP   G +G  G AG+ G +G KG+ G +G PG  G  GP GP G  G  GE G+ GD GP G +G+ G RG PG  G  G  G  G+RGP G  G  G +G  G+ G  G +G +G  G PG+ G AG  G  G+ G  G  G  G  G  G  G  G  G  G  G PG   + GP GP G  GP G              G+ G  GP GP G +G  G  G  G  G +G KG KG  G PG  G +G++GP GP G  G  G  G+ GP G  G  G  G  GAPG PG  G +G     G  G+ GP G S   GP G  G QG  G +GL GD G +G  G  G PG  G  G++G  G  G    +G++GLPG PG+ G  GP 
Sbjct:  366 SGEEGKRGPNGEAGSSGPSGNAGIRGVPGTRGLPGPDGRAGGIGPAGSRGSSGPPGARGPNGDAGRPGEPGLLGARGLPGFSGSNGPQGKEGPAGPQGIEGRSGAAGPAGARGEPGAIGFPGPKGPNGEPGKNGDKGNQGPSGNRGAPGPDGNNGAQGPAGLGGATGEKGEQGPSGAPGFQGLPGPGGPPGEVGKPGERGAPGDFGPPGSAGTRGERGAPGESGGAGPHGPSGSRGPSGAPGPDGQKGEPGAAGLNGGLGPSGPAGIPGERGTAGTPGTKGEKGDAGNSGDYGNPGRDGARGPAGAAGAPGPAGGPGDRGESGPAGPSGVAGPRGAP------------GERGEAGPAGPTGFAGPPGAAGHTGAKGDRGAKGPKGEAGSPGPLGAHGSAGPAGPNGPAGSTGARGDAGPSGATGFPGPAGRAGAPGPPGNVGPSGPTGHPGKDGSRGPRGDS---GPVGRPGEQGQHGPVGLAGDKGPSGEAGPAGPPGAAGPSGVLGARGILGLPGTRGERGLPGGPGSNGEPGPS 888          

HSP 3 Score: 99.3673 bits (246), Expect = 5.236e-19
Identity = 78/243 (32.10%), Postives = 119/243 (48.97%), Query Frame = -3
Query:  229 EDEDIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCIE--PEVVN----YKKTSYTKTISSWFSVLASLNKQISY-------KIPKEQLVFXXXXXXXXXXXXXXSC-DQIALVSDDSITQDIRYNNSVQLFGDDNQILTVNNEDDLFQYKVVEDTC-KDKSNNGRAVIKVEXXXXXXXXXXXLNFKSIENSRPAMIGIEIGPVCF 912
            +D ++   L  L+  ++ +  P GS+  PAR+C D++  +   ++G ++IDPN G   DAI V C+F   ETCI   P+ +     Y  TS       WF  + +   Q  Y       K    QL F++L +  +SQ +T  C + IA +  D  T +++   +V L G ++  L     +  F Y V+ED C K     G+ VI+   ++P RLPI D+    I       IG EIGPVCF
Sbjct: 1118 KDYEVDATLKSLNQQIEVILTPEGSRKNPARTCRDLRLSHPEWTSGFYWIDPNQGCTSDAIRVFCDFSSGETCIHANPDEITQKNWYINTSNKDKKHLWFGEILNGGTQFEYHDEGLTAKDMATQLAFMRLLANQASQNITYHCKNSIAYM--DEETGNLK--KAVILQGSNDVELRAEG-NTRFTYSVLEDGCTKHTGEWGKTVIEYRTNKPSRLPILDIAPLDI-GGHDQEIGFEIGPVCF 1354          

HSP 4 Score: 98.2117 bits (243), Expect = 9.853e-19
Identity = 198/558 (35.48%), Postives = 228/558 (40.86%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGS---DGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIA---------------------GVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPG------------------IAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            G PG  GP GP+G  G+ G  G+ G KG  G  G+ G +G +G  GP G  G  G  G  GS GP GNAG  GV G  G                       G  G  GG+G  GS G  G PG+   +G  G PGE G  G  G+ G SG  G  GK G  G  G  G  G  G  G  GE G+ G  GP GP+G PG  G+ G  G  G++G PG  G  G  G  G  G TG KG QG  G                       G PG  G  G AG  G                                   G PG++   GP GP G RGP G  G DG  G  G  G +G  GP GP G  G+RG  G+ G  G KG+ G+ G YG PG                    GD G SGP GP G  G  G  GE+G  G  G  G  G  GA G  G  G+ G     G  G+ GP+G+ G  GP    G  GP GS G +GD G +G                       GF G  G  G PG PG +GP 
Sbjct:  319 GIPGPAGPAGPSGARGLAGDPGIAGGKGDTGSKGEPGSVGQQGPAGPSGEEGKRGPNGEAGSSGPSGNAGIRGVPGTRGL---------------------PGPDGRAGGIGPAGSRGSSGPPGARGPNGDAGRPGEPGLLGARGLPGFSGSNGPQGKEGPAGPQGIEGRSGAAGPAGARGEPGAIGFPGPKGPNGEPGKNGDKGNQGPSGNRGAPGPDGNNGAQGPAGLGGATGEKGEQGPSGAPGFQGLPGPGGPPGEVGKPGERGAPGDFGPPGSAGTRG---------------------------------ERGAPGESGGAGPHGPSGSRGPSGAPGPDGQKGEPGAAGLNGGLGPSGPAGIPGERGTAGTPGTKGEKGDAGNSGDYGNPGRDGARGPAGAAGAPGPAGGPGDRGESGPAGPSGVAGPRGAPGERGEAGPAGPTGFAGPPGAAGHTGAKGDRGAKGPKGEAGSPGPLGAHGSAGP---AGPNGPAGSTGARGDAGPSG---------------------ATGFPGPAGRAGAPGPPGNVGPS 798          

HSP 5 Score: 97.4413 bits (241), Expect = 2.069e-18
Identity = 203/487 (41.68%), Postives = 237/487 (48.67%), Query Frame = 1
Query: 5680 GVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSP------------------GPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPG------ARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXT---------PGKNMQPGPQGPLGE---RGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIG 7032
            G PG  GP G  G +G+RG  G+ G  GP G  G +GP+GAPG  G  G P                  G  G AG PG +G  G  GN G+ G  G  G  G  G  G  G  GG G +G  G  G  G  G RGAPGE G+   AG  GP+G  G PG  G+ G  G RG +GP+G  G  G LG+ G  GP GP+G  G  G  G  G  G+ GFPG      A GP G +G  GP G  G  GS+G  G +G  G PG+ G+ G VG+ G  GP G  GP GP G  G  G  G  G  G PGT         PG N +PGP G  G    RGPPG  G  G  G       SG  G  G PGN G    PG +G  G KG +G  G  G  G+AG  G +G  GP G++G+ G  G  GP G  G +G RG  G  G+ G  GE G+    G  G  G  G SG  GP G  G  GP GS+G
Sbjct:  565 GAPGDFGPPGSAGTRGERGAPGESGGAGPHGPSGSRGPSGAPGPDGQKGEPGAAGLNGGLGPSGPAGIPGERGTAGTPGTKGEKGDAGNSGDYGNPGRDGARGPAGAAGAPGPAGGPGDRGESGPAGPSGVAGPRGAPGERGE---AGPAGPTGFAGPPGAAGHTGAKGDRGAKGPKGEAGSPGPLGAHGSAGPAGPNGPAGSTGARGDAGPSGATGFPGPAGRAGAPGPPGNVGPSGPTGHPGKDGSRGPRGDSGPVGRPGEQGQHGPVGLAGDKGPSGEAGPAGPPGAAGPSGVLGARGILGLPGTRGERGLPGGPGSNGEPGPSGLAGSSGPRGPPGSVGSPGPVG------HSGEAGRDGHPGNDGP---PGRDGLPGAKGERGYPGNTGPSGLAGAPGPAGSAGPAGKSGNRGEGGPSGPAGITGPSGPRGPAGPQGVRGDKGEAGERGARGLDGRKGHNGLSGLPGPSGTPGETGPSGSVG 1039          

HSP 6 Score: 95.5153 bits (236), Expect = 7.264e-18
Identity = 170/478 (35.56%), Postives = 201/478 (42.05%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGD---KGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMG 7068
            GE G  GPTG  G PG  G  G KGD   KG +G  G  G LG  G+ GP GP G  G  G  G  GP G  G PG  G +G                          G  G +G  G  G  G  GS G RG  G  G PG+ G  GP G+ GD G +G  G +G  G  G              G +G  G  G PG RG  G+ G  GS G PG   P G+ GS GPRG  GS GS G +G +G     G+DG  G  G                                     PG++  PG +G   ERG PG +                     GP G +G  G  GS GP+G  GN+G  GP G  GI G +G  GP GP+G  GD G  GE+G  G  G  G  G++G PG  G  GE G        G++GP+G  G  GP G  G +G  G  G  G +G  GP G
Sbjct:  706 GEAGPAGPTGFAGPPGAAGHTGAKGDRGAKGPKGEAGSPGPLGAHGSAGPAGPNGPAGSTGARGDAGPSGATGFPGPAGRAG------------------------APGPPGNVGPSGPTGHPGKDGSRGPRGDSGPVGRPGEQGQHGPVGLAGDKGPSGEAGPAGPPGAAG------------PSGVLGARGILGLPGTRGERGLPGGPGSNGEPG---PSGLAGSSGPRGPPGSVGSPGPVGHSG---EAGRDGHPGNDG------------------------------------PPGRDGLPGAKG---ERGYPGNT---------------------GPSGLAGAPGPAGSAGPAGKSGNRGEGGPSGPAGITGPSGPRGPAGPQGVRGDKGEAGERGARGLDGRKGHNGLSGLPGPSGTPGETGP------SGSVGPVGPRGPSGPSGPPGKEGRSGHPGAMGPVGPRGPAG 1075          

HSP 7 Score: 87.4261 bits (215), Expect = 2.040e-15
Identity = 197/518 (38.03%), Postives = 219/518 (42.28%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGA---------------PGRRGT------------------VGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGL---------GIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVK---GDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGI---------------RGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQG 7014
            +G PG  GP GP G  G  G  G+ G KG RG  G DG  G  G  G +G  GA               PG RG                   VG  GP+G+AG PG+ G  G  G  G  G  GP G  G RG  G  GS G           G+ G+ G  G PG  G  G PG  G PG AG  GPSG +   GDPG              G +G+ G  GE GS G  GP GPSG  G RG  G  GS G  G  G RG  G  G PGP GR G  G  G+ G +G PG  G +G AG+ G                           +PG  G  G PG +   GPQG  G  GP G  G  G  G  G  G+ G    IG PG  G  G PG N   G KGN+G  G  G PG  G+NGA   QGP G  G  G  GEQGP G  G  G+               RG  G  G PG  G  G+    G  G  GP G SG RGP G  G  G
Sbjct:  141 SGRPGERGPVGPQGARGFPGTPGLPGFKGIRGHTGSDGQKGAPGAAGVKGENGANGDNGSPGQAGARGLPGERGRIGPAGSAGSRGSDGSSGPVGPAGPIGSAGAPGLPGAPGAKGELGPAGNNGPTGAAGGRGEPGPPGSLGPAGPPGNPGTNGVNGAKGTAGLPGVGGAPGLPGGRGIPGPAGPAGPSGARGLAGDPGIA------------GGKGDTGSKGEPGSVGQQGPAGPSGEEGKRGPNGEAGSSGPSGNAGIRGVPGTRGLPGPDGRAGGIGPAGSRGSSGPPGARGPNGDAGRPG---------------------------EPGLLGARGLPGFSGSNGPQGKEGPAGPQGIEGRSGAAGPAGARGEPGA---IGFPGPKGPNGEPGKN---GDKGNQGPSGNRGAPGPDGNNGA---QGPAGLGGATGEKGEQGPSGAPGFQGLPGPGGPPGEVGKPGERGAPGDFGPPGSAGTRGERGAPGESGGAGPHGPSGSRGPSGAPGPDG 610          

HSP 8 Score: 85.8853 bits (211), Expect = 6.470e-15
Identity = 179/547 (32.72%), Postives = 207/547 (37.84%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIK---GSIGQDGYPGSDGKRGAPGEHGDPGKA---------------GIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPS------------------------GSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGE---------------QGPVGEVGNAGIRGVN---------------GAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMG 7068
            G PG NG  G TG  G +GP G  G  G+ G  GK G  G RG +GPQG  G P   GT G PG  G  GH G  G  G                           + G  G+K   G+ G +G PG  G RG PGE G  G A               G  GP G  G PG                 G  G  GELG  G+ GP G +                        G  G +G  G+ G  G+ G PG R   GI G  GP G +G++G  G  GIAG  G  G  G+ G VG                                          Q GP GP GE G  G                +G  G  GP GN+G RG+PG+ G  G  G  G  GP      AG  G+SGP G RG NGD G  GE                GP G+ G AG +G+                GA G PG  G NG+   +G KGN GP G+ G  GP G  G QGP G  G  G+ G  GP G
Sbjct:  106 GLPGENGEPGQTGPVGSRGPSGAPGKAGEDGHPGKSGRPGERGPVGPQGARGFP---GTPGLPGFKGIRGHTGSDGQKG---------------------------APGAAGVKGENGANGDNGSPGQAGARGLPGERGRIGPAGSAGSRGSDGSSGPVGPAGPIGSAGAPGLP---------------GAPGAKGELGPAGNNGPTGAAGGRGEPGPPGSLGPAGPPGNPGTNGVNGAKGTAGLPGVGGAPGLPGGR---GIPGPAGPAGPSGARGLAGDPGIAGGKGDTGSKGEPGSVG------------------------------------------QQGPAGPSGEEGKRGP---------------NGEAGSSGPSGNAGIRGVPGTRGLPGPDGRAGGIGP------AGSRGSSGPPGARGPNGDAGRPGEPGLLGARGLPGFSGSNGPQGKEGPAGPQGIEGRSGAAGPAGARGEPGAIGFPGPKGPNGEPGKNGDKGNQGPSGNRGAPGPDGNNGAQGPAGLGGATGEKGEQGPSG 541          

HSP 9 Score: 55.8398 bits (133), Expect = 8.189e-6
Identity = 104/294 (35.37%), Postives = 123/294 (41.84%), Query Frame = 1
Query: 6532 PGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAG---DNGASGPQGPRGENGDLGNTGEQG------------------PVGEVGNAGIRGVNGAPGIPGKDGENG---------------------------------KDAVDGAKGNIG---------------------PIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGP 7188
            PG+N +PG  GP+G RGP G  G  G  G+ G  G+ G +GP+GP G  G  G PG  G  G +G+ GS G  G PG AG   +NGA+G  G  G+ G  G  GE+G                  PVG  G  G  G  G PG PG  GE G                                  + V+GAKG  G                     P G SG RG  G  GI G  G  G KG+ GS G  G  G  G  GK G  G  G  G  G+ G+ G PGT G+ GP
Sbjct:  108 PGENGEPGQTGPVGSRGPSGAPGKAGEDGHPGKSGRPGERGPVGPQGARGFPGTPGLPGFKGIRGHTGSDGQKGAPGAAGVKGENGANGDNGSPGQAGARGLPGERGRIGPAGSAGSRGSDGSSGPVGPAGPIGSAGAPGLPGAPGAKGELGPAGNNGPTGAAGGRGEPGPPGSLGPAGPPGNPGTNGVNGAKGTAGLPGVGGAPGLPGGRGIPGPAGPAGPSGARGLAGDPGIAGGKGDTGSKGEPGSVGQQGPAGPSGEEGKRGPNGEAGSSGPSGNAGIRGVPGTRGLPGP 401          
BLAST of Collagen alpha-1(XXVII) chain B vs. UniProt/SwissProt
Match: sp|Q91717|CO2A1_XENLA (Collagen alpha-1(II) chain OS=Xenopus laevis OX=8355 GN=col2a1 PE=2 SV=2)

HSP 1 Score: 158.303 bits (399), Expect = 6.036e-37
Identity = 89/251 (35.46%), Postives = 129/251 (51.39%), Query Frame = 1
Query: 8512 PVRTVRRD-----LLNDDALAVKYLGSDV--VKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASDVTEYRS-WFGE-ITGTFKFDYQIEAS-------QLMFLKLFSTNARQRITINCSRL-----SVVGNSEHPVILYSDHDEEVLRNGD-LFKYSVIRDGCKNSAEIIDSTELEMDTEAI-RLPIRDIA-LNTGSSKEQQQFGLDIGQVCF 9192
            P+R +R D     L  D    +K L + +  ++ P GTK  PARTC+ L   +P  + G Y+IDPN G   DA +V C  +  E+C+         K+W ++   E +  WFGE I G F+F Y  ++S       Q+ FL+L ST+A Q IT +C           GN +  V+L   +D E+   G+  F Y+ + DGCK        T +E  T+   RLPI DIA ++ G +   Q+FG+DIG VCF
Sbjct: 1237 PMRYMRADQASNSLPVDVEATLKSLNNQIENIRSPDGTKKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTVDAIKVFCDMETGETCVYPNPSKIPKKNWWSAKGKEKKHIWFGETINGGFQFSYGDDSSAPNTANIQMTFLRLLSTDASQNITYHCKNSIAFMDEASGNLKKAVLLQGSNDVEIRAEGNSRFTYNALEDGCKKHTGKWSKTVIEYRTQKTSRLPIVDIAPMDIGGA--DQEFGVDIGPVCF 1485          

HSP 2 Score: 101.293 bits (251), Expect = 1.281e-19
Identity = 222/592 (37.50%), Postives = 259/592 (43.75%), Query Frame = 1
Query: 5662 GPTGPTGVPGMKGPLGVKGDKGQRGRM------------------------GKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGE------HGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLR------------------GNPGVIGSLGSQGFPGARGPQ---------------------------GILGSPGPRGRTGSKGSQGTIGIAGVP---GTPGKDGKAGQ------VGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLG---------------------------NTGEQGP------VGEVGNAGIRGVNGAP------GIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMG 7068
            GP GP G+PG +G  G  G  G RG                          G  G  GP G  GP+G  G  G  GT GSPGP G +G+PG  GI G  G+ G PG+ G PG PG RGP G +G+ G LG KG  G  G  G  G++G  GE       G PG AG +G  G +G+PG           GP GP G RG  G  G  G  G  GP G+PG R                  G PG+ G+ G  G PG  GPQ                           G++G PGP+G  G  G  G  G+ G P   G PGKDG+ G        G  G+ G  G PGP G  GLPG PG  G+ G  G  G PG+   PG  GP GERG PG+ G  G           GLQGP G PG  G  G  G++GPSG  G +G  G  G PG  G  G SGP+G RG+ G+ G                             GE GP      VG  G  G RG NG P      G PG DG++G     G  G  G  G+ G +GP G  G QGP G  G KG  G+ GP G
Sbjct:  323 GPMGPRGLPGERGRPGSSGAAGARGNDGLPGPAGPPGPVGPAGAPGFPGAPGSKGEAGPTGARGPEGAQGPRGESGTPGSPGPAGASGNPGTDGIPGAKGSSGGPGIAGAPGFPGPRGPPGPQGATGPLGPKGQTGDPGVAGFKGEQGPKGEIGSAGPQGAPGPAGEEGKRGARGEPGAA---------GPNGPPGERGAPGNRGFPGQDGLAGPKGAPGERGVPGLGGPKGGNGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGASGEDGRPGPPGPQGARGQPGVMGFPGPKGANGEPGKAGEKGLVGAPGLRGLPGKDGETGSQGPNGPAGPAGERGEQGPPGPSGFQGLPGPPGSPGEGGKPGDQGVPGEAGAPGLVGPRGERGFPGERGSSGP---------QGLQGPRGLPGTPGTDGPKGASGPSGPNGAQGPPGLQGMPGERGAAGISGPKGDRGDTGEKGPEGASGKDGSRGLTGPIGPPGPAGPNGEKGESGPSGPPGIVGARGAPGDRGENGPPGPAGFAGPPGADGQSGLKGDQGESGQKGDAGAPGPQGPSGAPGPQGPTGVFGPKGARGAQGPAG 896          

HSP 3 Score: 96.2857 bits (238), Expect = 4.152e-18
Identity = 194/494 (39.27%), Postives = 232/494 (46.96%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGA---------PGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIG---PMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTG---------------SKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQ------PGPQGPLGERGPPGKSXXXXXXXXXXXXX---------QSGLQGPIGPPGNSGQRGLPG---------------------SNGPSGTKGNKGS---KGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENG 6924
             G PG+ GP G  G PG +G  G +G +G RG  G  G  GP+G  GP GP GA         PG RG  G  GP G+ G  G +G  G  G  G  G+ GP G PG  GP GEKG  G  G  G +G  G PG  G+ G PG  G  G  G DG SG+KGD G                        E G KGD G   P GPSG+PG +G  GV G  G++G   A+GP G  G PG  GR G               S G +G  G+ G  G PG+ G  G  G  G  G  G PG  GP G  G PG  G  G  G  G PG+  +      PGP G  G++G PG SGD G PG VGPPG         + G  G  GPPG  G  G+ G                     S GP+G +G++G    +GP G  G AG  G +GPQGPRG+ G+ G  GE+   G+ G+ G  G+ G PG PG  G+ G
Sbjct:  691 AGAPGLVGPRGERGFPGERGSSGPQGLQGPRGLPGTPGTDGPKGASGPSGPNGAQGPPGLQGMPGERGAAGISGPKGDRGDTGEKGPEGASGKDGSRGLTGPIGPPGPAGPNGEKGESGPSGPPGIVGARGAPGDRGENGPPGPAGFAGPPGADGQSGLKGDQG------------------------ESGQKGDAGAPGPQGPSGAPGPQGPTGVFGPKGARG---AQGPAGATGFPGAAGRVGTPGPNGNPGPPGPPGSAGKEGPKGVRGDAGPPGRAGDPGLQGAAGAPGEKGEPGEDGPSGPDGPPGPQGLSGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGGPGSSGDRGPPGPVGPPGLTGPSGEPGREGNPGSDGPPGRDGATGIKGDRGETGPLGAPGAPGAPGAPGSVGPTGKQGDRGESGPQGPLGPSGPAGARGLAGPQGPRGDKGEAGEAGER---GQKGHRGFTGLQGLPGPPGSAGDQG 1154          

HSP 4 Score: 90.5077 bits (223), Expect = 2.750e-16
Identity = 59/242 (24.38%), Postives = 107/242 (44.21%), Query Frame = -3
Query:  229 DIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCIEPEVVNYKKTSYTKTISSWFSVLASLNKQISY-KIPKEQLVFXXXXXXXXXXXXXXSCDQIALVSDDSITQDIRYN--NSVQLF----GDDNQILTVNNEDDL---------FQYKVVEDTCKDKSNNGRAVIKVEXXXXXXXXXXXLNFKSIE-NSRPAMIGIEIGPVCF 903
            D+   L  L++ ++N+  P G+K  PAR+C D++  +    +G ++IDPN G   DAI V C+ +  ETC+ P      K        +W+S      K I + +       F      S+  T  +    + L+S D+ +Q+I Y+  NS+       G+  + + +   +D+         F Y  +ED CK  +      + +E    +   +  ++   ++        G++IGPVCF
Sbjct: 1253 DVEATLKSLNNQIENIRSPDGTKKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTVDAIKVFCDMETGETCVYPNPSKIPK-------KNWWSAKGKEKKHIWFGETINGGFQFSYGDDSSAPNTANIQMTFLRLLSTDA-SQNITYHCKNSIAFMDEASGNLKKAVLLQGSNDVEIRAEGNSRFTYNALEDGCKKHTGKWSKTV-IEYRTQKTSRLPIVDIAPMDIGGADQEFGVDIGPVCF 1485          

HSP 5 Score: 88.9669 bits (219), Expect = 7.945e-16
Identity = 204/580 (35.17%), Postives = 242/580 (41.72%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGA---------PGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSG---------------------SPGLRGNPGVIGSLGSQGFPGARG---------PQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIG------------SSGRRGPQGMTGIQGPPGSIG---LKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKG---------DKGLPGNPGTPGVIGPQ 7191
             GE G  G  G  G  G  GP G +G  G RG  G+DG+ GP+G  G +G  G          PGR G  G PG  G  G PG  G  G+ G  G  G  G PG PG +G  G+ G  G  G KG+ G+ G  G  G  GAPG  G PGK G  G  G  G  G                          G +G+ GP GPSG                      PG  G PG++G  G +GFPG RG         P+G+ G+PG  G  G+ G  G  G  G PG  G  G+ G  GI G  G                                G   + GP+G  G+ G  G +G  G PG  GP G+ G  GP GPPG  G RG PG  G +G  G  G  GP   PG  G +G  G QG  G+ GD G  G QGP G  G  G  GV G  G  G  G  G     GA G +G  G            S+G+ GP+G+ G  GPPG  G   L+G  G+ G  G  G  G  G  G  GP G  G +G         ++G PG PG  G  G Q
Sbjct:  487 AGEEGKRGARGEPGAAGPNGPPGERGAPGNRGFPGQDGLAGPKGAPGERGVPGLGGPKGGNGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGASGEDGRPGPPGPQGARGQPGVMGFPGPKGANGEPGKAGEKGLVGAPGLRGLPGKDGETGSQGPNGPAGPA------------------------GERGEQGPPGPSGFQGLPGPPGSPGEGGKPGDQGVPGEAGAPGLVGPRGERGFPGERGSSGPQGLQGPRGLPGTPGTDGPKGASGPSGPNGAQGPPGLQGMPGERGAAGISGPKGDR------------------------------GDTGEKGPEGASGKDGSRGLTGPIGPPGPAGPNGEKGESGPSGPPGIVGARGAPGDRGENGPPGPAGFAGP---PGADGQSGLKGDQGESGQKGDAGAPGPQGPSGAPGPQGPTGVFGPKGARGAQGPAGATGFPGAAGRVGTPGPNGNPGPPGPPGSAGKEGPKGVRGDAGPPGRAGDPGLQGAAGAPGEKGEPGEDGPSGPDGPPGPQGLSGQRGIVGLPGQRGERGFPGLPGPSGEPGKQ 1009          

HSP 6 Score: 64.6994 bits (156), Expect = 2.002e-8
Identity = 188/536 (35.07%), Postives = 224/536 (41.79%), Query Frame = 1
Query: 5794 TGAPGRRGTVGSPGPVGNAGH------PGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEH---------------------GDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSL------------------------------------GSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQP---------------GPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGP------PGNSGQRGL---PGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGEN---------------------GDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGL---KGDIGSTGPMG 7068
             G PG+ G  G PGP G  G       PGV+G  G PG  G  G  G  G  G  G  GE GS G +G +G  G+ G PGS G  GA G                       G PG  G  GP+G +G  G                    G  GE G+ G  GP G SG+PG  G PG  GS                                     G  GF G +GP+G +GS GP+G  G  G +G  G  G PG  G +G  G+ G PG  G PG+ G  GP G PG  G  G  GP G  G PG+  +P               GPQG +G  G  G+ G  G PG  G  GQ G+ G  GP      PG +G++GL   PG  G  G  G  GS+GP G  G AG+ G  GP GP G                       G+ G  G  GP GE G  G RG +G  G+ G  G  G    DG KG  GP G +G +GP G+ G+ G  G+ G+   KGD G TG  G
Sbjct:  259 AGKPGKSGERGPPGPQGARGFPGTPGLPGVKGHRGYPGLDGAKGEAGAAGAKGEGGATGEAGSPGPMGPRGLPGERGRPGSSGAAGARGNDGLPGPAGPPGPVGPAGAPGFPGAPGSKGEAGPTGARGPEGAQ------------------GPRGESGTPGSPGPAGASGNPGTDGIPGAKGSSGGPGIAGAPGFPGPRGPPGPQGATGPLGPKGQTGDPGVAGFKGEQGPKGEIGSAGPQGAPGPAGEEGKRGARGEPGAAGPNGPPGERGAPGNRGFPGQDGLAGPKGAPGERGVPGLGGPKGGNGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGASGEDGRPGPPGPQGARGQPGVMGFPGPKGANGEPGKAGEKGLVGAPGLRGLPGKDGETGSQGPNGPAGPAGERGEQGPPGPSGFQGLPGPPGSPGEGGKPGDQGVPGEAGAPGLVGPRGERGFPGERGSSGPQGLQGPRGLPGTPGTDGPKGASGPSGPNGAQGPPGLQGMPGERGAAGISGPKGDRGDTGEKG 776          

HSP 7 Score: 58.9214 bits (141), Expect = 9.674e-7
Identity = 114/306 (37.25%), Postives = 145/306 (47.39%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNL------------GPQGPTGAPGR---RGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKA---------------------------------GIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQV 6417
            G+ G  GP GP+G PG +GP GV G KG RG  G  G  G  G              GP GP G+ G+   +G  G  GP G AG PG+QG +G PG +GEPG  GP G  G  GP+G  G +G +G+ G  G+ G+PG  G  G PG+ G PG +                                 G DG +G+KGD G+TG  G  G  G  G  G+ G  G+ G +G+ GP GP G           G  G++G  G +GP+G  G  G  G  G KG +G  G+ G+PG PG  G  G  
Sbjct:  860 GDAGAPGPQGPSGAPGPQGPTGVFGPKGARGAQGPAGATGFPGAAGRVGTPGPNGNPGPPGPPGSAGKEGPKGVRGDAGPPGRAGDPGLQGAAGAPGEKGEPGEDGPSGPDGPPGPQGLSGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGGPGSSGDRGPPGPVGPPGLTGPSGEPGREGNPGSDGPPGRDGATGIKGDRGETGPLGAPGAPGAPGAPGSVGPTGKQGDRGESGPQGPLGP---------SGPAGARGLAGPQGPRGDKGEAGEAGERGQKGHRGFTGLQGLPGPPGSAGDQGAT 1156          
BLAST of Collagen alpha-1(XXVII) chain B vs. UniProt/SwissProt
Match: sp|O46392|CO1A2_CANLF (Collagen alpha-2(I) chain OS=Canis lupus familiaris OX=9615 GN=COL1A2 PE=2 SV=2)

HSP 1 Score: 157.918 bits (398), Expect = 6.719e-37
Identity = 79/237 (33.33%), Postives = 120/237 (50.63%), Query Frame = 1
Query: 8530 RDLLNDDALAVKYLGSDVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASDVTEYRSWFGE-ITGTFKFDYQIE-------ASQLMFLKLFSTNARQRITINCSRLSV-----VGNSEHPVILYSDHDEEVLRNGD-LFKYSVIRDGCKNSAEIIDSTELEMDT-EAIRLPIRDIA-LNTGSSKEQQQFGLDIGQVCF 9192
            +D   D  L       + +  P G++  PARTC+ L  ++P    G+Y+IDPN G   DA +V C     E+CI ++  +   K+W  +   +   W GE I G  +F+Y +E       A+QL F++L + +A Q IT +C           GN +  VIL   +D E++  G+  F Y+V+ DGC         T +E  T +  RLPI DIA L+ G +   Q+F +D+G VCF
Sbjct: 1131 KDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRNSKVKKHIWLGETINGGTQFEYNVEGVTTKEMATQLAFMRLLANHASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWRKTIIEYKTNKPSRLPILDIAPLDIGDA--DQEFRVDVGPVCF 1365          

HSP 2 Score: 109.383 bits (272), Expect = 4.528e-22
Identity = 81/276 (29.35%), Postives = 128/276 (46.38%), Query Frame = -3
Query:  229 DLFQNDQPKTEKISSIDPNDEDEDIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCIEPEVVN------YKKTSYTKTISSWFSVLASLNKQISYKIP-------KEQLVFXXXXXXXXXXXXXXSC-DQIALVSDDSITQDIRYNNSVQLFGDDNQILTVNNEDDLFQYKVVEDTCKDKSNNGRAVIKVEXXXXXXXXXXXLNFKSIENSR-------PAMIG-------IEIGPVCF 972
            D ++ DQP++    S+ P D + D    L  L++ ++ L  P GS+  PAR+C D++  +   S+G ++IDPN G   DAI V+C+F   ETCI  +  N      Y+ +   K I  W     +   Q  Y +          QL F++L +  +SQ +T  C + IA +  D  T +++   +V L G  N +  V   +  F Y V+ D C  K+N  R  I +E             +K+ + SR       P  IG       +++GPVCF
Sbjct: 1115 DFYRADQPRSPP--SLRPKDYEVDA--TLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRNSKVKKHI--WLGETINGGTQFEYNVEGVTTKEMATQLAFMRLLANHASQNITYHCKNSIAYM--DEETGNLK--KAVILQG-SNDVELVAEGNSRFTYTVLVDGCSKKTNEWRKTI-IE-------------YKTNKPSRLPILDIAPLDIGDADQEFRVDVGPVCF 1365          

HSP 3 Score: 107.457 bits (267), Expect = 1.525e-21
Identity = 196/502 (39.04%), Postives = 230/502 (45.82%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAP------------GRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGE------------HGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQR---GLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMG 7068
            GE G  G TG  G+PG +G +G  G  G R   G DG +GP   +GP GP G+             G  G VG+PGP G AG  G  G+ G              G  G  G  G  G  G  G  G  G  G PG  G RG PG              G+PG AG  G SG KG+PG           G +GP G  G  G+ G  G+ G  GPSG PGLRG+P      GS+G PGA GP G++G PGPRG TG  G +G  G +G PG PG  G  G  G                      PG  G  G  G  G PG + +PGP GP G RG PG  G              G +GP G PG +G +   GL G+ G  G  GN G++GP G  G+ G  G  GP GP G  G  G  G  G VG+ G  G+ G  G PG  G  GE G     GA G  GPIGS G  GP G  G +G PG +G  G  G++GP G
Sbjct:  205 GENGTPGQTGARGLPGERGRVGAPGPAGAR---GSDGSVGP---VGPAGPIGSAGPPGFPGAPGPKGEIGPVGNPGPAGPAGPRGEVGLPG------------VSGPVGPPGNPGANGLTGAKGAAGLPGVAGAPGLPGPRGIPGPVGAAGATGARGIVGEPGPAGSKGESGNKGEPGSA---------GAQGPPGPSGEEGKRGPNGEAGSAGPSGPPGLRGSP------GSRGLPGADGPAGVMGPPGPRGATGPAGVRGPNGDSGRPGEPGLMGPRGFPGA---------------------PGNVGPAGKEGPMGLPGIDGRPGPIGPAGARGEPGNIGF------------PGPKGPTGDPGKNGDKGHAGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPAGTAGEVGKPGERGLPGEFGLPGPAGPRGERGPPGESGAAGPSGPIGSRGPSGPPGPDGNKGEPGVLGAPGTAGASGPGG 640          

HSP 4 Score: 89.7373 bits (221), Expect = 4.645e-16
Identity = 157/373 (42.09%), Postives = 186/373 (49.87%), Query Frame = 1
Query: 6022 GKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGP---PGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNG---------------------PSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMG 7068
            G RG PG  G PG  G  GP+G  G+PG+TG  G  G  GP G  G  G  G+ G  G+ G +GP G+ G  G PG+ G  G +G  G  G +G  G+PG +G  G+ G  GT G  G  G PG+ G+ G  G  G  G  G  GPVGP G  G  G  G PG  G  G  G    PGP GP G RG    PG SG  G PGN G  G +G +G  G PG +G  GLPG  G                     P+G+KG  G+KG  G  G  G  G SG +G RG NG+ G+ G  GP G  G+ G RG+ GA G  G  G  G     G  G  GP G SGR G  G+ G +G PG+ G  G  G  GPMG
Sbjct:   97 GPRGPPGASGAPGPQGFQGPAGEPGEPGQTGPAGARGPPGPPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGIRGHNGLDGLKGQPGAPGVKGEPGAPGENGTPGQTGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGEIGPVGNPGPAGPAGPRGEVGLPGVSGPVGPPGNPGANGLTGAKGAAGLPGVAGAPGLPGPRGIPGPVGAAGATGARGIVGEPGPAGSKGESGNKGEPGSAGAQGPPGPSGEEGKRGPNGEAGSAGPSGPPGLRGSPGSRGLPGADGPAGVMGPPGPRGATGPAGVRGPNGDSGRPGEPGLMGPRGFPGAPGNVGPAGKEGPMG 469          

HSP 5 Score: 85.1149 bits (209), Expect = 1.006e-14
Identity = 180/485 (37.11%), Postives = 211/485 (43.51%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGP---TGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXX---XXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGS---------------KGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIG 7032
             GEPG  G  G +G  G  G  G +G  G  G  GK G  G  G+ GP GP    G+PG RG  G+ GP G  G PG +G +G                             G  G  G  G+ G PG  G RG PG  G+ G AG +GP G+ G  G+ G  G +G RG            E G+ G  GP GP+G PG  G+ G  G  G++G PG  G  G  G PGP+G  G KG QG  G  G  G PG  G AG+VG                                G  G PG+   PGP GP GERGPPG+SG  G     G+ GP G  G  G  G PG  G  G  G++GP G  G +G+               +G  G PG  G  GA G  G  G  G  G+ GE GP G  G AG RG  G  G  G  G NG     GA G  G  G  G +GP+G  G  GP G IG
Sbjct:  345 VGEPGPAGSKGESGNKGEPGSAGAQGPPGPSGEEGKRGPNGEAGSAGPSGPPGLRGSPGSRGLPGADGPAGVMGPPGPRGATG---------------------------PAGVRGPNGDSGRPGEPGLMGPRGFPGAPGNVGPAGKEGPMGLPGIDGRPGPIGPAGARG------------EPGNIGFPGPKGPTGDPGKNGDKGHAGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPAGTAGEVG------------------------------KPGERGLPGEFGLPGPAGPRGERGPPGESGAAGPSGPIGSRGPSGPPGPDGNKGEPGVLGAPGTAGASGPGGLPGERGAAGIPGGKGEKGETGLRGEIGNPGRDGARGAPGAMGAPGPAGATGDRGEAGPAGPAGPAGPRGTPGERGEVGPAGPNGFAGPAGAAGQPGAKGERGTKGPKGENGPVGPTGPIG 760          

HSP 6 Score: 81.6481 bits (200), Expect = 1.207e-13
Identity = 203/583 (34.82%), Postives = 247/583 (42.37%), Query Frame = 1
Query: 5680 GV-------------------PGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPT---------------------GAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGV---------IGSLGSQGFPGARGPQGILGSPG------------PRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGE------RGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPV---GEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQ---------GPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            G                    PG  G +G +G  G  G  G  G  GP G  G  G T                     G PGR G  G  GP G  G PG  G+ G                         KG +G  G+ G  GQ G PG  G+ GAPGE+G PG+ G  G  G +G  G  G  G                    GS G +GP+GP+G  G  G PG          IG +G+ G  G  GP+G +G PG              G TG+KG+ G  G+AG PG PG  G  G VG  G  G  G  G  GP G  G  G  G+PG AG  G PG + + G +GP GE       GPPG  G  G  G  G  G +G+ GP GP G +G  G+ G NG SG  G  G  GP G PG  G+ G +G +GP G  G  G  G  GP    GE GN G  G  G  G PGK+G+ G   + GA+G  GP G++G +GP G  G+Q         GPPG  GL G  G+ G +G+                      G++GLPG  G PG  GP+
Sbjct:   69 GPPGLGGNFAAQYDGKGVGLGPGPMGLMGPRGPPGASGAPGPQGFQGPAGEPGEPGQTGPAGARGPPGPPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPG------------------------FKGIRGHNGLDGLKGQPGAPGVKGEPGAPGENGTPGQTGARGLPGERGRVGAPGPAGA------------------RGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGEIGPVGNPGPAGPAGPRGEVGLPGVSGPVGPPGNPGANGLTGAKGAAGLPGVAGAPGLPGPRGIPGPVGAAGATGARGIVGEPGPAGSKGESGNKGEPGSAGAQGPPGPSGEEGKRGPNGEAGSAGPSGPPGLRGSPGSRGLPGADGPAGVMGPPGPRGATGPAGVRGPNGDSGRPGEPGLMGPRGFPGAPGNVGPAGKEGPMGLPGIDGRPGPIGPAGARGEPGNIGFPGPKGPTGDPGKNGDKGHAGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPAGTAGEVGK---------------------PGERGLPGEFGLPGPAGPR 588          

HSP 7 Score: 76.6406 bits (187), Expect = 4.046e-12
Identity = 211/623 (33.87%), Postives = 253/623 (40.61%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPG---VQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAG------------------------VPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGP---------------PGNSGQRGLPGSNGPSGTKGNKGS---------------KGPYGKPGIAGDNGASGP------------------------QGPRGENGDLGNTGEQGPVGEVGNAGIRG------------------VNGAPGI---PGKDGENGKDAVDGAKGNIGPIG------SSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIG 7185
            +G PG+ G  G  G+PG  GP GV G  G RG  G  G+ GP G+ G  G  G  G RG  G+PG VG AG  G   + GI GRPG                          G  G +G  G  G+PG  G  G PG++GD G AG+ G  G  G  G  G  G  G +               G +G  G  GP+G PG +G PG  G+ G  G PG RG  G  G PGP G  G +G  G  G AG                        V G PG  G +G  G+PG+ G  G PG  G  G  G  G+ G PG  G  G PG    PGP G  G+RG  G +G  G  G  G PG+ G  GP GP                G  G +G  G NGP G  G  GS               +G  G PG  G  GA+G                         +GPRG+ G +G TGE G  G  G  G +G                  + GAPGI   PG  GE G   V G+ G  GP+G      + G  G  G  G+ G PG  G  G+ G+ GP GR G                 G KG++G PGN G  G +G
Sbjct:  393 SGPPGLRGSPGSRGLPGADGPAGVMGPPGPRGATGPAGVRGPNGDSGRPGEPGLMGPRGFPGAPGNVGPAGKEGPMGLPGIDGRPGPI------------------------GPAGARGEPGNIGFPGPKGPTGDPGKNGDKGHAGLAGARGAPGPDGNNGAQGPPGPQ---------------GVQGGKGEQGPAGPPGFQGLPGPAGTAGEVGKPGERGLPGEFGLPGPAGPRGERGPPGESGAAGPSGPIGSRGPSGPPGPDGNKGEPGVLGAPGTAGASGPGGLPGERGAAGIPGGKGEKGETGLRGEIGNPGRDGARGAPGAMGAPGPAGATGDRGEAGPAGPAGPAGPRGTPGERGEVGPAGPNGFAGPAGAAGQPGAKGERGTKGPKGENGPVGPTGPIGSAGPSGPNGPPGPAGSRGDGGPPGATGFPGAAGRTGPPGPSGITGPPGPPGAAGKEGLRGPRGDQGPVGRTGETGASGPPGFTGEKGPSGEPGTAGPPGTPGPQGLLGAPGILGLPGSRGERGLPGVAGSVGEPGPLGIAGPPGARGPPGAVGAPGVNGAPGEAGRDGNPGNDGPPGRDGQA---------------GHKGERGYPGNIGPVGAVG 961          

HSP 8 Score: 75.0998 bits (183), Expect = 1.219e-11
Identity = 237/637 (37.21%), Postives = 286/637 (44.90%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKG---PLGVKGDKGQRGRMGKDGILGPRG------NLGPQG------------------PTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGY------PGSDGKRGAPGEHGDPGKAGIDGPSGVKGD---PGKTXXXXXXXXXXXXXXXXXXXXXXE------LGSKGDIGPMGPSGSPGLRGNPGV------------IGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVP---GTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGER------------------GPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGP---------------------------QGPRGENGDLGNTGEQGPVG---------EVGNAGIRGVNGAPGI------------PGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIG 7185
            G PG +GP G  G PG +G   P GV+G  G  GR G+ G++GPRG      N+GP G                  P GA G  G +G PGP G  G PG  G  G  G  G  G  GP G  G +GP G +G QGG G +G  G  G+       G+ G+ G PGE G PG+ G+ GP+G +G+   PG++G  G SG  G RGP G  G  G       LG+ G  G  GP G PG RG  G+             G +G+ G  GARG  G +G+PGP G TG +G  G  G AG     GTPG+ G+ G  G  G  GP G  G  G  G  G  G              G+N   GP GP+G                    GPPG +G  G  G  GPPG SG+ GP GPPG +G+ GL G  G  G  G  G  G  G PG  G+ G SG                            +G RG  G  G+ GE GP+G           G  G  GVNGAPG             PG+DG+ G     G  GNIGP+G+ G  GP G  G  G  G+ G  G  GS GP+G           G  GP GP+G +GDKG PG  G  G+ G
Sbjct:  406 GLPGADGPAGVMGPPGPRGATGPAGVRGPNGDSGRPGEPGLMGPRGFPGAPGNVGPAGKEGPMGLPGIDGRPGPIGPAGARGEPGNIGFPGPKGPTGDPGKNGDKGHAGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPAGTAGEVGKPGERGLPGEFGLPGPAGPRGERGPPGESGAAGPSGPIGSRGPSGPPGPDGNKGEPGVLGAPGTAGASGPGGLPGERGAAGIPGGKGEKGETGLRGEIGNPGRDGARGAPGAMGAPGPAGATGDRGEAGPAGPAGPAGPRGTPGERGEVGPAGPNGFAGPAGAAGQPGAKGERGTKGPK------------GENGPVGPTGPIGSAGPSGPNGPPGPAGSRGDGGPPGATGFPGAAGRTGPPGPSGITGPPGPPGAAGKEGLRGPRGDQGPVGRTGETGASGPPGFTGEKGPSGEPGTAGPPGTPGPQGLLGAPGILGLPGSRGERGLPGVAGSVGEPGPLGIAGPPGARGPPGAVGAPGVNGAPGEAGRDGNPGNDGPPGRDGQAGHKGERGYPGNIGPVGAVGAPGPHGPVGPTGKHGNRGEPGPAGSVGPVG---------AVGPRGPSGPQGIRGDKGEPGEKGPRGLPG 1021          

HSP 9 Score: 68.9366 bits (167), Expect = 7.876e-10
Identity = 118/296 (39.86%), Postives = 141/296 (47.64%), Query Frame = 1
Query: 6184 GSKGDIGPMGPSGSPGLRGNPGVIGSLGSQG------FPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGS 7053
            G +GD GP+G +G  G  G PG  G  G  G       PG  GPQG+LG+PG  G  GS+G +G  G+AG  G PG       +GI G  G  G PG VG                      PG N  PG     G  G PG  G  G  G  G  G+ G  G IGP G  G  G  G  GP+G  GN+G  GP G  G  G  G  GP GP+G  GD G  GE+GP G     G++G NG  G+PG  G++G     G+ G  GP G +G  GP G  G  G PG++G  G  GS
Sbjct:  820 GPRGDQGPVGRTGETGASGPPGFTGEKGPSGEPGTAGPPGTPGPQGLLGAPGILGLPGSRGERGLPGVAGSVGEPGP------LGIAGPPGARGPPGAVG---------------------APGVNGAPGE---AGRDGNPGNDGPPGRDGQAGHKGERGYPGNIGPVGAVGAPGPHGPVGPTGKHGNRGEPGPAGSVGPVGAVGPRGPSGPQGIRGDKGEPGEKGPRGL---PGLKGHNGLQGLPGLAGQHGDQGAPGSVGPAGPRGPAGPSGPAGKDGRTGQPGTVGPAGIRGS 1082          

HSP 10 Score: 63.929 bits (154), Expect = 2.892e-8
Identity = 188/520 (36.15%), Postives = 223/520 (42.88%), Query Frame = 1
Query: 5653 GINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPV------------GNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAP------------GEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIA---GVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKG---------------NKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGI---------QGPPGSIGLKGDIGSTG 7059
            G  GP GP G  G+ GP G  G+ G+ G  G  G  G  G  GP+G  G PG  G  G  GP+            GN G PGV G                                   G  G+ G  G PG  G  G P            GE G+PG+ G  G  G  G PG  G  G  G  GP GP G  G  G  G +G++GP GP+G  G  G  G  G+ G +G  G +G  G +G  GP G  G  G  G  G A   G  G PG  G  G  G  G  GP G  GP GP G  G  G  G  G  G  G  G+    GP G  GE+GP G+ G  G PG  GP G  G  G +G PG+ G+RGLPG  G  G  G                 G+ G  G PG AG +G  G  GP G +G  G+ GE+G  G +G  G  G  G  G  G  G++G     G  G++GP+G+ G RGP G  GI         +GP G  GLKG  G  G
Sbjct:  544 GEQGPAGPPGFQGLPGPAGTAGEVGKPGERGLPGEFGLPGPAGPRGERGPPGESGAAGPSGPIGSRGPSGPPGPDGNKGEPGVLGAP---------------------------------GTAGASGPGGLPGERGAAGIPGGKGEKGETGLRGEIGNPGRDGARGAPGAMGAPGPAGATGDRGEAGPAGPAGPAGPRGTPGERGEVGPAGPNGFAGPAGAAGQPGAKGERGTKGPKGENGPVGPTGPIGSAGPSGPNGPPGPAGSRGDGGPPGATGFPGAAGRTGPPGPSGITGPPGPPGAAGKEGLRGPRGDQGPVGRTGETGASGPPGFTGEKGPSGEPGTAGPPGTPGPQGLLGAPGILGLPGSRGERGLPGVAGSVGEPGPLGIAGPPGARGPPGAVGAPGVNGAPGEAGRDGNPGNDGPPGRDGQAGHKGERGYPGNIGPVGAVGAPGPHGPVGPTGKHGNRGEPGPAGSVGPVGAVGPRGPSGPQGIRGDKGEPGEKGPRGLPGLKGHNGLQG 1030          

HSP 11 Score: 60.077 bits (144), Expect = 4.099e-7
Identity = 101/290 (34.83%), Postives = 122/290 (42.07%), Query Frame = 1
Query: 5653 GINGPTGPTGVPGMKGPLGVKGDKGQRGR---------------MGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGN------------AGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTI------GIAGVPGTPGKDGKAGQVGI 6423
            G  GP G TG  G  GP G  G+KG  G                +G  GILG  G+   +G  G PG  G+VG PGP+G              G PGV G  G                          G  G  G  G  G+DG  G  G+RG PG  G  G  G  GP G  G  GK             G RG  G  G +G  G +GP GPSG  G+RG+ G  G  G +G PG +G  G+ G PG  G+ G +G+ G++      G AG  G  GKDG+ GQ G 
Sbjct:  823 GDQGPVGRTGETGASGPPGFTGEKGPSGEPGTAGPPGTPGPQGLLGAPGILGLPGS---RGERGLPGVAGSVGEPGPLGIAGPPGARGPPGAVGAPGVNGAPGE------------------------AGRDGNPGNDGPPGRDGQAGHKGERGYPGNIGPVGAVGAPGPHGPVGPTGKH------------GNRGEPGPAGSVGPVGAVGPRGPSGPQGIRGDKGEPGEKGPRGLPGLKGHNGLQGLPGLAGQHGDQGAPGSVGPAGPRGPAGPSGPAGKDGRTGQPGT 1073          
BLAST of Collagen alpha-1(XXVII) chain B vs. UniProt/SwissProt
Match: sp|Q6P4Z2|CO2A1_XENTR (Collagen alpha-1(II) chain OS=Xenopus tropicalis OX=8364 GN=col2a1 PE=2 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 1.094e-36
Identity = 88/254 (34.65%), Postives = 129/254 (50.79%), Query Frame = 1
Query: 8512 PVRTVRRDLLN--------DDALAVKYLGSDV--VKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASDVTEYRS-WFGE-ITGTFKFDYQIEAS-------QLMFLKLFSTNARQRITINCSRL-----SVVGNSEHPVILYSDHDEEVLRNGD-LFKYSVIRDGCKNSAEIIDSTELEMDTEAI-RLPIRDIA-LNTGSSKEQQQFGLDIGQVCF 9192
            P+R +R D  +        D    +K L + +  ++ P GTK  PARTC+ L   +P  + G Y+IDPN G   DA +V C  +  E+C+         K+W ++   E +  WFGE I G F+F Y  ++S       Q+ FL+L ST+A Q IT +C           GN +  V+L   +D E+   G+  F Y+ + DGCK        T +E  T+   RLPI DIA ++ G +   Q+FG+DIG VCF
Sbjct: 1240 PMRYMRADQASSSVPQRDVDVEATLKSLNNQIESIRSPDGTKKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTVDAIKVFCNMETGETCVYPNPSKIPKKNWWSAKGKEKKHIWFGETINGGFQFSYGDDSSAPNTANIQMTFLRLLSTDATQNITYHCKNSIAFMDEASGNLKKAVLLQGSNDVEIRAEGNSRFTYNALEDGCKKHTGKWSKTVIEYRTQKTSRLPIVDIAPMDIGGA--DQEFGVDIGPVCF 1491          

HSP 2 Score: 107.842 bits (268), Expect = 1.228e-21
Identity = 187/503 (37.18%), Postives = 223/503 (44.33%), Query Frame = 1
Query: 5698 GPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPG------RRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGL-GIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPG------KTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVP------------------GTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAG------------------DNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
            GPLG KG  G  G  G  G  GP+G +G  GP GAPG      +RG  G PG  G  G PG +G  G  G  G                      Q GL G KG+ G+ G PG  G +GA G+ G PG+ G+ G  G+ G PG      K G  G SG  G  GP G +G  G+ G  G  GP G +G PG  G  G++G+ G +G PG  G  G  G  GP G  G +G QG  G +G                    G PG+ G  G VG                              P G  G PG+    GPQG  G RG PG  G DG  G  GP G +G QGP G  G  G+RG  G +GP G +G+ G KGP G PG  G                  + G SGP GP G  G  G  G++G  G  G AG  G  GA G  G  G+ G+    G  G  GP G SG  GPQG TG+ GP G+ G +G  G+TG
Sbjct:  452 GPLGPKGQTGDPGVAGFKGEHGPKGEIGSAGPQGAPGPAGEEGKRGARGEPGAAGPLGPPGERGAPGNRGFPG----------------------QDGLAGPKGAPGERGVPGLGGPKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGASGEDGRPGPPGPQGARGQPGVMGFPGPKGANGEPGKAGEKGLLGAPGLRGLPGKDGETGAQGPNGPAGPAGERGEQGPPGPSGFQGLPGPPGSPGEGGKPGDQGVPGEAGAPGLVG------------------------------PRGERGFPGERGSSGPQGLQGPRGLPGTPGTDGPKGATGPSGPNGAQGPPGLQGMPGERGAAGISGPKGDRGDTGEKGPEGAPGKDGSRGLTGPIGPPGPSGPNGEKGESGPSGPAGIVGARGAPGDRGETGPPGPAGFAGPPGADGQAGLKGDQGESGQKGDAGAPGPQGPSGAPGPQGPTGVNGPKGARGAQGPPGATG 902          

HSP 3 Score: 104.76 bits (260), Expect = 1.266e-20
Identity = 208/528 (39.39%), Postives = 247/528 (46.78%), Query Frame = 1
Query: 5743 GKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTK------------------------GNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGN------IGPIGSSGRRGPQGMT---------------GIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            G  G  GP G  GP+G  G  G  GT GSPGP G +G+PG  GI G  G+ G PG+ G PG PG RGP G +G+ G LG KG  G  G  G  G+ G  GE G  G  G  GP+G +G  G  G                     E G+ G +GP G  G+PG RG PG  G  G +G PG RG  G+ G  G  G  G  G  G  G  G+ G PG  G  G+VG  G +G  GRPGP GP G  G PG  G PGP G  G PGK  + G  G  G RG PGK G            ++G QGP GP G +G+RG  G  GPSG +                        G  G  GP G+ G  G+ G+SGPQG +G  G  G  G  GP G  G +G  G  G PG+ G  GE G   + G KG+       GP G+ G+ G +G+T               G  GP G  G+ G  G+ G  G  G PG  G  G  G  G  G KGD+G  G  G  G  GPQ
Sbjct:  377 GSKGEAGPTGARGPEGAQGPRGESGTPGSPGPAGASGNPGTDGIPGAKGSSGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGQTGDPGVAGFKGEHGPKGEIGSAGPQGAPGPAGEEGKRGARG---------------------EPGAAGPLGPPGERGAPGNRGFPGQDGLAGPKGAPGERGVPGLGGPKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGASGEDGRPGPPGPQGARGQPGVMGFPGPKGANGEPGKAGEKGLLGAPGLRGLPGKDG------------ETGAQGPNGPAGPAGERGEQGPPGPSGFQGLPGPPGSPGEGGKPGDQGVPGEAGAPGLVGPRGERGFPGERGSSGPQGLQGPRGLPGTPGTDGPKGATGPSGPNGAQGPPGLQGMPGERGAAGISGPKGDRGDTGEKGPEGAPGKDGSRGLTGPIGPPGPSGPNGEKGESGPSGPAGIVGARGAPGDRGETGPPGPAGFAGPPGADGQAGLKGDQGESGQKGDAGAPGPQ 871          

HSP 4 Score: 98.2117 bits (243), Expect = 1.279e-18
Identity = 192/534 (35.96%), Postives = 230/534 (43.07%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGA---------PGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIG---PMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLG---ERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPY------------------GKPGIAGDNGASGPQG---------------------------------PRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGD 7044
             G PG+ GP G  G PG +G  G +G +G RG  G  G  GP+G  GP GP GA         PG RG  G  GP G+ G  G +G  G PG  G  G+ GP G PG  GP GEKG  G  G  G +G  G PG  G+ G PG  G  G  G DG +G+KGD G                        E G KGD G   P GPSG+PG +G  GV G  G++G   A+GP G  G PG  GR G  G  G  G +G PG+ GK+G  G  G  G                                   G+   PG QGP G   E+G  G+ G  G  G  GP G SG +G +G PG  G+RG PG  GPSG  G +G  G                    G+PG  G+ G+ GP G                                 P G+ GD G +G QGP+G  G AG R      G+PG  G  G       KG  G  G  G++G +G TG+QG PG  G  GD
Sbjct:  694 AGAPGLVGPRGERGFPGERGSSGPQGLQGPRGLPGTPGTDGPKGATGPSGPNGAQGPPGLQGMPGERGAAGISGPKGDRGDTGEKGPEGAPGKDGSRGLTGPIGPPGPSGPNGEKGESGPSGPAGIVGARGAPGDRGETGPPGPAGFAGPPGADGQAGLKGDQG------------------------ESGQKGDAGAPGPQGPSGAPGPQGPTGVNGPKGARG---AQGPPGATGFPGAAGRVGPPGPNGNPGPSGAPGSAGKEGPKGARGDAGPT---------------------------------GRAGDPGLQGPAGVPGEKGESGEDGPSGPDGPPGPQGLSGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGGPGSAGDRGPPGPVGPPGLTGPAGEPGREGNAGSDGPPGRDGATGIKGDRGETGPLGAPGAPGAPGAPGPVGPTGKQGDRGESGPQGPLGPSGPAGAR------GLPGPQGPRGD------KGEAGEAGERGQKGHRGFTGLQGLPGPPGTAGD 1155          

HSP 5 Score: 93.9745 bits (232), Expect = 2.060e-17
Identity = 64/257 (24.90%), Postives = 114/257 (44.36%), Query Frame = -3
Query:  229 KTEKISSIDPNDEDEDIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCIEPEVVNYKKTSYTKTISSWFSVLASLNKQISY-KIPKEQLVFXXXXXXXXXXXXXXSCDQIALVSDDSITQDIRYN--NSVQLF----GDDNQILTVNNEDDL---------FQYKVVEDTCKDKSNNGRAVIKVEXXXXXXXXXXXLNFKSIE-NSRPAMIGIEIGPVCF 948
            + ++ SS  P   D D+   L  L++ ++++  P G+K  PAR+C D++  +    +G ++IDPN G   DAI V CN +  ETC+ P      K        +W+S      K I + +       F      S+  T  +    + L+S D+ TQ+I Y+  NS+       G+  + + +   +D+         F Y  +ED CK  +      + +E    +   +  ++   ++        G++IGPVCF
Sbjct: 1245 RADQASSSVPQ-RDVDVEATLKSLNNQIESIRSPDGTKKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTVDAIKVFCNMETGETCVYPNPSKIPK-------KNWWSAKGKEKKHIWFGETINGGFQFSYGDDSSAPNTANIQMTFLRLLSTDA-TQNITYHCKNSIAFMDEASGNLKKAVLLQGSNDVEIRAEGNSRFTYNALEDGCKKHTGKWSKTV-IEYRTQKTSRLPIVDIAPMDIGGADQEFGVDIGPVCF 1491          

HSP 6 Score: 87.4261 bits (215), Expect = 2.438e-15
Identity = 222/556 (39.93%), Postives = 257/556 (46.22%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLG---------PQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGK---AGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGL------RGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPG---------PQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRG------------VNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
             GE G  G  G  G  G  GP G +G  G RG  G+DG+ GP+G  G         P+G  G PGR G  G PG  G  G PG  G  G+ G  G  G  G PG PG +G  G+ G  G  G KG+ G+ G  G  G  GAPG  G PGK    G  GP+G  G  G+ G  G  G  G +G  G  G  GE G  GD G  G +G+PGL      RG PG  GS G QG  G RG  G  G+ GP+G TG  G  G  G  G+ G PG+ G AG  G                       G  G  G  G  G PGK+   G         P GP GE+G  G SG  G+ G  G PG  G  GP GP G +G  G  G  G  G +G  G KG  G PG  G +GA GPQGP G NG  G  G QGP G  G  G  G             +GAPG  GK+G        GA+G+ GP G +G        G+QGP G  G KG+ G  GP G  G PG  G  G  G  G  G +G++G PG PG  G  G Q
Sbjct:  490 AGEEGKRGARGEPGAAGPLGPPGERGAPGNRGFPGQDGLAGPKGAPGERGVPGLGGPKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGASGEDGRPGPPGPQGARGQPGVMGFPGPKGANGEPGKAGEKGLLGAPGLRGLPGKDGETGAQGPNGPAGPAGERGEQGPPGPSGFQGLPGPPGSPGEGGKPGDQGVPGEAGAPGLVGPRGERGFPGERGSSGPQGLQGPRGLPGTPGTDGPKGATGPSGPNGAQGPPGLQGMPGERGAAGISG---------------------PKGDRGDTGEKGPEGAPGKDGSRGLTGPIGPPGPSGPNGEKGESGPSGPAGIVGARGAPGDRGETGPPGPAGFAGPPGADGQAGLKGDQGESGQKGDAGAPGPQGPSGAPGPQGPTGVNGPKGARGAQGPPGATGFPGAAGRVGPPGPNGNPGPSGAPGSAGKEGPK------GARGDAGPTGRAGD------PGLQGPAGVPGEKGESGEDGPSGPDGPPGPQGLSGQRGIVGLPGQRGERGFPGLPGPSGEPGKQ 1012          

HSP 7 Score: 75.8702 bits (185), Expect = 6.542e-12
Identity = 140/459 (30.50%), Postives = 173/459 (37.69%), Query Frame = 1
Query: 6031 GAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFP------------------GARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKG---------SKGPYGKPGIAGDNGASGPQGPRGEN---------------GDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQ------------------------------GPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            GAPG  G+ G  G  GP G +G  G                        E G+ G  GP G SG+PG  G PG  GS G+ G                    G  GP+G  G PG  G  G  G +G IG AG  G PG  G+ G+ G                                      G+    GP GP GERG PG  G  G         Q GL GP G PG   +RG+PG  GP G  G+ G         ++G  G+PG AG  G  GP G  GE+               G +G  G +G  GE G AG +G+ GAPG+ G  G++G+    G  G  GP G  G +GP G +G Q                              GP G  G  G+ GS+GP                     +G +G +GLPG   TPG  GP+
Sbjct:  374 GAPGSKGEAGPTGARGPEGAQGPRG------------------------ESGTPGSPGPAGASGNPGTDGIPGAKGSSGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGQTGDPGVAGFKGEHGPKGEIGSAGPQGAPGPAGEEGKRGAR------------------------------------GEPGAAGPLGPPGERGAPGNRGFPG---------QDGLAGPKGAPG---ERGVPGLGGPKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGASGEDGRPGPPGPQGARGQPGVMGFPGPKGANGEPGKAGEKGLLGAPGLRGLPGKDGETGAQGPNGPAGPAGERGEQGPPGPSGFQGLPGPPGSPGEGGKPGDQGVPGEAGAPGLVGPRGERGFPGERGSSGP---------------------QGLQGPRGLPG---TPGTDGPK 736          
BLAST of Collagen alpha-1(XXVII) chain B vs. UniProt/SwissProt
Match: sp|O93484|CO1A2_ONCMY (Collagen alpha-2(I) chain OS=Oncorhynchus mykiss OX=8022 GN=col1a2 PE=2 SV=2)

HSP 1 Score: 157.147 bits (396), Expect = 1.165e-36
Identity = 85/242 (35.12%), Postives = 118/242 (48.76%), Query Frame = 1
Query: 8521 TVRRDLLNDDALAVKYLGSDV--VKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASDVTEYRSWFGE-ITGTFKFDYQIE-------ASQLMFLKLFSTNARQRITINCSRLSVV-----GNSEHPVILYSDHDEEVLRNGD-LFKYSVIRDGCKNSAEIIDSTELEMDTEA-IRLPIRDIA-LNTGSSKEQQQFGLDIGQVCF 9192
            + R      DA  +K L S +  +  P G+K  PARTC+ +  ++P+   GFY+IDPN G   DA +  C      +CI     S   K+W  S   +   WFGE I G  +F Y  E       A+QL F++L +  A Q IT +C           GN +  V+L   +D E+   G+  F ++V+ DGC         T +E  T    RLPI DIA L+ G +   Q+FGLDIG VCF
Sbjct: 1117 SFRAKDYEVDAT-IKSLNSQIENLLTPEGSKKNPARTCRDIRLSHPDWSSGFYWIDPNQGCIADAIKAYCDFSTGHTCIHPHPESIARKNWYRSSENKKHVWFGETINGGTEFAYNDETLSPQSMATQLAFMRLLANQATQNITYHCKNSVAYMDGENGNLKKAVLLQGSNDVELRAEGNSRFTFNVLEDGCTRHTGQWSKTVIEYRTNKPSRLPILDIAPLDIGEA--DQEFGLDIGPVCF 1355          

HSP 2 Score: 105.145 bits (261), Expect = 9.710e-21
Identity = 68/275 (24.73%), Postives = 122/275 (44.36%), Query Frame = -3
Query:  229 DLFQNDQPKTEKISSIDPNDEDEDIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCIEPEVVNYKKTSYTKTISS----WF-------SVLASLNKQISYKIPKEQLVFXXXXXXXXXXXXXXSCDQIALVSDDSITQDIRYN--NSVQLFGDDN------QILTVNNEDDL-------FQYKVVEDTCKDKSNNGRAVIKVEXXXXXXXXXXXLNFKSIE-NSRPAMIGIEIGPVCF 972
            D ++ DQP            +D ++   +  L+S ++NL  P GSK  PAR+C DI+  + + S+G ++IDPN G   DAI  +C+F    TCI P   +  + ++ ++  +    WF       +  A  ++ +S +    QL F                  + L+++ + TQ+I Y+  NSV     +N       +L  +N+ +L       F + V+ED C   +      + +E    +   +  L+   ++        G++IGPVCF
Sbjct: 1109 DEYRADQPSFRA--------KDYEVDATIKSLNSQIENLLTPEGSKKNPARTCRDIRLSHPDWSSGFYWIDPNQGCIADAIKAYCDFSTGHTCIHPHPESIARKNWYRSSENKKHVWFGETINGGTEFAYNDETLSPQSMATQLAF------------------MRLLANQA-TQNITYHCKNSVAYMDGENGNLKKAVLLQGSNDVELRAEGNSRFTFNVLEDGCTRHTGQWSKTV-IEYRTNKPSRLPILDIAPLDIGEADQEFGLDIGPVCF 1355          

HSP 3 Score: 78.1814 bits (191), Expect = 1.519e-12
Identity = 207/509 (40.67%), Postives = 242/509 (47.54%), Query Frame = 1
Query: 5671 GPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGK------------------TXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGR---TGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPL---------------------GERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGR---RGPQGMTGIQGPPGSIGLKGDIGSTGP 7062
            GPTG  G++G  G  G+ G     G  G++G  G  G QGP GAPG +G  G  GP G AG  G QG+ G   +QG PG  G  G  G  GP G  GSQG +G +G  G    PG DG +G PG  G  G AG  GP G+ G+ G                    GN GR G RG  GP G  G  G  G KG+ G  GP+G  GLRG  G  G  G  G PG  GP G  G  GPRG     G KG  G  G AG  G  G  G +G  G PG  G  G  G  G  G  G  G  G  G AG PG+ G   + GP+G                       G++GP G+SG  G PG  GP G  G  G +G PG+ G +GLPG  G  G  G  G  G  G  G AG+ G  G  G +GE G  GN+G  GP G  G AG +G  G PG PG  G +G+       G  GP GS+GR   RG  G TG  GP G++G +G  G  GP
Sbjct:  505 GPTGATGLRGGPGADGNNGA---PGPAGVVGNTGEKGEQGPAGAPGFQGLPGPAGPAGEAGKAGNQGMPG---DQGLPGPAGVKGERGNSGPAGSAGSQGAIGARGPAGT---PGPDGGKGEPGSVGIVGAAGHQGPGGMPGERGAGGTPGPKGEKGEGGHRGLEGNMGRDGARGGPGPSGPPGPSGANGEKGESGSFGPAGPAGLRGPSGERGEGGPAGLPGFAGPPGSDGQSGPRGEKGPAGGKGDVGPAGPAGPSGQSGPSGASGPAGPPGGRGDAGPSGLTGFPGAAGRVGGPGPAGIAGPPGSAGPAGKDGPRGLRGDPGPGGPQGEQGVVGPAGISGDKGPSGESGPPGAPGTAGPQGVLGPSGFVGLPGSRGDKGLPGGPGAVGEPGRLGPAGASGPRGPAGNIGMPGMTGTQGEAGREGNSGNDGPPGRPGAAGFKGDRGEPGSPGALGSSGQ------PGPNGPAGSAGRPGNRGESGPTGNGGPVGAVGARGAPGPAGP 998          

HSP 4 Score: 76.6406 bits (187), Expect = 3.742e-12
Identity = 171/434 (39.40%), Postives = 205/434 (47.24%), Query Frame = 1
Query: 5977 GIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGK---------------DGENGKDAVDGAKGN------------IGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGT---PGVIGP 7188
            G  G+ G  G PG+DG  GAPG       AG+ G +G KG+ G  G PG  G  GP GP G  G  G  G  GD G  GP+G  G RGN G  GS GSQG  GARGP    G+PGP G  G  GS G +G AG  G  G  G+ G  G PG  G  G  G  G  G  G  G  G PGP+G PG  G N + G  G  G  GP                  +GL+GP G  G  G  GLPG  GP G+ G  G +G  G  G  GD G +GP GP G++G  G +G  GP G  G+AG  G+ G PG  G+                G  GKD   G +G+            +GP G SG +GP G +G  G PG+ G +G +G +G +G                    G +GDKGLPG PG    PG +GP
Sbjct:  505 GPTGATGLRGGPGADGNNGAPG------PAGVVGNTGEKGEQGPAGAPGFQGLPGPAGPAGEAGKAGNQGMPGDQGLPGPAGVKGERGNSGPAGSAGSQGAIGARGP---AGTPGPDGGKGEPGSVGIVGAAGHQGPGGMPGERGAGGTPGPKGEKGEGGHRGLEGNMGRDGARGGPGPSGPPGPSGANGEKGESGSFGPAGP------------------AGLRGPSGERGEGGPAGLPGFAGPPGSDGQSGPRGEKGPAGGKGDVGPAGPAGPSGQSGPSGASGPAGPPGGRGDAGPSGLTGFPGAAGRVGGPGPAGIAGPPGSAGPAGKDGPRGLRGDPGPGGPQGEQGVVGPAGISGDKGPSGESGPPGAPGTAGPQGVLGPSGFVGL------------------PGSRGDKGLPGGPGAVGEPGRLGP 893          

HSP 5 Score: 61.6178 bits (148), Expect = 1.453e-7
Identity = 97/279 (34.77%), Postives = 113/279 (40.50%), Query Frame = 1
Query: 6229 GLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPM 7065
            G+ G+ G  G  G  G PG  GPQG+LG   P G  G  GS+G  G+ G PG  G+ G+ G  G                                            GP+GP G  G PG                +G QG  G  GNSG  G PG  G +G KG++G  G    PG  G +G  GP GP G  G  GN GE GP G  G  G  G  GAPG  G  GE G     G +      G  G RG  G+ G+ GP G  G  G  G TGP 
Sbjct:  835 GISGDKGPSGESGPPGAPGTAGPQGVLG---PSGFVGLPGSRGDKGLPGGPGAVGEPGRLGPAGAS------------------------------------------GPRGPAGNIGMPG---------------MTGTQGEAGREGNSGNDGPPGRPGAAGFKGDRGEPG---SPGALGSSGQPGPNGPAGSAGRPGNRGESGPTGNGGPVGAVGARGAPGPAGPRGEKGGAGEKGDR------GMKGLRGHGGLQGMPGPNGPSGETGSAGITGPA 1044          

HSP 6 Score: 60.077 bits (144), Expect = 4.162e-7
Identity = 50/115 (43.48%), Postives = 59/115 (51.30%), Query Frame = 1
Query: 6733 GSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVG---NAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMG 7068
            G  G  G+PG  G  GA GP G  G+ G+ GN G  G  G+ G     G RG  G PG+PG  G  G + +DG KG  G  G+ G  G  G  G  GP GS GL G+ G  GP G
Sbjct:  109 GHAGEPGEPGQTGSIGARGPTGSAGKPGEDGNNGRPGKPGDRGGPGTQGARGFPGTPGLPGMKGHRGYNGLDGRKGESGTAGAKGETGAHGANGSPGPAGSRGLNGERGRAGPAG 223          

HSP 7 Score: 57.3806 bits (137), Expect = 2.933e-6
Identity = 56/143 (39.16%), Postives = 65/143 (45.45%), Query Frame = 1
Query: 6646 LQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRG---------------ENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSI 7029
              G  G PG  GQ G  G+ GP+G+ G  G  G  G+PG  GD G  G QG RG                NG  G  GE G  G  G  G  G NG+PG  G  G NG+      +G  GP G +G RG  G TG  GP G +
Sbjct:  107 FTGHAGEPGEPGQTGSIGARGPTGSAGKPGEDGNNGRPGKPGDRGGPGTQGARGFPGTPGLPGMKGHRGYNGLDGRKGESGTAGAKGETGAHGANGSPGPAGSRGLNGE------RGRAGPAGPAGARGADGSTGPAGPAGPL 243          
BLAST of Collagen alpha-1(XXVII) chain B vs. TrEMBL
Match: A0A4D6FZG6 (Collagen F-4 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=colF-4 PE=2 SV=1)

HSP 1 Score: 318.546 bits (815), Expect = 1.046e-94
Identity = 237/282 (84.04%), Postives = 239/282 (84.75%), Query Frame = 1
Query: 6346 GSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            G  G +G  G+PG PGKDGK G  G PG                                 TPGKNMQPGPQGPLGERGPPGKSGDDGVPGNVGPPGQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRIGVPGIPGKPGIVGPPGPEGFKGDKGLPGNPGTPGVIGPQ
Sbjct:    2 GRPGPVGPIGLPGHPGKDGKPGPAGFPG---------------------------------TPGKNMQPGPQGPLGERGPPGKSGDDGVPGNVGPPGQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRIGVPGIPGKPGIVGPPGPEGFKGDKGLPGNPGTPGVIGPQ 250          

HSP 2 Score: 73.1738 bits (178), Expect = 1.002e-9
Identity = 88/250 (35.20%), Postives = 114/250 (45.60%), Query Frame = 1
Query: 5644 GEPGINGPTGP------TGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDI---GPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIG 6366
            G+ G+ GP GP       G+PG  GP G KG+KG +G  GK GI G  G  GPQGP G  G  G  G  GPVG  G+ G++G++G P                              GI G  G++G    DG +G  G  G  G+ G  G +G++G PG                         +G KGDI   GPMG  G PG+ G PG++G  G +GF G +G  G  G+PG  G  G +G +G  G
Sbjct:   65 GQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAP------------------------------GIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPG------------------------SIGLKGDIGSTGPMGRIGVPGIPGKPGIVGPPGPEGFKGDKGLPGNPGTPGVIGPQGLRGKRGKAG 260          

HSP 3 Score: 65.4698 bits (158), Expect = 3.665e-7
Identity = 90/260 (34.62%), Postives = 114/260 (43.85%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVG 6420
            +G+ G+ G  GP G  G++GP+G  G+ GQRG  G +G  G +GN G +GP G PG  G  G+ GP G  G  G  G +G                                G  G +G  G  G +G  G PG+ G+ GK  +DG  G  G  G +G                       G +G  G  GP GS GL+G+ G  G +G  G PG  G  GI+G PGP G  G KG  G  G  GV G  G  GK G+ G
Sbjct:   52 SGDDGVPGNVGPPGQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGE------------------------------QGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSG---------------------RRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRIGVPGIPGKPGIVGPPGPEGFKGDKGLPGNPGTPGVIGPQGLRGKRGKAG 260          
BLAST of Collagen alpha-1(XXVII) chain B vs. TrEMBL
Match: A0A0R3U1N0 (Fibrillar collagen NC1 domain-containing protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS285 PE=4 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 1.148e-52
Identity = 141/333 (42.34%), Postives = 195/333 (58.56%), Query Frame = 1
Query: 8203 GSPGKPGTIGHPGWMGTVGNPGARGKSXXXXXXXXXXXXXXXXXXXXXXXQGSVGPTGTKGFPGENGSPGPVGMPGRDGPAXXXXXXXXXXXXXXXXXXAVFFPVRTVRRDLLNDDALAVKYLGSDVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASDVTEYRSWFGEITGTFKFDYQIEASQLMFLKLFSTNARQRITINCSRLSVVGNSEHPVILYSDHDEEVLRNGDLFKYSVIRDGCKNSAEIIDSTELEMDTEAIRLPIRDIALNT--GSSKEQQQFGLDIGQVCFS 9195
            G PGK G  GH GWMG  G+ G +G+ G +G PG RG  G  G PGE G QG  GP G  G+ G+ G  G  G  GRDGP G  GPVGN GPPGPPGPPA+ + +       +NDDA   +++G+D + KP G++ +PARTCK L   NP+L DG+Y+IDPN G   DA  V C  Q  E+C+   +  +  K +D + V     WF E+ G   F Y +   QL FLK+ S+ A+Q +T+ C +     +S+    L SD+D    R+G+LF+Y+V+RD CK   +    T +E+ T   RLP+RD++ +   GSSKE    G+ +  VC++
Sbjct:  996 GRPGKAGPTGHKGWMGPPGDSGPKGQRGAKGPPGSRGHQGPTGLPGEQGSQGFEGPVGEVGYQGDQGPTGLPGPAGRDGPQGPAGPVGNQGPPGPPGPPAITYDM------AVNDDAAQAQFIGTDSIDKPDGSRGLPARTCKHLAKVNPHLPDGYYWIDPNSGSIKDAIEVYCHIQTGETCVSPSTEEFDGKTYDQA-VPGEEHWFNELQGGKLFTYNVPGDQLAFLKMLSSKAKQNVTVMCRQ-----SSQDEARLLSDNDRYFSRSGELFRYNVVRDECKFMKDTYGYTVMEVMTRPQRLPVRDVSFSDVGGSSKE---VGVKLSPVCYA 1313          

HSP 2 Score: 109.768 bits (273), Expect = 9.206e-20
Identity = 69/218 (31.65%), Postives = 118/218 (54.13%), Query Frame = -3
Query:  226 VDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCIEPEVVNYKKTSYTKTI---SSWFSVLASLNKQISYKIPKEQLVFXXXXXXXXXXXXXXSCDQIALVSDDSITQDIRYNNSVQLFGDDNQILTVNNEDDLFQYKVVEDTCK-DKSNNGRAVIKVEXXXXXXXXXXXLNFKSIENSRPAMIGIEIGPVCFS 867
             D++ KP GS+  PAR+C  + +   +  +G ++IDPN G  KDAI V+C+    ETC+ P    +   +Y + +     WF+ L    K  +Y +P +QL FL++ S  + Q +T+ C Q +              +  +L  D+++  + + E  LF+Y VV D CK  K   G  V++V + RP+RLP+RD++F  +  S    +G+++ PVC++
Sbjct: 1114 TDSIDKPDGSRGLPARTCKHLAKVNPHLPDGYYWIDPNSGSIKDAIEVYCHIQTGETCVSPSTEEFDGKTYDQAVPGEEHWFNELQG-GKLFTYNVPGDQLAFLKMLSSKAKQNVTVMCRQSS-------------QDEARLLSDNDRYFSRSGE--LFRYNVVRDECKFMKDTYGYTVMEV-MTRPQRLPVRDVSFSDVGGSS-KEVGVKLSPVCYA 1313          

HSP 3 Score: 99.7525 bits (247), Expect = 1.167e-16
Identity = 216/479 (45.09%), Postives = 263/479 (54.91%), Query Frame = 1
Query: 5677 TGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGN---------------PGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMG 7068
            TG  G  GP+G KGDKG     G DG +G RG +GP+GPTG  G RG  G PGP G  G  G+QG  G  G  G PG +GP G  G+ GP G KG  G +G  G +G+ G  G+DG  GAPGE G+ G  G DGP G KG+               +GP G  G  G  G +G  G  G  G+PGLRG+                G +G  G +G PG  G  G  G  GP G +G +G  G+ G  G+PGTPG DG  GQ G+ GK+G PG  G  GP G PG PGK G+ GP G+PG+ G++  PGP+G +GERGP GK G++G PG  G  GQ G  GP GP G  G+RG  G  G +G KG+KGS+GP G  G+ G  GA G +GP G +G+ G+ G  GP G  G  G  G  G  G  G+DG+ G+    G  G  GP G  GR G +G  G QG PG  G KG  G  GP G
Sbjct:  157 TGTQGPAGPMGPKGDKGS---PGADGPMGERGPVGPRGPTGPSGPRGLTGIPGPQGPIGPAGMQGADGTMGPTGPPGPRGPSGSVGMTGPVGLKGDAGEVGPIGPMGEQGEAGADGIPGAPGESGEIGLPGKDGPVGAKGE---------------QGPPGPVGSPGLAGPRGPSGRAGFVGAPGLRGDQGPPGPQGPVGAPGAAGSVGDAGERGRPGRPGDIGKPGLRGPPGPSGERGDIGSPGSPGIPGTPGIDGLPGQPGVAGKDGEPGPMGARGPPGPPGSPGKPGEVGPHGYPGSRGRDGAPGPRGDVGERGPEGKPGEEGSPGPDGLTGQQGPSGPSGPSGPRGERGPQGERGDAGEKGDKGSRGPVGPRGVRGKPGAPGSEGPSGPDGEAGHEGPVGPAGPSGPPGPVGPPGNKGPSGRDGQAGEAGNIGPPGPPGPTGEPGRPGERGEVGPQGYPGLPGAKGPRGKMGPQG 617          

HSP 4 Score: 84.3445 bits (207), Expect = 5.342e-12
Identity = 129/300 (43.00%), Postives = 151/300 (50.33%), Query Frame = 1
Query: 6178 ELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRG------------RTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKG 7041
            E G+KG  GP GP G  G  G+ G  G+ G  G  G  GP+G LG+ GP G            +TG  G QG  G AG PG  GK G  G+ G  G  GP G PGP GP G PG  G  G+ GP G  G PG+    GPQGP GE G PG  G              G  GPIGP G  G RG PG++G  G  G  G +GP G PG AG +G   P G  G+ G  G+ G  GP G+ G  G RG  G PG  G  G  G     G++G  GP+G  G +G QG TG+ GP G  G +G
Sbjct:  796 EDGAKGPTGPTGPIGFRGPAGHAGKDGAKGPVGDAGPDGPKGPLGTAGPLGIDGPPGPQGKPGQTGRTGPQGRQGPAGKPGAQGKAGIKGKQGNEGPAGPAGPPGPPGPAGEPGDVGPMGEGGPQGVQGQPGER---GPQGPQGEAGQPGPDGP------------QGPTGPIGPTGPVGDRGEPGTDGVDGQPGKPGERGPQGYPGRAGFDG---PSGRPGKAGPTGHKGWMGPPGDSGPKGQRGAKGPPGSRGHQGPTGLPGEQGSQGFEGPVGEVGYQGDQGPTGLPGPAGRDGPQG 1077          

HSP 5 Score: 67.781 bits (164), Expect = 5.360e-7
Identity = 66/164 (40.24%), Postives = 74/164 (45.12%), Query Frame = 1
Query: 6697 GSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGP 7188
            G  GP G +G  G +GP G  G AG  G  GPQGP         TG  GP G VG+ G  G +G  G PGK GE G     G  G  GP G  G+ GP G  G  GPPG  G KG  G+ GP G                    G +G  GLPG  G+ G  GP
Sbjct:  915 GEGGPQGVQGQPGERGPQGPQGEAGQPGPDGPQGP---------TGPIGPTGPVGDRGEPGTDGVDGQPGKPGERGPQGYPGRAGFDGPSGRPGKAGPTGHKGWMGPPGDSGPKGQRGAKGPPG------------------SRGHQGPTGLPGEQGSQGFEGP 1051          
BLAST of Collagen alpha-1(XXVII) chain B vs. TrEMBL
Match: A0A0X3PTQ4 (Fibrillar collagen NC1 domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR119418 PE=4 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 2.908e-52
Identity = 144/335 (42.99%), Postives = 205/335 (61.19%), Query Frame = 1
Query: 8194 GRPGSPGKPGTIGHPGWMGTVGNPGARGKSXXXXXXXXXXXXXXXXXXXXXXXQGSVGPTGTKGFPGENGSPGPVGMPGRDGPAXXXXXXXXXXXXXXXXXXAVFFPVRTVRRDLLNDDALAVKYLGSDVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHW-DASDVTEYRSWFGEITGTFKFDYQIEASQLMFLKLFSTNARQRITINCSRLSVVGNSEHPVILYSDHDEEVLRNGDLFKYSVIRDGCKNSAEIIDSTELEMDTEAIRLPIRDIALNTGSSKEQQQFGLDIGQVCFS 9195
            G PG PGKPG+ GH GWMG  G  G +G+ G++G  G RG +G  G PG  G  G VG  G  GF GE G+ GP G  GRDGP G PGP+GN GPPGPPGPPA+ + +R      ++DDA   KY+G+D ++ P G++ +PAR+C+ L    P+L DG+Y+IDPN G   DA +V C+    E+CI +++   + + +  A+   EY  WF  +TG+ +FDY+I   QL FLKL S  A+Q+IT+ C + SV     +  +L +D+D      G LF+Y V+RD C+   +   ST L++ + A RLP+RDI+       E ++ G+ +G VCF+
Sbjct:  991 GAPGRPGKPGSAGHKGWMGPPGEQGPKGQRGMQGPAGPRGYDGPTGLPGGRGPIGFVGQVGEIGFQGEQGAAGPPGPAGRDGPQGNPGPMGNHGPPGPPGPPAITYDMR------MSDDADQAKYIGTDSIELPDGSRGLPARSCRHLARVKPHLDDGYYWIDPNAGSIKDAIQVYCKIATGETCIGAQTAEIETQPFSSATSGVEY--WFTALTGSSRFDYEIPGDQLSFLKLLSAKAKQKITVTCRQSSVTEYGSYSRLL-ADNDLFFSAEGPLFRYKVLRDDCQYKKDSYGSTVLQVSSRAHRLPVRDISFAD-IGGEDREVGVSLGPVCFA 1315          

HSP 2 Score: 116.316 bits (290), Expect = 1.061e-21
Identity = 77/218 (35.32%), Postives = 120/218 (55.05%), Query Frame = -3
Query:  226 VDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCI---EPEVVNYKKTSYTKTISSWFSVLASLNKQISYKIPKEQLVFXXXXXXXXXXXXXXSCDQIALVSDDSITQDIRYNNSVQLFGDDNQILTVNNEDDLFQYKVVEDTCKDKSNN-GRAVIKVEXXXXXXXXXXXLNFKSIENSRPAMIGIEIGPVCFS 867
             D++  P GS+  PARSC  + R   +  +G ++IDPN G  KDAI V+C     ETCI     E+     +S T  +  WF+ L   + +  Y+IP +QL FL+L S  + Q +T++C Q       S+T+   Y +  +L  D++  L  + E  LF+YKV+ D C+ K ++ G  V++V   R  RLP+RD++F  I       +G+ +GPVCF+
Sbjct: 1112 TDSIELPDGSRGLPARSCRHLARVKPHLDDGYYWIDPNAGSIKDAIQVYCKIATGETCIGAQTAEIETQPFSSATSGVEYWFTALTG-SSRFDYEIPGDQLSFLKLLSAKAKQKITVTCRQ------SSVTE---YGSYSRLLADND--LFFSAEGPLFRYKVLRDDCQYKKDSYGSTVLQVS-SRAHRLPVRDISFADI-GGEDREVGVSLGPVCFA 1315          

HSP 3 Score: 103.219 bits (256), Expect = 9.619e-18
Identity = 220/481 (45.74%), Postives = 257/481 (53.43%), Query Frame = 1
Query: 5680 GVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQR---GLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTG---------------------EQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMT---GIQGPPGSIGLKG 7041
            G  G +GP G  G KG++G  G DG+ G RG++G +G  G  G RG VG PG  G  G PG+QG+ G  G  G PG +GPPG  G+ G  G KG  G LG  GS G  G  G DG  G  GE G+ G  G DGP G KG+ G  G  G +G  GPRG  G+ G  G  GSKG  GP GP GS G  G  G +G  G +G PG  G  G  G  GP G +G +G  G+ G  GVPGTPG DG  G  G PGK+G PG  G  GP G  G PGK G+ GP G+ G+ G++  PGP+G +GERGP GK G+DG  G+ G  G  G  GP GP G  G+R   G PG  G  G KG +GS GP G  G +G  GA GP GP GE G  G TG                       G  GE GN G  G  G PG  G  GE G+    G  G  G  G  G+ GP+G T   G+QG PGS GL G
Sbjct:  153 GATGNQGPAGPIGPKGEKGSPGIDGLAGERGDIGVRGSIGPSGPRGLVGLPGAQGPPGPPGMQGLDGHAGAMGPPGPRGPPGTLGMIGAVGLKGDVGELGAAGSTGDPGEAGPDGSPGVHGEPGEMGTPGKDGPVGRKGEQGAIGPMGPAGMPGPRGVMGSAGSQGAAGSKGSQGPPGPQGSVGPPGYTGPVGDAGERGPPGPDGDIGKQGLRGPPGPSGERGDVGSPGAPGVPGTPGLDGPTGMSGAPGKDGEPGPTGIRGPPGPQGPPGKAGEVGPRGYTGSRGRDGSPGPRGEVGERGPAGKPGEDGAAGSDGLAGPQGPAGPSGPAGIRGERGPSGEPGEMGEKGKKGTRGSAGPRGPRGKSGSAGAEGPVGPAGEKGPDGPTGTIGYPGAIGPPGPPGSKGPDGRDGQAGEAGNIGPPGPAGPPGEVGPKGEQGEAGPQGYAGLAGAKGEPGKMGPRGNTGQMGVQGVPGSRGLPG 633          

HSP 4 Score: 91.6633 bits (226), Expect = 3.207e-14
Identity = 212/546 (38.83%), Postives = 264/546 (48.35%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGV---------PGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGY---PGSDGKR---GAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDG---------------ENGKDAVDGAKGNIGPIGSSGRRGP----QGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPG 7176
            TG+PG  GP G  GV         PG  GP+G KG++G  G MG  G+ GPRG +G  G  GA G +G+ G PGP G+ G PG  G  G                        + G +G  G  G IG+ G    PG  G+R   G+PG  G PG  G+DGP+G+ G PGK G PG +G RGP GP+G  G  GE+G +G  G  G  GSPG RG  G  G  G  G  GA G  G+ G  GP G +G  G +G  G +G PG  G+ GK G  G  G  GP G+                            G     GP GP GE+GP G +G  G PG +GPPG  G +GP G  G +G+ G  G  GP+G  G  G KG  G+   AG  G +G  G +GE G +      GP G  G  G++GV G+ G+PG  G               E+GKD   G  G  GP G++  + P    +G  G +G PG  G  G +G TGP G +G  G PG  G  GP GPEG +G  G+ G PG PG
Sbjct:  257 TGDPGEAGPDGSPGVHGEPGEMGTPGKDGPVGRKGEQGAIGPMGPAGMPGPRGVMGSAGSQGAAGSKGSQGPPGPQGSVGPPGYTGPVG------------------------DAGERGPPGPDGDIGKQGLRGPPGPSGERGDVGSPGAPGVPGTPGLDGPTGMSGAPGKDGEPGPTGIRGPPGPQGPPGKAGEVGPRGYTGSRGRDGSPGPRGEVGERGPAGKPGEDGAAGSDGLAGPQGPAGPSGPAGIRGERGPSGEPGEMGEKGKKGTRGSAGPRGPRGKS---------------------------GSAGAEGPVGPAGEKGPDGPTGTIGYPGAIGPPGPPGSKGPDGRDGQAGEAGNIGPPGPAGPPGEVGPKGEQGE---AGPQGYAGLAGAKGEPGKM------GPRGNTGQMGVQGVPGSRGLPGFRGKKGPTGNPGPDGPPGEDGKDGEPGIAGEQGPRGATVVQAPLASLRGAPGPKGEPGYAGSPGPVGITGPPGEMGAAGPPGADGEDGPEGPEGPQGRDGVDGVPGRPG 742          

HSP 5 Score: 88.9669 bits (219), Expect = 2.014e-13
Identity = 178/491 (36.25%), Postives = 219/491 (44.60%), Query Frame = 1
Query: 5707 GVKGDKGQRGRMGKDGILGPRGNLGPQGPT---------GAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIG------------------------QDGYP------------------GSDGKRGAPGEHG------DPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXX---XXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGM 6999
            G  G  G+ GR GKDG+ G +G  GP GP          GA G +G  G  GP G  G PG+ G++G                            +G +G++GSIG                         DG+                   G+ G +G  GE G      DPG+AG DG  GV G+PG+             G  G  G +G  G +G IGPMGP+G PG R   GV+GS GSQG  G++G Q   G PGP+G  G  G  G +G AG  G PG DG  G+ G+                   G PG  G+ G  G PG PG    PG  GP G  G PGK G+    G+ G  GP G  G  G +GP G +G RG  GS GP G  G +G  G  G+ G AG +G +GPQGP G +G  G  GE+GP GE G  G +G  G  G  G  G  GK    GA+G +GP G  G  GP G 
Sbjct:  114 GSPGPAGEPGRDGKDGVDGGQGPPGPPGPPGPPGQMGIIGATGNQGPAGPIGPKGEKGSPGIDGLAGE---------------------------RGDIGVRGSIGPSGPRGLVGLPGAQGPPGPPGMQGLDGHAGAMGPPGPRGPPGTLGMIGAVGLKGDVGELGAAGSTGDPGEAGPDGSPGVHGEPGEM------------GTPGKDGPVGRKGEQGAIGPMGPAGMPGPR---GVMGSAGSQGAAGSKGSQ---GPPGPQGSVGPPGYTGPVGDAGERGPPGPDGDIGKQGL------------------RGPPGPSGERGDVGSPGAPGVPGTPGLDGPTGMSGAPGKDGEPGPTGIRGPPGPQGPPGKAGEVGPRGYTGSRGRDGSPGPRGEVGERGPAGKPGEDGAAGSDGLAGPQGPAGPSGPAGIRGERGPSGEPGEMGEKGKKGTRGSAGPRGPRGKSGSAGAEGPVGPAGEKGPDGPTGT 541          

HSP 6 Score: 64.6994 bits (156), Expect = 5.480e-6
Identity = 181/499 (36.27%), Postives = 203/499 (40.68%), Query Frame = 1
Query: 5779 GPQGPTGAPGRR------------------GTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKG---------------DPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPM------------GPSGSPGLRGNPGVIGS------LGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQ------------------GPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMG 7068
            G  GP G PG +                  GT GSPGP G  G  G  G+       G  G  GPPG PG  G  G  G+ G  G  G IG  G  GS G  G  GE GD G  G  GPSG +G                 G  G+ G  G  GPRGP G  G+IG +G KGD+G +            GP GSPG+ G PG +G+      +G +G  GA GP G  G PGPRG  GS GSQG  G  G  G PG  G  G  G                                            GP G  GERGPPG              G  G QG  GPPG SG+RG  GS G  G  G  G  GP G  G  G +G  GP                   GPRG  G  G  G  GP GEVG        G  G PG+DG  G D + G +G  GP G +G RG +G +G  G  G  G KG  GS GP G
Sbjct:   81 GEVGPPGPPGPQGPTGPAGPMGPPGPAGTDGTRGSPGPAGEPGRDGKDGVD------GGQGPPGPPGPPGPPGQMGIIGATGNQGPAGPIGPKGEKGSPGIDGLAGERGDIGVRGSIGPSGPRGLVGLPGAQGPPGPPGMQGLDGHAGAMGPPGPRGPPGTLGMIGAVGLKGDVGELGAAGSTGDPGEAGPDGSPGVHGEPGEMGTPGKDGPVGRKGEQGAIGPMGPAGMPGPRGVMGSAGSQGAAGSKGSQGPPGPQGSVGPPGYT------------------------------------------GPVGDAGERGPPGPD------------GDIGKQGLRGPPGPSGERGDVGSPGAPGVPGTPGLDGPTGMSGAPGKDGEPGPTGIRGPPGPQGPPGKAGEVGPRGYTGSRGRDGSPGPRGEVGE------RGPAGKPGEDGAAGSDGLAGPQGPAGPSGPAGIRGERGPSGEPGEMGEKGKKGTRGSAGPRG 513          
BLAST of Collagen alpha-1(XXVII) chain B vs. TrEMBL
Match: A0A0R3TPT3 (Fibrillar collagen NC1 domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS9498 PE=4 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 1.142e-51
Identity = 148/337 (43.92%), Postives = 207/337 (61.42%), Query Frame = 1
Query: 8194 GRPGSPGKPGTIGHPGWMGTVGNPGARGKSXXXXXXXXXXXXXXXXXXXXXXXQGSVGPTGTKGFPGENGSPGPVGMPGRDGPAXXXXXXXXXXXXXXXXXXAVFFPVRTVRRDLLNDDALAVKYLGSDVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHW-DASDVTEYRSWFGEITGTFKFDYQIEASQLMFLKLFSTNARQRITINCSRLSVVGNSEHPVILYSDHDEEVLRNGDLFKYSVIRDGCKNSAEIIDSTELEMDTEAIRLPIRDIALNT--GSSKEQQQFGLDIGQVCFS 9195
            G PG  GKPG IGH GWMG  G+PG +G+ G +G  G RG  G +G PGE G QG  GP G  G+ GE G  G  G PGRDGP G  GP+GN GPPGPPGPPAV + +        NDDA   +++G+D + KP G++ +PARTCK L   NP+L DG+Y+IDPN G   DA  V C  Q  E+C++ K+  ++ K + D S   E+  WF ++ G+  FDY +   QL FLKL S+ A+Q +T+ C +     +S+    L SD+D+   RNG+LF+Y+V+RD C++  +   +T LE+ +   RLP+RDI+     G++KE    G+ +  VC++
Sbjct: 1030 GLPGRAGKPGPIGHKGWMGPPGDPGPKGQRGSKGPTGPRGHQGPSGLPGEQGPQGLEGPMGEMGYQGEQGPSGLPGPPGRDGPQGPSGPIGNQGPPGPPGPPAVTYDM------AFNDDAAQAQFIGTDSIDKPDGSRKLPARTCKHLAHVNPHLPDGYYWIDPNAGSIKDAIEVYCHIQTGETCVKPKTDDFETKSYQDVSAGEEH--WFHDLQGSKLFDYNVPGDQLSFLKLLSSKAKQNVTVVCRQ-----SSQDEARLMSDNDQYFSRNGELFRYNVLRDECQHLKDSYGNTVLEVVSRPQRLPVRDISFRDVGGATKE---VGVRLSPVCYA 1350          

HSP 2 Score: 111.309 bits (277), Expect = 3.287e-20
Identity = 70/218 (32.11%), Postives = 120/218 (55.05%), Query Frame = -3
Query:  226 VDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCIEPEVVNYKKTSYTKTIS---SWFSVLASLNKQISYKIPKEQLVFXXXXXXXXXXXXXXSCDQIALVSDDSITQDIRYNNSVQLFGDDNQILTVNNEDDLFQYKVVEDTCKD-KSNNGRAVIKVEXXXXXXXXXXXLNFKSIENSRPAMIGIEIGPVCFS 867
             D++ KP GS+  PAR+C  +     +  +G ++IDPN G  KDAI V+C+    ETC++P+  +++  SY    +    WF  L   +K   Y +P +QL FL+L S  + Q +T+ C Q +              +  +L  D++Q  + N E  LF+Y V+ D C+  K + G  V++V + RP+RLP+RD++F+ +  +    +G+ + PVC++
Sbjct: 1151 TDSIDKPDGSRKLPARTCKHLAHVNPHLPDGYYWIDPNAGSIKDAIEVYCHIQTGETCVKPKTDDFETKSYQDVSAGEEHWFHDLQG-SKLFDYNVPGDQLSFLKLLSSKAKQNVTVVCRQSS-------------QDEARLMSDNDQYFSRNGE--LFRYNVLRDECQHLKDSYGNTVLEV-VSRPQRLPVRDISFRDVGGAT-KEVGVRLSPVCYA 1350          

HSP 3 Score: 78.9518 bits (193), Expect = 2.179e-10
Identity = 189/486 (38.89%), Postives = 223/486 (45.88%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGV----------------KGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQG---PLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGD 7044
            G PG +G TGP G+ G +GP G                 KGD G  G  G  G +GP G+ GPQGP GA G  G  G  GP G  G  G  G  G+ G  G  G  G PG  G  G +G  G +G  G  G+ G+ G PG+DG   APGE G  G  G  GP G +G  G +G  G                    G  GD+GP GP GS G  G       +G+ G PGA   QG+ G PG   RTG +G QG  G AG  G PG  GK G                    G  G  G  G PGPAG  G PG   + GPQG   P GERGP G  GD G  G  G     G  GP+GP G  G RG PG +GP G  G  G +GP G PG AG NG              G  G+ GP+G       +G  G PG PG  G+ G     G +G+ GP G  G +GPQ   G++GP G +G +G+
Sbjct:  687 GPPGRDGKTGPAGIQGEEGPQGATVVQTYGHTRTGPSGPKGDMGYSGAPGPAGQVGPPGDTGPQGPPGANGEDGPPGPEGPRGRDGMDGAPGRPGKRGAPGPRGADGLPGPDGPPGDDGPMGPRGQDGAMGASGERGPPGADG---APGEDGPKGPTGPAGPIGFRGPAGSSGKDGAK------------------GPTGDVGPDGPKGSSGPSG------PVGNDGPPGA---QGVQGQPG---RTGPQGRQGPAGKAGAQGKPGIKGKQGN------------------EGPQGPSGPQGPPGPAGEVGEPGLTGEVGPQGVQGPPGERGPQGPEGDAGETGPDGA---QGATGPMGPTGPVGDRGEPGEDGPDGKPGKPGEQGPRGYPGRAGMNGLP------------GRAGKPGPIGH------KGWMGPPGDPGPKGQRGSKGPTGPRGHQGPSGLPGEQGPQ---GLEGPMGEMGYQGE 1097          

HSP 4 Score: 77.7962 bits (190), Expect = 5.693e-10
Identity = 189/517 (36.56%), Postives = 225/517 (43.52%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKG---PLGVK---------------GDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGS------------PGLRGNPGVIGSLGSQGFPGARGPQGILGSPG------------PRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMG 7068
            G PGI+GP G  G  G  G   P+G +               G +G  G  G+DG  GPRG++G +GP G PG  G   SPGP G  G  G  G SG                          G +G  G  G  G+ G  G  G RG  G  G+ GK G  GP G  G  G+ G  G  G  G  GP G  G  G  G  G  G  G SG+            PG +G  G +G  G  G PG +GP+G +G PG             RG  G +G +G  G  G  G PG+DGK G  GI G+ GP G             P              PG   Q GP G  G +GPPG +G+DG PG  GP G+ G+ G  G PG  G  G  G++G  G  G  G  GP G  G  G  GASG +GP G +G  G  G +GP G  G  G RG  G+ G  G  G  G    DG KG+ GP G  G  GP G  G+QG PG  G +G  G  G  G
Sbjct:  426 GTPGIDGPPGQPGAAGKDGEPGPMGARGPPGPAGSPGKPGEAGPRGYPGSPGRDGASGPRGDVGERGPDGKPGEEG---SPGPDGLTGQQGPTGPSG------------------------PSGPRGERGPTGEAGEAGAKGEKGSRGPAGPRGNRGKVGQAGPEGPTGADGEAGPEGPPGPAGSAGPPGPVGPPGNKGPAGRDGQAGESGNVGPPGPPGPSGPPGAQGERGEVGPQGYPGQPGTKGPRGKMGPPGSNGPAGPPGAPGARGMPGPRGRKGPAGNPGKEGPPGRDGKTGPAGIQGEEGPQGATVVQTYGHTRTGPSGPKGDMGYSG--APGPAGQVGPPGDTGPQGPPGANGEDGPPGPEGPRGRDGMDGAPGRPGKRGAPGPRGADGLPGPDGPPGDDGPMGPRGQDGAMGASGERGPPGADGAPGEDGPKGPTGPAGPIGFRGPAGSSGKDGAKGPTGDVGPDGPKGSSGPSGPVGNDGPPGAQGVQGQPGRTGPQGRQGPAGKAG 913          

HSP 5 Score: 72.0182 bits (175), Expect = 2.811e-8
Identity = 186/464 (40.09%), Postives = 222/464 (47.84%), Query Frame = 1
Query: 5968 GGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGV---IGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPR---------------------------------------GENGDL---------------GNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGP 7188
            G  G +G +G+ G  G+DG  GAPG  G+ G  G DG  G +G+ G  G  G  G  GPRGP G  G  G  G +GD GP GP G  G  G  G     G  G  G PG  G QG+ G PGP   TG +G  G  G  G+PGTPG DG  GQ G  GK+G PG  G  GP G  G PGK G+ GP G+PG+PG++   GP+G +GERGP GK G++G PG  G  GQ G  GP GP G  G+RG  G  G +G KG KGS+GP G  G  G  G +GP+GP                                        GE+G++               G  GE GP G  G  G +G  G  G PG +G  G     GA+G  GP    GR+GP G  G +GPPG  G  G  G  G  G         +       GP G KGD G  G PG  G +GP
Sbjct:  288 GDTGPQGPMGESGEAGADGAPGAPGVAGEMGPPGKDGAVGARGEQGPVGPVGPPGPAGPRGPPGRAGFPGSQGHRGDQGPPGPQGPSGPPGPAGSSGDAGERGRVGRPGDAGKQGLRGPPGP---TGERGDIGAPGAPGMPGTPGIDGPPGQPGAAGKDGEPGPMGARGPPGPAGSPGKPGEAGPRGYPGSPGRDGASGPRGDVGERGPDGKPGEEGSPGPDGLTGQQGPTGPSGPSGPRGERGPTGEAGEAGAKGEKGSRGPAGPRGNRGKVGQAGPEGPTGADGEAGPEGPPGPAGSAGPPGPVGPPGNKGPAGRDGQAGESGNVGPPGPPGPSGPPGAQGERGEVGPQGYPGQPGTKGPRGKMGPPGSNGPAGPPGAPGARGMPGP---RGRKGPAGNPGKEGPPGRDGKTGPAGIQGEEG--PQGATVVQTYGHTRTGPSGPKGDMGYSGAPGPAGQVGP 743          

HSP 6 Score: 69.3218 bits (168), Expect = 2.086e-7
Identity = 218/554 (39.35%), Postives = 251/554 (45.31%), Query Frame = 1
Query: 5662 GPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPG------------------SDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQG--ILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTG------------------------IQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            G  GP G PG +G  G  G  GQ+G  G  G  GPRG  GP G  G  G +G  GS GP G  G+ G  G +G  G  G  G  GP G PG  G  G  G  G  G KG  G+DG  G                  + G+RG  G  G PG+ G  GP G  G PG  G  G  G  G              G  G  G  GP+G+PG  G PG  G  G  G  G  GPQG  ++ + G   RTG  G +G +G +G PG       AGQVG PG  GP G PG  G  G PG  G  G+ G  G PG PGK   PGP+G  G  GP G  GDDG  G  G  G  G  G  GPPG  G  G  G  GP+G  G  G +GP G    +G +GA GP G  G +G  G++G  GPVG  G  G +GV G PG  G  G  G     GA+G  G  G  G  GPQG +G                        +QGPPG  G +G  G  G  G  G  G  G  G  GP G  G  G+ G  G PG PG  GP+
Sbjct:  489 GERGPDGKPGEEGSPGPDGLTGQQGPTGPSGPSGPRGERGPTGEAGEAGAKGEKGSRGPAGPRGNRGKVGQAGPEGPTGADGEAGPEGPPGPAGSAGPPGPVGPPGNKGPAGRDGQAGESGNVGPPGPPGPSGPPGAQGERGEVGPQGYPGQPGTKGPRGKMGPPGSNGPAGPPGAPG------------ARGMPGPRGRKGPAGNPGKEGPPGRDGKTGPAGIQGEEGPQGATVVQTYG-HTRTGPSGPKGDMGYSGAPGP------AGQVGPPGDTGPQGPPGANGEDGPPGPEGPRGRDGMDGAPGRPGKRGAPGPRGADGLPGPDGPPGDDGPMGPRGQDGAMGASGERGPPGADGAPGEDGPKGPTGPAGPIGFRGPAGS---SGKDGAKGPTGDVGPDGPKGSSGPSGPVGNDGPPGAQGVQGQPGRTGPQGRQGPAGKAGAQGKPGIKGKQGNEGPQGPSGPQGPPGPAGEVGEPGLTGEVGPQGVQGPPGERGPQGPEGDAGETGPDGAQGATGPMGPTGPVGDRGEPGEDGPDGKPGKPGEQGPR 1020          
BLAST of Collagen alpha-1(XXVII) chain B vs. TrEMBL
Match: A0A0R3W9W4 (Fibrillar collagen NC1 domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS7281 PE=4 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 2.824e-51
Identity = 147/337 (43.62%), Postives = 201/337 (59.64%), Query Frame = 1
Query: 8194 GRPGSPGKPGTIGHPGWMGTVGNPGARGKSXXXXXXXXXXXXXXXXXXXXXXXQGSVGPTGTKGFPGENGSPGPVGMPGRDGPAXXXXXXXXXXXXXXXXXXAVFFPVRT--VRRDLLNDDALAV-KYLGSDVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASDVTEYRSWFGEITGTFKFDYQIEASQLMFLKLFSTNARQRITINCSRLSVVGNSEHPVILYSDHDEEVLRNGDLFKYSVIRDGCKNSAEIIDSTELEMDTEAIRLPIRDIALNTGSSKEQQQFGLDIGQVCFS 9195
            G PG  G PG  GHPGWMG  G PG +G  G RGD G+ GP GN GP GE G+ G  G TG KG  G+ G PGP G  GRDGP G PGP+G  GPPGPPGPPAV  P+ T   + +++  DA AV +  G + V  PLGT+D+PA TC+ L +++PNLQDGFY++DPNGG  +DA  V C  + KE+CI++    Y +     S  TE  +W GE+       Y++E +QL+ LK  S  A Q +T++CS+          + LYSD++ E+  NG   K+SV  + C+N++ +     L++    +RLP+RD+A     +K      + +GQVCF 
Sbjct:  897 GSPGPDGLPGPQGHPGWMGPPGLPGEQGDDGPRGDTGEEGPEGNPGPAGETGLIGPRGKTGVKGPRGDPGLPGPQGPTGRDGPRGPPGPMGPPGPPGPPGPPAVKMPMMTSPTKGNIMYSDAAAVAQVFGVESVSVPLGTRDVPALTCRDLAESHPNLQDGFYWVDPNGGGPEDAVHVYCNFRTKETCIDADQTVYSVSAEKRS-ATEDFTWLGEVANYGNLLYKVEGTQLVMLKARSLGAHQTLTVSCSKD---------LKLYSDNEIELTSNGVHAKFSVASNTCQNNSGLPKEVVLDVYGPPLRLPVRDVAFTEAEAK----MNVQLGQVCFQ 1219          

HSP 2 Score: 105.916 bits (263), Expect = 1.539e-18
Identity = 199/542 (36.72%), Postives = 235/542 (43.36%), Query Frame = 1
Query: 5653 GINGPTGPTGVPGMKGPLGVK---------------------GDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGS---------------------KGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGK-------------SXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKG---NKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPG---------------------KDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKG 7041
            G +GP GPTGV G++G  G K                     G  G  GR G  G  GPRG  GP GP G+ G+ G +G PGP G                    G  GP G  G RGP G+ G  G  G  G  G  G  GS G  G  GEHG PG  G  GP G +GD G TG                       G +G+ GP GP G PGL+G  G  G +G  G  G RGP+G  G PG  G+ G                      +G  G  G AG PG PG  G AG +G  G  G  G PG  G  G  G  G  G  G  G  G PGK+ + GP+GP G  GPPG               G+ G  G+ GP G++G+QG  G PG SG  G PG  GP G KG   N G  GP G PG+ G  G SG  GP G+ G  G  G  G  G  G +G+RG+ G  G PG                     +DG  G++   G +G  G  G  G +GPQG  G  GP GS G++G
Sbjct:  260 GPSGPMGPTGVRGLRGRAGQKGAMGPPGAPGAPGAPGSDGRPGQPGASGRQGPRGRTGPRGEAGPAGPDGSDGKAGPIGHPGPDGKE------------------GAPGPQGPQGPRGPPGKPGEDGAPGRPGVSGPAGEQGSRGPPGPQGEHGAPGPNGAVGPKGDRGDKGHTGP---------------------AGIQGETGPAGPRGRPGLQGPKGGQGPMGPDGPAGPRGPRGPSGEPGDDGKEGEPGKDAEDGPPGPRGRPGPAGDRGEAGPAGPAGTPGEPGAKGDAGPMGPMGVMGAAGLPGAPGEDGAQGPQGYKGDRGRQGARGLPGKHGEAGPRGPSGREGPPGYLRIMGRSIGVSGPPGEAGDVGSAGPKGRAGMQGVQGQPGPSGIPGAPGKRGPQGPKGPDGNPGRDGPSGTPGLPGPAGHSGASGPAGQPGPRGKPGRPGSPGFDGLSGLRGMTGPSGKPGATGRVGEPGDKGPPGPVGPAGRDGAPGREGAQGDQGATGEPGPMGDKGPQGGVGRDGPMGSQGMRG 762          

HSP 3 Score: 102.064 bits (253), Expect = 1.889e-17
Identity = 58/215 (26.98%), Postives = 107/215 (49.77%), Query Frame = -3
Query:  229 VDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCIEPEVVNYKKTSYTKTISSWFSVLASLNK--QISYKIPKEQLVFXXXXXXXXXXXXXXSCDQIALVSDDSITQDIRYNNSVQLFGDDNQILTVNNEDDLFQYKVVEDTCKDKSNNGRAVIKVEXXXXXXXXXXXLNFKSIENSRPAMIGIEIGPVCF 867
            V+++  P G++  PA +C D+   + N  +G +++DPNGG  +DA+HV+CNF   ETCI+ +   Y  ++  ++ +  F+ L  +     + YK+   QLV                    +L +  ++T  +  +  ++L+ D+   LT N      ++ V  +TC++ S   + V+      P RLP+RD+ F   E    A + +++G VCF
Sbjct: 1027 VESVSVPLGTRDVPALTCRDLAESHPNLQDGFYWVDPNGGGPEDAVHVYCNFRTKETCIDADQTVYSVSAEKRSATEDFTWLGEVANYGNLLYKVEGTQLVM---------------LKARSLGAHQTLT--VSCSKDLKLYSDNEIELTSNGVH--AKFSVASNTCQNNSGLPKEVVLDVYGPPLRLPVRDVAFTEAE----AKMNVQLGQVCF 1218          

HSP 4 Score: 92.8189 bits (229), Expect = 1.550e-14
Identity = 197/616 (31.98%), Postives = 229/616 (37.18%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHG---------------DPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSG---SPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQG-------------TIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIA------------------------GDNGASGPQGPRGENGDLGNTGEQGPVGE---VGNAGIRGVN------------------------------------------GAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGP 7188
             GE G  GP GP G  G  GP G  G KG RG  G  G  G +G  GP GP G PG +G  G  GP+G                                         G  G +G  G  G PG DGK G PG+                 D G+AG  GP+G  G+PG                           +KGD GPMGP G   + GL G PG  G+ G QG+ G RG QG  G PG  G  G +G  G             +IG++G PG  G  G AG  G                       G  G  G  G  G PG   + GPQGP G  G PG+ G  G PG  GP G SG  GP G PG  G+ G PGS G  G  G +G  GP GKPG                          G  GA G QG  GE G +G+ G QG VG    +G+ G+RG N                                          G  G  G  G +G D  DG  G  G  G  G RGP+G  G+ GP   IGL+G +G  G  G                    G +G  G PG PG  G +GP
Sbjct:  379 AGEQGSRGPPGPQGEHGAPGPNGAVGPKGDRGDKGHTGPAGIQGETGPAGPRGRPGLQGPKGGQGPMG---------------------------------------PDGPAGPRGPRGPSGEPGDDGKEGEPGKDAEDGPPGPRGRPGPAGDRGEAGPAGPAGTPGEPG---------------------------AKGDAGPMGPMGVMGAAGLPGAPGEDGAQGPQGYKGDRGRQGARGLPGKHGEAGPRGPSGREGPPGYLRIMGRSIGVSGPPGEAGDVGSAGPKG---------------------RAGMQGVQGQPGPSGIPGAPGKRGPQGPKGPDGNPGRDGPSGTPGLPGPAGHSGASGPAGQPGPRGKPGRPGSPGFDGLSGLRGMTGPSGKPGATGRVGEPGDKGPPGPVGPAGRDGAPGREGAQGDQGATGEPGPMGDKGPQGGVGRDGPMGSQGMRGANGGPGAQGPPGPEGLPGPQGPQGPTGDQGPPGPPGPQGRKGPVGEEGPEGPIGLDGPDGPDGPAGETGDAGVPGFRGPRGARGLTGP---IGLEGPVGLPGRQG------------------APGARGRAGKPGAPGAQGEVGP 886          

HSP 5 Score: 86.2705 bits (212), Expect = 1.552e-12
Identity = 195/385 (50.65%), Postives = 221/385 (57.40%), Query Frame = 1
Query: 6031 GAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIG 7185
            GAPG  G PG+ G  GP   KG+PG  G  G  G +GPRG  G  G  GE G KG +G  GP GSPG  G+ G  G +G +G  G  GP G  G  G RGR G KG+ G  G  G PG PG DG+ GQ G  G+ GP GR GP G  G  G  G DGK GP G PG  GK   PGPQGP G RGPPGK G+DG PG  G  G +G QG  GPPG  G+ G PG NG  G KG++G KG  G  GI G+ G +GP+G  G  G  G  G  GP G  G  G RG +G PG  GK+GE GKDA DG  G  G  G +G RG  G  G  G PG  G KGD G  GPMG +G  G+PG PG  G  GP+G+KGD+G  G  G PG  G
Sbjct:  179 GAPGIQGLPGRDGAQGP---KGEPGLRGLAGPPGPQGPRGVSGPAGATGEAGQKGPVGIPGPVGSPGPAGHQGHPGPIGPRGPTGPSGPMGPTGVRGLRGRAGQKGAMGPPGAPGAPGAPGSDGRPGQPGASGRQGPRGRTGPRGEAGPAGPDGSDGKAGPIGHPGPDGKEGAPGPQGPQGPRGPPGKPGEDGAPGRPGVSGPAGEQGSRGPPGPQGEHGAPGPNGAVGPKGDRGDKGHTGPAGIQGETGPAGPRGRPGLQGPKGGQGPMGPDGPAGPRGPRGPSGEPGDDGKEGEPGKDAEDGPPGPRGRPGPAGDRGEAGPAGPAGTPGEPGAKGDAGPMGPMGVMGAAGLPGAPGEDGAQGPQGYKGDRGRQGARGLPGKHG 560          

HSP 6 Score: 85.5001 bits (210), Expect = 2.307e-12
Identity = 199/499 (39.88%), Postives = 232/499 (46.49%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKG------PLGVKGDKGQRGRMGKDGILGP---RGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSL------------------GSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
            GE G  GP G  G PG KG      P+GV G  G  G  G+DG  GP   +G+ G QG  G PG+ G  G  GP G  G PG   I GR      P  +                  G  G++G  G  G PG+ GKRG  G  G  G  G DGPSG  G PG  G+ G SG  G  GPRG  G     GS G  G  G  G  G  G PG  G +                  G+ G  GA+G QG  G PGP    G KG QG +G  G  G+ G  G  G  G  G  GP G PGP GP G  G  G  G PGP G  G  G+    GP+GP+G  GP G  G  G  G+ G     G +GP G  G +G  GL G  G  G +G  G++G  GKPG  G  G  GP G  G +G  G+ G  G  G  G+ G  G  G PG  G DG  G    +G +GN GP G +G  GP+G TG++GP G  GL G  G TG
Sbjct:  494 GEAGPAGPAGTPGEPGAKGDAGPMGPMGVMGAAGLPGAPGEDGAQGPQGYKGDRGRQGARGLPGKHGEAGPRGPSGREGPPGYLRIMGRSIGVSGPPGEAGDVGSAGPKG-----RAGMQGVQGQPGPSGIPGAPGKRGPQGPKGPDGNPGRDGPSGTPGLPGPAGHSGASGPAGQPGPRGKPG---RPGSPGFDGLSGLRGMTGPSGKPGATGRVGEPGDKGPPGPVGPAGRDGAPGREGAQGDQGATGEPGP---MGDKGPQGGVGRDGPMGSQGMRGANGGPGAQGPPGPEGLPGPQGPQGPTGDQGPPGPPGPQGRKGPVGEE---GPEGPIGLDGPDGPDGPAGETGDAGV---PGFRGPRGARGLTGPIGLEGPVGLPGRQGAPGARGRAGKPGAPGAQGEVGPAGEPGADGKDGSPGPDGLPGPQGHPGWMGPPGLPGEQGDDGPRGDTGEEGPEGNPGPAGETGLIGPRGKTGVKGPRGDPGLPGPQGPTG 975          

HSP 7 Score: 79.337 bits (194), Expect = 1.790e-10
Identity = 165/445 (37.08%), Postives = 192/445 (43.15%), Query Frame = 1
Query: 6013 GSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPG---------------VIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAG------------------------DNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSI-------------GLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            G+ G+ G  G  G PG  G  GP+G +G PG  G                       G  G  GPMGP+G  GLRG  G                 GS G  G PGA G QG  G  GPRG  G  G  G+ G AG  G PG DGK G  G  G  GP G PG  G  G PG PG  G  G  G  G PG   + G  GP G  GP G  GD G  G  G  G++G  GP G PG  G +G  G  GP G  G +G +GP G+PG  G                        D G +GP GP G  G+ G  G+ GP+G +G  G  G+ GAPG  G  G  G     G +G  G  G  G  GP+G +G +GPPG +             G  GD+GS GP GR                G +G +G  G  G PG PG  GPQ
Sbjct:  221 GATGEAGQKGPVGIPGPVGSPGPAGHQGHPGPIGP---------------------RGPTGPSGPMGPTGVRGLRGRAGQKGAMGPPGAPGAPGAPGSDGRPGQPGASGRQGPRGRTGPRGEAGPAGPDGSDGKAGPIGHPGPDGKEGAPGPQGPQGPRGPPGKPGEDGAPGRPGVSGPAGEQGSRGPPGPQGEHGAPGPNGAVGPKGDRGDKGHTGPAGIQGETGPAGPRGRPGLQGPKGGQGPMGPDGPAGPRGPRGPSGEPGDDGKEGEPGKDAEDGPPGPRGRPGPAGDRGEAGPAGPAGTPGEPGAKGDAGPMGPMGVMGAAGLPGAPGEDGAQGPQGYKGDRGRQGARGLPGKHGEAGPRGPSGREGPPGYLRIMGRSIGVSGPPGEAGDVGSAGPKGR---------------AGMQGVQGQPGPSGIPGAPGKRGPQ 629          

HSP 8 Score: 78.5666 bits (192), Expect = 3.149e-10
Identity = 191/493 (38.74%), Postives = 231/493 (46.86%), Query Frame = 1
Query: 5677 TGVPGMKGPLGVKGDKGQRGRM------GKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHP---GVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVK------GDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQP-GPQGPLGERGP------------PGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKD-AVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMG 7068
             G+PG  G  G KG+ G RG        G  G+ GP G  G  G  G  G  G VGSPGP G+ GHP   G +G +G  G  G  G++G  G  G +G  G  G+ G  G  GS G+ G PG+ G++G  G  G  G+AG  GP G        G PG  G  G  G +GP+GPRG  G  GE G+ G  G  GP+G  G RG PG  G  G+ G  GA GP+G  G    +G TG  G QG  G AG  G PG  G  G  G                                         M P GP GP G RGP            PGK  +DG PG  G PG +G +G  GP G +G  G PG+ G +G  G  G  G  G PG  G++GA   QGP+G  GD G  G +G  G+ G AG RG +G  G PG     G+   V G  G  G +GS+G +G  GM G+QG PG  G+ G  G  GP G
Sbjct:  184 QGLPGRDGAQGPKGEPGLRGLAGPPGPQGPRGVSGPAGATGEAGQKGPVGIPGPVGSPGPAGHQGHPGPIGPRGPTGPSGPMGPTGVRGLRGRAGQKGAMGPPGAPGAPGAPGSDGRPGQPGASGRQGPRGRTGPRGEAGPAGPDGSDGKAGPIGHPGPDGKEGAPGPQGPQGPRGPPGKPGEDGAPGRPGVSGPAGEQGSRGPPGPQGEHGAPGPNGAVGPKGDRGD---KGHTGPAGIQGETGPAGPRGRPGLQGPKGGQGP----------------------------------------MGPDGPAGPRGPRGPSGEPGDDGKEGEPGKDAEDGPPGPRGRPGPAGDRGEAGPAGPAGTPGEPGAKGDAGPMGPMGVMGAAGLPGAPGEDGA---QGPQGYKGDRGRQGARGLPGKHGEAGPRGPSGREGPPGYLRIMGRSIGVSGPPGEAGDVGSAGPKGRAGMQGVQGQPGPSGIPGAPGKRGPQG 630          

HSP 9 Score: 68.9366 bits (167), Expect = 2.607e-7
Identity = 196/594 (33.00%), Postives = 235/594 (39.56%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKG---PLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSG-------------SPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIG------------------PPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGP---QGPRGEN---------------------------------------GDLGNTGEQGPV---GEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGP 7188
            G PG NG  GP G  G KG   P G++G+ G  G  G+ G+ GP+G  GP GP G  G RG  G   P G  G  G +G  G+    G PG +G PG  G RG  G  G  G  G  G+ G  G  G  G  GA G  G PG+ G  GP G KGD G+ G  G                    G  G+ GP GPSG             S G+ G PG  G +GS G  G  G QG+ G PGP G  G+ G +G  G  G  G PG+DG +G  G+                                    PG     G  GP G+ GP GK G  G PG  G  G  G+ GP G                  P G +G+ G PG  G  G +G  G  GP G  G  G  G  GP   QG RG N                                       G +G  G +GP+   G  G  G  G  G  G+PG  G  G   + G  G  GP+G  GR+G  G  G  G PG+ G +G++G  G  G                 G +G  G  GLPG  G PG +GP
Sbjct:  395 GAPGPNGAVGPKGDRGDKGHTGPAGIQGETGPAGPRGRPGLQGPKGGQGPMGPDGPAGPRGPRG---PSGEPGDDGKEGEPGKDAEDGPPGPRGRPGPAGDRGEAGPAGPAGTPGEPGAKGDAGPMGPMGVMGAAGLPGAPGEDGAQGPQGYKGDRGRQGARGLP------------------GKHGEAGPRGPSGREGPPGYLRIMGRSIGVSGPPGEAGDVGSAGPKGRAGMQGVQGQPGPSGIPGAPGKRGPQGPKGPDGNPGRDGPSGTPGL------------------------------------PGPAGHSGASGPAGQPGPRGKPGRPGSPGFDGLSGLRGMTGPSGKPGATGRVGEPGDKGPPGPVGPAGRDGAPGREGAQGDQGATGEPGPMGDKGPQGGVGRDGPMGSQGMRGANGGPGAQGPPGPEGLPGPQGPQGPTGDQGPPGPPGPQGRKGPVGEEGPEGPIGLDGPDGPDGPAGETGDAGVPGFRGPRGARGLTGPIGLEGPVGLPGRQGAPGARGRAGKPGAPGAQGEVGPAGEPG---------------ADGKDGSPGPDGLPGPQGHPGWMGP 916          

HSP 10 Score: 66.6254 bits (161), Expect = 1.371e-6
Identity = 156/428 (36.45%), Postives = 185/428 (43.22%), Query Frame = 1
Query: 5653 GINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDG------ILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGK---AGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSK---------------GDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGN 6864
            G+ G  GP+G+PG  G  G +G KG  G  G+DG      + GP G+ G  GP G PG RG  G PG       PG  G+SG  G  G  G  G  G  G  G +G  G  G  G  G+ G++G  G  G  G PG  GD G     G DGP G +G  G  G PG  G  GP G  G +G  G  G +               G+ GP GP G  G  G  G  G  G  G PG RGP+G       RG TG  G +G +G+ G  G PG  G+AG+ G                                           PG QG +G  G PG  G DG PG        GL GP G PG  G  GLPG  G  G +G+ G +GP G PG AG+ G  GP+G  G  G  G+ G  GP G  G 
Sbjct:  609 GVQGQPGPSGIPGAPGKRGPQGPKGPDGNPGRDGPSGTPGLPGPAGHSGASGPAGQPGPRGKPGRPG------SPGFDGLSGLRGMTGPSGKPGATGRVGEPGDKGPPGPVGPAGRDGAPGREGAQGDQGATGEPGPMGDKGPQGGVGRDGPMGSQGMRGANGGPGAQGPPGPEGLPGPQGPQGPTGDQGPPGPPGPQGRKGPVGEEGPEGPIGLDGPDGPDGPAGETGDAGVPGFRGPRGA------RGLTGPIGLEGPVGLPGRQGAPGARGRAGKPGA------------------------------------------PGAQGEVGPAGEPGADGKDGSPGP------DGLPGPQGHPGWMGPPGLPGEQGDDGPRGDTGEEGPEGNPGPAGETGLIGPRGKTGVKGPRGDPGLPGPQGPTGR 976          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Cavefish
Match: col1a1b (collagen, type I, alpha 1b [Source:ZFIN;Acc:ZDB-GENE-030131-4400])

HSP 1 Score: 137.117 bits (344), Expect = 1.792e-31
Identity = 79/253 (31.23%), Postives = 123/253 (48.62%), Query Frame = 1
Query: 8512 PVRTVR------RDLLNDDALAVKYLGSDV--VKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASDVTEYRS--WFGE-ITGTFKFDYQIEAS-------QLMFLKLFSTNARQRITINCSRL-----SVVGNSEHPVILYSDHDEEVLRNGD-LFKYSVIRDGCKNSAEIIDSTELEMDT-EAIRLPIRDIA-LNTGSSKEQQQFGLDIGQVCF 9192
            P+R+ R      RD  ++    +K L   +  ++ P GT+  PAR C+ L   +P  +   Y++DPN G   DA +V C  +  E+C++    S  LK+W  S     +   WFGE +   F+F Y  E S       Q+ F++L S  A Q IT +C           GN +  ++L   +D E+   G+    Y+V  DGC +       T +E  T +  RLPI DIA ++ G+    Q+FG+++G VCF
Sbjct: 1073 PLRSYRADDASVRDRDSEVDTTLKSLSQKIENIRSPEGTQKNPARMCRDLRMCHPEWKS-SYFVDPNQGSPLDAIKVFCNMETGETCVQPTRGSVPLKNWYLSKNFREKKHIWFGESMPEGFQFQYGSEGSDPEDVNIQMTFMRLMSNKASQNITYHCKNSIAYMDQASGNLKKALLLQGSNDVEIRAEGNSRSTYTVSEDGCTSHTGTWGKTVIEYQTAKTTRLPIIDIAPMDIGAP--DQEFGVEVGAVCF 1322          

HSP 2 Score: 80.1073 bits (196), Expect = 3.501e-14
Identity = 63/273 (23.08%), Postives = 113/273 (41.39%), Query Frame = -3
Query:  229 DQPKTEKISSIDPNDEDEDIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCIEPEVVN------YKKTSYTKTISSWFSVLASLNKQISY----KIPKE---QLVFXXXXXXXXXXXXXXSCDQIALVSDDSITQDIRYN--NSV----QLFGDDNQILTVNNEDDL---------FQYKVVEDTCKDKSNN-GRAVIKVEXXXXXXXXXXXLNFKSIENSRPAM-IGIEIGPVCF 957
            D  ++ +       D D ++   L  LS  ++N+  P G++  PAR C D+ R    +    +++DPN G   DAI V CN +  ETC++P   +      Y   ++ +    WF        Q  Y      P++   Q+ F                  + L+S+ + +Q+I Y+  NS+    Q  G+  + L +   +D+           Y V ED C   +   G+ VI+ +    +   +  ++   ++   P    G+E+G VCF
Sbjct: 1072 DPLRSYRADDASVRDRDSEVDTTLKSLSQKIENIRSPEGTQKNPARMCRDL-RMCHPEWKSSYFVDPNQGSPLDAIKVFCNMETGETCVQPTRGSVPLKNWYLSKNFREKKHIWFGESMPEGFQFQYGSEGSDPEDVNIQMTF------------------MRLMSNKA-SQNITYHCKNSIAYMDQASGNLKKALLLQGSNDVEIRAEGNSRSTYTVSEDGCTSHTGTWGKTVIEYQ--TAKTTRLPIIDIAPMDIGAPDQEFGVEVGAVCF 1322          

HSP 3 Score: 77.0258 bits (188), Expect = 3.929e-13
Identity = 122/290 (42.07%), Postives = 141/290 (48.62%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGI---------------------SGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLG---------IKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVG 6420
            +G PG  GP GP G  G  G  G  G+ G  G  G  G  G  G  G  GPTGAPG+ G  G PGP G+ G PGV G                      +G  G  G+ G  G PG PG  GP GEKG QGG G          +G+ G+ G PG  G RG PGE G PG A   GP G +G  G  GN G  G  G  G  G  G  G  G  G+ G  G  G+ G RG+ G  G  G+ G  GARGP G +G+PGP G  G KG  G +G AGV G  G  G+ G+VG
Sbjct:  418 SGAPGERGPNGPAGSQGATGEPGRPGEPGLPGSKGMTGAPGSPGPDGKTGPTGAPGQDGASGPPGPAGSRGTPGVMGFPGPKGADGESGKPGERGVTGPTGSVGAPGKDGDVGAPGAPGPAGPAGEKGEQGGAGPSGFQGLPGTQGATGEAGKPGEQGDRGLPGERGAPGPA---GPIGARGSTGPAGNDGARGEPGAAGAPGGVGPAGMQGMPGERGAGGMPGARGDRGDAGPKGPDGAVGKDGARGPAGAIGAPGPSGAPGDKGEPGPVGTAGVTGPRGSAGERGEVG 704          

HSP 4 Score: 72.0182 bits (175), Expect = 1.023e-11
Identity = 151/394 (38.32%), Postives = 180/394 (45.69%), Query Frame = 1
Query: 6013 GSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKG---------------SQGTIGIAGVPGTPGKDGKAGQ------VGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGK------------------PGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRR---GPQGMTGIQGPPGSIGLKGDIGSTGPMG 7068
            G+ G +G PG  G+ G AG  G SG  G+ GK G  G  G  GP GP G R      G+ G+ GP GP+GS G  G PG     G  G PG++G  G  GSPGP G+TG  G               S+GT G+ G PG  G DG++G+       G  G  G PG+ G VG  G PG  G  G+ G  G  G  G    PG QG  GE G PG+                  QG  G PG   +RG PG  GP G +G+ G  G  G                    G+ G+ GA G  G RG+ GD G  G  G VG+ G  G  G  GAPG  G  G+ G+    G  G  GP GS+G R   GP G  G  GPPG+ G  G  G TG  G
Sbjct:  366 GAQGAKGEPGPKGESGPAGPQGLSGPSGEEGKRGARGEPGGAGPLGPPGARTS----GAPGERGPNGPAGSQGATGEPG---RPGEPGLPGSKGMTGAPGSPGPDGKTGPTGAPGQDGASGPPGPAGSRGTPGVMGFPGPKGADGESGKPGERGVTGPTGSVGAPGKDGDVGAPGAPGPAGPAGEKGEQGGAGPSGFQGLPGTQGATGEAGKPGE------------------QGDRGLPG---ERGAPGPAGPIGARGSTGPAGNDGARGEPGAAGAPGGVGPAGMQGMPGERGAGGMPGARGDRGDAGPKGPDGAVGKDGARGPAGAIGAPGPSGAPGDKGEPGPVGTAGVTGPRGSAGERGEVGPPGPAGFAGPPGAAGQPGSKGETGDSG 731          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Cavefish
Match: col1a1a (collagen, type I, alpha 1a [Source:ZFIN;Acc:ZDB-GENE-030131-9102])

HSP 1 Score: 134.806 bits (338), Expect = 1.010e-30
Identity = 94/282 (33.33%), Postives = 135/282 (47.87%), Query Frame = 1
Query: 8428 GRDGPAXXXXXXXXXXXXXXXXXXAVFFPVRTVR---------RDLLNDDALAVKYLGSDVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDAS-DVTEYRS-WFGE-ITGTFKFDYQIEAS-------QLMFLKLFSTNARQRITINCSRL-----SVVGNSEHPVILYSDHDEEVLRNGD-LFKYSVIRDGCKNSAEIIDSTELEMD-TEAIRLPIRDIA-LNTGSSKEQQQFGLDIGQVCF 9192
            G  GP G  G   + G    P   A   P R  R         RDL  D  L       + ++ P GTK  PARTC+ L   +P+ + G Y+IDP+ G   DA +V C  +  E+C+         K+W  S ++ E +  WFGE +T  F+F+Y  E S       QL FL+L ST A Q IT +C           GN +  ++L   ++ E+   G+  F YSV  DGC +       T ++   T+  RLPI DIA ++ G+    Q+FG+++G VCF
Sbjct: 1156 GPPGPPGPSGGGFDIGFIAQPQEKAP-DPFRHFRADDANVMRDRDLEVDTTLKSLSQQIESIRSPDGTKKNPARTCRDLKMCHPDWKSGEYWIDPDQGCNQDAIKVYCNMETGETCVYPSQSDIPQKNWYTSKNIKEKKHVWFGEAMTDGFQFEYGGEESKPEDVNIQLTFLRLMSTEASQNITYHCKNSIAYMDQASGNLKKALLLQGSNEIEIRAEGNSRFTYSVTEDGCTSHTGAWGKTVIDYKTTKTSRLPIIDIAPMDVGAP--NQEFGIEVGPVCF 1434          

HSP 2 Score: 98.5969 bits (244), Expect = 9.273e-20
Identity = 75/258 (29.07%), Postives = 119/258 (46.12%), Query Frame = -3
Query:  229 DEDEDIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCIEPEVVNY-KKTSYT-KTISS----WFSVLASLNKQISY----KIPKE---QLVFXXXXXXXXXXXXXXSC-DQIALVSDDSITQDIRYNNSVQLFGDDNQILTVNNEDDLFQYKVVEDTCKDKSNN-GRAVIKVEXXXXXXXXXXXLNFKSIENSRPAMI--------------GIEIGPVCF 915
            D D ++   L  LS  ++++  P G+K  PAR+C D++  + +  +G ++IDP+ G  +DAI V+CN +  ETC+ P   +  +K  YT K I      WF    +   Q  Y      P++   QL FL+L S  +SQ +T  C + IA +  D  + +++      L    N+I      +  F Y V ED C   +   G+ VI               ++K+ + SR  +I              GIE+GPVCF
Sbjct: 1197 DRDLEVDTTLKSLSQQIESIRSPDGTKKNPARTCRDLKMCHPDWKSGEYWIDPDQGCNQDAIKVYCNMETGETCVYPSQSDIPQKNWYTSKNIKEKKHVWFGEAMTDGFQFEYGGEESKPEDVNIQLTFLRLMSTEASQNITYHCKNSIAYM--DQASGNLK---KALLLQGSNEIEIRAEGNSRFTYSVTEDGCTSHTGAWGKTVI---------------DYKTTKTSRLPIIDIAPMDVGAPNQEFGIEVGPVCF 1434          

HSP 3 Score: 83.1889 bits (204), Expect = 4.689e-15
Identity = 200/545 (36.70%), Postives = 230/545 (42.20%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDK------------GQRGRMGKDGILGPR---------GNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKR------GAPGEHGD------------------------PGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGS---------------------NGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
            +G PG+ GP GP G  G +G  G  G              G RG  G DG  GP+         G +GP+G TG PGR G  G PG  G  G PG  G  G+ G  G  G  G PG PG  G  G+ G  G  G KG+ G+ G PG  G        GAPG+ GD                        PG  G+ GP G  G+PGK                      GE G  G+ G  GPSGS G RG P      G +G PG  GP G  GSPG  G  G+KG  G  G  G  G PG  G  G+ G  G  G  G  G  G  G  G  G  G  G  G  G PG     GP GP G RGPPG+ G+ G PG       +G  GP G  G +G +G PG                       GP G  G KG++G  G PG  G  GA+G  GP G  G+ G  G  GP G+ G  G RG  G  G PG+ G  G     G KG  G  G+ G  G  G  GI G  G +GL G  G  G
Sbjct:  435 SGAPGVQGPPGPAGEEGKRGARGEPGAAGGRGPPGERGAPGARGFPGADGASGPKGAPGERGGPGAVGPKGATGEPGRNGEPGMPGSKGMTGSPGSPGPDGKTGATGPAGQDGRPGPPGPVGARGQPGVMGFPGPKGAAGEAGKPGERGVMGAIGVAGAPGKDGDVGAPGAPGAAGPSGERGEQGPAGPPGFQGLPGPQGATGEPGKP---------------------GEQGLPGEAGATGPSGSRGDRGFP------GERGAPGPAGPVGSRGSPGAAGNDGAKGESGASGAPGAQGPPGLQGMPGERGAAGLPGLKGDRGDQGAKGADGAAGPPGPAGAQGDKGEPGAA---GPVGPTGARGPPGERGESGAPGP------AGFAGPPGADGQAGAKGEPGDTGAKGDAGAPGAAGATGAPGPQGPVGATGPKGARGAAGPPGATGFPGAAGRVGPPGPAGNSGPPGAPGPSGKEGPKGNRGETGPAGRPGEIGAAGPPGAPGEKGTPGAEGAPGSSGIPGPQGIAGQRGIVGLPGQRGERG 943          

HSP 4 Score: 78.9518 bits (193), Expect = 8.929e-14
Identity = 150/419 (35.80%), Postives = 185/419 (44.15%), Query Frame = 1
Query: 5983 KGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQG---------FPGARGPQGILGSPGPRGRTGSKGSQGTI---------------GIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKN---------MQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLP---GSNGPSGTKGNKGSKGPYGKPGIA------GDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAV---------------DGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMG 7068
            KG+ G+ G PG+ G+ G  GE G PG   + GP G  G+ GK G  G  G  G RGP G RG  G  G  G  G  GP G+PG RG PG +G  G+ G          PG++G  G  GSPGP G+TG+ G  G                 G+ G PG  G  G+AG+ G                        + G  G  G  G PGK+            GP G  GE+GP G  G  G+          G QG  G PG  G++GLP   G+ GPSG++G++G  G  G PG A      G  GA+G  G +GE+G  G  G QGP G  G  G RG  G PG+ G  G+ G                    G  G  GP+G +G RGP G  G  G PG  G  G  G+ G  G
Sbjct:  414 KGNTGEAGAPGAKGEAGVKGESGAPG---VQGPPGPAGEEGKRGARGEPGAAGGRGPPGERGAPGARGFPGADGASGPKGAPGERGGPGAVGPKGATGEPGRNGEPGMPGSKGMTGSPGSPGPDGKTGATGPAGQDGRPGPPGPVGARGQPGVMGFPGPKGAAGEAGKPG------------------------ERGVMGAIGVAGAPGKDGDVGAPGAPGAAGPSGERGEQGPAGPPGFQGL---------PGPQGATGEPGKPGEQGLPGEAGATGPSGSRGDRGFPGERGAPGPAGPVGSRGSPGAAGNDGAKGESGASGAPGAQGPPGLQGMPGERGAAGLPGLKGDRGDQGAKGADGAAGPPGPAGAQGDKGEPGAAGPVGPTGARGPPGERGESGAPGPAGFAGPPGADGQAG 796          

HSP 5 Score: 78.5666 bits (192), Expect = 1.315e-13
Identity = 190/609 (31.20%), Postives = 226/609 (37.11%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKD------------GILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGD---------------PGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGN------PGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNG------------ASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGN------------------------IGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGD---------------------KGLPGN---PGTPGVIGPQ 7191
            GE G+ G +G  GV G  GP G +G +G RG  G              G  G  G  G  GP GAPG RG  G+ GP G  G PG  G  G P                              G KG  G  G PG DGK GA G  G                PG  G  GP G  G+ GK                         G +G +G +G +G+PG  G+      PG  G  G +G  G  GP G  G PGP+G TG  G  G  G+ G  G  G  G  G  G                                     PG+   PGP GP+G RG PG +                  G  G  G SG  G PG+ GP G +G  G +G  G PG+ GD G              GP G +G+ G+ G  G  GP G  G  G RG +GAPG  G  G  G D   GAKG                          GP+G++G   P+G  G  GPPG+ G  G  G  GP G  G  G PG PG  G  GP+G +G+                     KG PG    PG+ G+ GPQ
Sbjct:  427 GEAGVKGESGAPGVQGPPGPAGEEGKRGARGEPGAAGGRGPPGERGAPGARGFPGADGASGPKGAPGERGGPGAVGPKGATGEPGRNGEPGMP------------------------------GSKGMTGSPGSPGPDGKTGATGPAGQDGRPGPPGPVGARGQPGVMGFPGPKGAAGEAGKP------------------------GERGVMGAIGVAGAPGKDGDVGAPGAPGAAGPSGERGEQGPAGPPGFQGLPGPQGATGEPGKPGEQGLPGEAGATGPSGSRGDRGF------------------------------------PGERGAPGPAGPVGSRGSPGAA------------------GNDGAKGESGASGAPGAQGPPGLQGMPGERGAAGLPGLKGDRGDQGAKGADGAAGPPGPAGAQGDKGEPGAAGPVGPTGARGPPGERGESGAPGPAGFAGPPGADGQAGAKGEPGDTGAKGDAGAPGAAGATGAPGPQGPVGATG---PKGARGAAGPPGATGFPGAAGRVGPPGPAGNSGPPGAPGPSGKEGPKGNRGETGPAGRPGEIGAAGPPGAPGEKGTPGAEGAPGSSGIPGPQ 924          

HSP 6 Score: 78.1814 bits (191), Expect = 1.419e-13
Identity = 192/556 (34.53%), Postives = 226/556 (40.65%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGN------------AGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDG---------------KRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSN---------------------GPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPG 7167
            G PG +G +GP G PG +G  G  G KG  G  G++G  G  G+ G  G  G+PG  G  G+ GP G              G PGV G  G                   +G  GE G  G  G+ G+IG  G PG DG               +RG  G  G PG  G+ GP G  G+PGK G                     E G  G+ G  GPSGS G RG PG       +G PG  GP G  GSPG  G  G+KG  G  G  G  G PG  G  G+ G  G  G  G  G  G  G  G  G  G  G  G  G PG     GP GP G RGPPG+ G+ G PG       +G  GP G  G +G +G PG                       GP G  G KG++G  G PG  G  GA+G  GP G  G+ G  G  GP G+ G  G RG  G  G PG+ G  G     G KG  G  G+ G  G  G  GI G  G +GL G                               +G++G PG PG
Sbjct:  478 GFPGADGASGPKGAPGERGGPGAVGPKGATGEPGRNGEPGMPGSKGMTGSPGSPGPDGKTGATGPAGQDGRPGPPGPVGARGQPGVMGFPG------------------PKGAAGEAGKPGERGVMGAIGVAGAPGKDGDVGAPGAPGAAGPSGERGEQGPAGPPGFQGLPGPQGATGEPGKPG---------------------EQGLPGEAGATGPSGSRGDRGFPG------ERGAPGPAGPVGSRGSPGAAGNDGAKGESGASGAPGAQGPPGLQGMPGERGAAGLPGLKGDRGDQGAKGADGAAGPPGPAGAQGDKGEPGAA---GPVGPTGARGPPGERGESGAPGP------AGFAGPPGADGQAGAKGEPGDTGAKGDAGAPGAAGATGAPGPQGPVGATGPKGARGAAGPPGATGFPGAAGRVGPPGPAGNSGPPGAPGPSGKEGPKGNRGETGPAGRPGEIGAAGPPGAPGEKGTPGAEGAPGSSGIPGPQGIAGQRGIVGLPGQ------------------------------RGERGFPGLPG 949          

HSP 7 Score: 76.6406 bits (187), Expect = 4.458e-13
Identity = 194/558 (34.77%), Postives = 229/558 (41.04%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSP------------------------GPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGS---------------------------KGPYGKPGIAGDNGASGPQGPRGE------------------------NGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIG------------------PIGSSGRRGPQGMTGIQGPPGSIGL 7035
            +GE G  GP GP G  G+ GP G  G+ G+ G  G  G  G  G  G +G  G PG RG  G  GPVG+ G PG  G                                   G KG  G  G PG+   +G PG  G PG+ G  G  G+KGD G  G  G  G  GP GP G +G  GE G+ G +GP G  G PG RG  G  G  G  G PGA G  G  G P                        GP G TG KG++G  G  G  G PG  G+ G  G      P G  GP G  G  G  G  G  G  G  G PG+    GP G  GE+G PG  G  G  G  GP G +G +G +G PG  G+RG PG  GPSG  G +G                            +G  G  G AG +GA+G +G RGE                         GD G +G  GP G +G AG RG +G  G  G  GE G+    G KG+ G                  P GSSG  GP+G +G  G PG  G+
Sbjct:  612 SGERGEQGPAGPPGFQGLPGPQGATGEPGKPGEQGLPGEAGATGPSGSRGDRGFPGERGAPGPAGPVGSRGSPGAAGND---------------------------------GAKGESGASGAPGA---QGPPGLQGMPGERGAAGLPGLKGDRGDQGAKGADGAAGPPGPAGAQGDKGEPGAAGPVGPTGARGPPGERGESGAPGPAGFAGPPGADGQAGAKGEPGDTGAKGDAGAPGAAGATGAPGPQGPVGATGPKGARGAAGPPGATGFPGAAGRVGPPG------PAGNSGPPGAPGPSGKEGPKGNRGETGPAGRPGEIGAAGPPGAPGEKGTPGAEGAPGSSGIPGPQGIAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGPGGPGGERGPPGPMGPPGLAGPPGEPGREGTPGNEGSAGRDGAAGAKGDRGETGAAGAPGAPGPPGAPGPIGPAGKTGDRGESGPAGPAGAMGPAGPRGPSGPAGARGDKGETGEAGERGMKGHRGFTGMQGPPGPPGPSGESGPAGSSGPAGPRGPSGSAGTPGKDGM 1127          

HSP 8 Score: 55.4546 bits (132), Expect = 1.301e-6
Identity = 44/98 (44.90%), Postives = 51/98 (52.04%), Query Frame = 1
Query: 6769 GDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGP 7062
            G  GA+GP G  GE+G+ G  G  G  G  G  G RG  G PG+PG  G  G   +DGAKG+ GP G  G  G  G  G  G  G  GL G+ G  GP
Sbjct:  202 GPRGAAGPPGKNGEDGESGKPGRPGERGPSGPQGARGFPGTPGLPGIKGHRGFSGLDGAKGDTGPAGPKGEPGAPGENGTPGAMGPRGLPGERGRAGP 299          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Cavefish
Match: col1a2 (collagen, type I, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-030131-8415])

HSP 1 Score: 129.028 bits (323), Expect = 4.860e-29
Identity = 96/304 (31.58%), Postives = 134/304 (44.08%), Query Frame = 1
Query: 8353 QGSVGPTGTKGFPGENGSPGPV------GMPGRDGPAXXXXXXXXXXXXXXXXXXAVFFPVRTVRRDLLNDDALAVKYLGSDVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASDVTEYRSWFGE-ITGTFKFDYQIE-------ASQLMFLKLFSTNARQRITINCSRLSVV-----GNSEHPVILYSDHDEEVLRNGD-LFKYSVIRDGCKNSAEI--IDSTELEMDT-EAIRLPIRDIA-LNTGSSKEQQQFGLDIGQVCF 9192
             G +GP G +G PG  G  GP       G PG  G         +          A  + V    + L             D +  P G+K  PARTC+ +  ++P+    FY+IDPN G   DA +  C     ++CI +   S   K+W  S   +   WFGE I G  +F Y  E       A+QL F++L +  A Q +T +C           GN +  V+L   +D E+   G+  F +SV+ DGC           T +E  T +  RLPI DIA L+ G +   Q+FGLDIG VCF
Sbjct: 1063 HGPIGPAGHRGPPGHVGPVGPPGSPGLAGPPGAAGGGYDVSGGYDEYRADQAALRAKDYEVDATIKSLNTQ---------IDNLLSPEGSKKNPARTCRDIRLSHPDWTS-FYWIDPNQGCTMDAIKAFCDFSTGQTCIHAHPESIPRKNWYRSSQEKKHIWFGETINGGTEFGYNDETLSPQSMATQLAFMRLLANQAVQNVTYHCKNSIAYMDAENGNLKKAVLLQGSNDVELRAEGNSRFTFSVLEDGCTLQRHTGQWSKTVIEYRTNKPSRLPILDIAPLDIGGA--DQEFGLDIGPVCF 1354          

HSP 2 Score: 90.5077 bits (223), Expect = 2.539e-17
Identity = 63/242 (26.03%), Postives = 114/242 (47.11%), Query Frame = -3
Query:  229 EDEDIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCI--EPEVV---NYKKTSYTKTISSWF-------SVLASLNKQISYKIPKEQLVFXXXXXXXXXXXXXXSCDQIALVSDDSITQDIRYNNSVQLFGDDNQILTVNNEDDLFQYKVVEDTCKDKSNNGR-AVIKVEXXXXXXXXXXXLNFKSIE-NSRPAMIGIEIGPVCF 912
            +D ++   +  L++ +DNL  P GSK  PAR+C DI+  + + ++  ++IDPN G   DAI   C+F   +TCI   PE +   N+ ++S  K    WF       +     ++ +S +    QL F++L +  + Q +T  C       D    ++     +V L G ++  L     +  F + V+ED C  + + G+ +   +E    +   +  L+   ++        G++IGPVCF
Sbjct: 1119 KDYEVDATIKSLNTQIDNLLSPEGSKKNPARTCRDIRLSHPDWTS-FYWIDPNQGCTMDAIKAFCDFSTGQTCIHAHPESIPRKNWYRSSQEKK-HIWFGETINGGTEFGYNDETLSPQSMATQLAFMRLLANQAVQNVTYHCKNSIAYMD---AENGNLKKAVLLQGSNDVELRAEG-NSRFTFSVLEDGCTLQRHTGQWSKTVIEYRTNKPSRLPILDIAPLDIGGADQEFGLDIGPVCF 1354          

HSP 3 Score: 83.9593 bits (206), Expect = 2.549e-15
Identity = 197/571 (34.50%), Postives = 242/571 (42.38%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKG------PLGVKGDKGQRGRMGKDGILGP---RGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGA------------PGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGP---------------------------------MGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNS---GQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIG 7185
            G PG  G  GP+G PG +G      P+G  G  G RG  G  G+ GP   +G  G  GP GA G +G +G+ GP   AG PG  G  G PG  G  G  G  G  G+ G  G  G+ G  G KG  G  G  G+ G+ GA             G +GD G+ G  GPSG  G  G +G  G SG  GP G  G  G  G+ G++G+ GP                                  G SG PGL G PG  G +G  G      P GI+G PGP   TG++G  G  G+ G  G  G  G+ G +G                                             P G  GE+G PG+S                  GP+GPPG +   GQ G  G NG  G++G +G  G  G  G AG  G SG  GPRG +G++G  G  GP GE G  G  G +G PG PG  G  G     G+ G +G  G+ G  GP G  G  G  G  G  G  G+ GP G  G P + G  G  G  G  G KGD+G+ G  G PG+ G
Sbjct:  527 GAPGEKGEQGPSGAPGFQGLPGPAGPVGETGKPGDRGIPGDQGVAGPSGVKGERGTPGPAGASGAQGPIGARGP---AGTPGPDGSKGEPGAVGAAGAPGHQGAAGMPGERGAAGTPGAKGEKGEAGYRGLEGNAGRDGARGAPGPSGPPGPAGANGDKGETGSFGPSGPAGARGPSGERGESGPAGPPGFAGPPGADGQAGARGEKGPGGVKGDVGAPGPAGPAGNTGPLGPSGPVGPPGARGDSGPPGLTGFPGAAGRVGPAG------PAGIVGPPGP---TGAQGKDGPRGLRGDVGPAGPQGENGLIG---------------------------------------------PPGLSGEKGSPGES------------------GPMGPPGIAGPQGQLGSQGFNGLPGSRGERGLPGAAGSVGEAGRVGPSGSPGPRGPSGNIGLPGMTGPQGEAGREGSPGNDGPPGRPGAAGIKGDRGEPGSPGPLGIAGAPGPLGPSGAVGRPGNRGEAGSAGPSGAVGPAGARGAPFLQGPSGPRGEKGVAGDKGDRGMKGLRGHPGLQG 1022          

HSP 4 Score: 76.6406 bits (187), Expect = 4.027e-13
Identity = 103/269 (38.29%), Postives = 117/269 (43.49%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGA------PGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGL------RGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAG 6411
            +G PG+ G  G  G  G  GP G+ G  G  G  GKDG  G RG++GP GP G       PG  G  GSPG  G  G PG+ G  G+                         GSQG  G+ GS G+ G PG+ G  G  G  G  G  G  GPSG  G PG T                  G  GE G +G  G  GP G PG       RG PG  G LG  G PG  GP G +G PG RG  GS G  G +G AG  G P   G +G
Sbjct:  769 SGPPGLTGFPGAAGRVGPAGPAGIVGPPGPTGAQGKDGPRGLRGDVGPAGPQGENGLIGPPGLSGEKGSPGESGPMGPPGIAGPQGQ------------------------LGSQGFNGLPGSRGERGLPGAAGSVGEAGRVGPSGSPGPRGPSGNIGLPGMT------------------GPQGEAGREGSPGNDGPPGRPGAAGIKGDRGEPGSPGPLGIAGAPGPLGPSGAVGRPGNRGEAGSAGPSGAVGPAGARGAPFLQGPSG 995          

HSP 5 Score: 72.4034 bits (176), Expect = 7.871e-12
Identity = 179/515 (34.76%), Postives = 208/515 (40.39%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSI---------------------------GQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGP---------YGKPGIAGDNGASGPQGPRGE---NGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENG------------------------KDAVDGAKGNIGPIGSSGRRGPQGM 6999
            G  G+ G  G  G PG KG  G  G +G  G  G+DG  G  G  GP GP GA G +G  GS GP G AG    +G SG  G  G  G  G  G PG  G  G +G +G  G+KG +                           G  G PG  G  GA G  G  G AGI GP G  G  GK G                       G +GD+GP GP G  GL G PG+ G  GS G  G  GP GI G  G  G  G  G  G+ G  G+PG  G  G+AG+VG                                        +  PGP+GP G  G PG +G  G  G  G PG  G  G  G  G  G RG PGS GP G  G  G  GP          G+ G AG +GA GP G RG     G  G  GE+G  G+ G+ G++G+ G PG+ G  G NG                            DG  G  GPIG +G RGP G 
Sbjct:  626 GAAGMPGERGAAGTPGAKGEKGEAGYRGLEGNAGRDGARGAPGPSGPPGPAGANGDKGETGSFGPSGPAG---ARGPSGERGESGPAGPPGFAGPPGADGQAGARGEKGPGGVKGDVGAPGPAGPAGNTGPLGPSGPVGPPGARGDSGPPGLTGFPGAAGRVGPAGPAGIVGPPGPTGAQGKDG---------------------PRGLRGDVGPAGPQGENGLIGPPGLSGEKGSPGESGPMGPPGIAGPQGQLGSQGFNGLPGSRGERGLPGAAGSVGEAGRVG---------------------------------------PSGSPGPRGPSGNIGLPGMTGPQGEAGREGSPGNDGPPGRPGAAGIKGDRGEPGSPGPLGIAGAPGPLGPSGAVGRPGNRGEAGSAGPSGAVGPAGARGAPFLQGPSGPRGEKGVAGDKGDRGMKGLRGHPGLQGMPGPNGPSGDTGAAGIAGPAGPRGPAGPNGPPGKDGRSGTHGPIGPAGHRGPPGH 1077          

HSP 6 Score: 67.0106 bits (162), Expect = 3.982e-10
Identity = 160/460 (34.78%), Postives = 184/460 (40.00%), Query Frame = 1
Query: 5659 NGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGP---SGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSI 7029
            NG  G TG  G  GP G +G  G+RG   + G  GP G  GP G  G  G RG  G  G  G+                      G PG  G  G  G  G  G +G  G+ G  G PG  G  GA G  G  G AGI GP G  G  GK                      G  G +GD+GP GP G  GL G PG+ G  GS G  G  GP GI G  G  G  G  G  G+ G  G+PG  G  G+AG+V                                       G +  PGP+GP G  G PG +                     GP G +G+ G PG++GP    G  G KG +G  G PG  G  GA GP GP G  G  GN GE G  G  G  G  G  GAP + G  G  G+  V G KG+ G  G  G  G QGM G  GP G  
Sbjct:  679 NGDKGETGSFGPSGPAGARGPSGERG---ESGPAGPPGFAGPPGADGQAGARGEKGPGGVKGDV---------------------GAPGPAGPAGNTGPLGPSGPVGPPGARGDSGPPGLTGFPGAAGRVGPAGPAGIVGPPGPTGAQGKD---------------------GPRGLRGDVGPAGPQGENGLIGPPGLSGEKGSPGESGPMGPPGIAGPQGQLGSQGFNGLPGSRGERGLPGAAGSVGEAGRV---------------------------------------GPSGSPGPRGPSGNIGLPGMT---------------------GPQGEAGREGSPGNDGPPGRPGAAGIKGDRGEPGSPGPLGIAGAPGPLGPSGAVGRPGNRGEAGSAGPSGAVGPAGARGAPFLQGPSGPRGEKGVAGDKGDRGMKGLRGHPGLQGMPGPNGPSGDT 1033          

HSP 7 Score: 60.077 bits (144), Expect = 7.857e-9
Identity = 128/398 (32.16%), Postives = 151/398 (37.94%), Query Frame = 1
Query: 6187 SKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGP---PGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGI------------------AGDNGASGPQGPRGENGDLGNTGEQGPVGEV---------GNAGIRGVNGAPGIPGK------------------------------DGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGT---PGVIGPQ 7191
            + G  GP+G  G+PG +G  G  G+ G QG PG  GP G  G PG RG  G +G  G  G+ G  GTPG  G +                                                G QGP+G RGP   PG  G  G PG VG  G  G QG  G PG  G  G PG+ G  G  G +G +G  G+ G                    G+ G+ GP GP G  G  G  GE GP G           G AG RG  G  G+ G                                G  G     GA G +GP G +G  GP G TG QG  G  GL+GD+G  GP G  G+ G              G  G+KG PG  G    PG+ GPQ
Sbjct:  516 NNGPAGPVGLGGAPGEKGEQGPSGAPGFQGLPGPAGPVGETGKPGDRGIPGDQGVAGPSGVKGERGTPGPAGAS------------------------------------------------GAQGPIGARGPAGTPGPDGSKGEPGAVGAAGAPGHQGAAGMPGERGAAGTPGAKGEKGEAGYRGLEGNAGRDGARGAPGPSGPPGPAGANGDKGETGSFGPSGPAGARGPSGERGESGPAGPPGFAGPPGADGQAGARGEKGPGGVKGDVGAPGPAGPAGNTGPLGPSGPVGPPGARGDSGPPGLTGFPGAAGRVGPAGPAGIVGPPGPTGAQGKDGPRGLRGDVGPAGPQGENGLIGP------------PGLSGEKGSPGESGPMGPPGIAGPQ 853          

HSP 8 Score: 20.7866 bits (42), Expect = 7.857e-9
Identity = 16/49 (32.65%), Postives = 19/49 (38.78%), Query Frame = 2
Query: 7238 RLLVGQVVSLGREANQAHQGSPAP---VDRKGLLVLLVRWGNLGRQGRP 7375
            R L G   S+G        GSP P       GL  +    G  GR+G P
Sbjct:  871 RGLPGAAGSVGEAGRVGPSGSPGPRGPSGNIGLPGMTGPQGEAGREGSP 919          

HSP 9 Score: 20.7866 bits (42), Expect = 7.857e-9
Identity = 54/126 (42.86%), Postives = 62/126 (49.21%), Query Frame = 1
Query: 7387 SIGLKGERGPNGIDGSIGPPGRNGAPGAVXXXXXXXXXXXXXXXXSVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRGSIGLPGPSGVPGIRGQQGRDGPRGEIGLNGDPGLPGDIGMPGASGSDG 7764
            + G+KG+R   G  GS GP G  GAPG +GP G +G PG  G  GS                   G  G VGP G RG+  L GPSG  G +G  G  G RG  GL G PGL    GMPG +G  G
Sbjct:  930 AAGIKGDR---GEPGSPGPLGIAGAPGPLGPSGAVGRPGNRGEAGSA------------------GPSGAVGPAGARGAPFLQGPSGPRGEKGVAGDKGDRGMKGLRGHPGL---QGMPGPNGPSG 1031          

HSP 10 Score: 62.7734 bits (151), Expect = 8.043e-9
Identity = 199/524 (37.98%), Postives = 228/524 (43.51%), Query Frame = 1
Query: 5668 TGPTGVPGMKGPLGV---------------------------KGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPG---------------------LRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGD---------NGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMG 7068
             GPTG  G  G +G                             G  G  G  G  G+ G  G  G QGP+GAPG +G  G  GPVG  G PG +GI G                            QG  G  G  G+ G PG  G  GA G  G  G AG  GP G KG+PG  G  G  G +G  G  G RG  G  G+KG+ G  G  G  G                       G+ G  GS G  G  GARGP G  G  GP G  G  G  G  G AG  G  G  G  G VG PG  GP G  GP+GP G  G PG  G  GP G  G PG   + GP GP G  GPPG +G  G  G        GL+G +GP G  G+ GL G  G SG KG+ G  GP G PGIAG          NG  G +G RG  G  G+ GE G VG  G+ G RG +G  G+PG  G  G+   +G+ GN GP G  G  G +G  G  G PG +G+ G  G  GP G
Sbjct:  469 PGPTGPRGQPGNIGFPGPKGPGGEPGKPGEKGPAGPPGLRGPPGPDGNNGPAGPVGLGGAPGEKGEQGPSGAPGFQGLPGPAGPVGETGKPGDRGIPG---------------------------DQGVAGPSGVKGERGTPGPAGASGAQGPIGARGPAGTPGPDGSKGEPGAVGAAGAPGHQGAAGMPGERGAAGTPGAKGEKGEAGYRGLEGNAGRDGARGAPGPSGPPGPAGANGDKGETGSFGPSGPAGARGPSGERGESGPAGPPGFAGPPGADGQAGARGEKGPGGVKGDVGAPGPAGPAGNTGPLGPSGPVGPPGARGDSGPPGLTGFPGAAGRVGPAGPAGIVGPPGPTGAQGKDGP------RGLRGDVGPAGPQGENGLIGPPGLSGEKGSPGESGPMGPPGIAGPQGQLGSQGFNGLPGSRGERGLPGAAGSVGEAGRVGPSGSPGPRGPSGNIGLPGMTGPQGEAGREGSPGNDGPPGRPGAAGIKGDRGEPGSPGPLGIAGAPGPLGPSG 959          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Cavefish
Match: col5a3b (collagen, type V, alpha 3b [Source:ZFIN;Acc:ZDB-GENE-110728-4])

HSP 1 Score: 118.242 bits (295), Expect = 1.026e-25
Identity = 194/526 (36.88%), Postives = 238/526 (45.25%), Query Frame = 1
Query: 5653 GINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHP------------------GVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPS------GVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXX--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRG---------------LPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQ------------GPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIG----SSGRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
            G  G  G  G PG KG +GVKGD G  G +G  G  GP G  G  GP G PG  G  G  G +G  G P                  GV G  GR G  G+ G+ G  G  G RG  G +G  G  G KGS G DG PG  G+RG  G  G  G+ G  GPS      G+ G PG+                      GE G +G  GP GPSG  G +GN G  G +G +G PG+ GP G  G PG  G+ G+KG  G+ G++G  G  G  G  G  G PG  G               PG  G+ G PG AG  G PG+    G  GP+GE+G P                  G +GPIGP G  G++G                 G  G +G  G KGSKG  G+PG AG  G  GP+            GP G+ G  G  G++G  G  G  G RG+ G PG PG+ GE+G   + G  G  GP G    S G++GP G  G++G PG +G KG+ G +G
Sbjct:  493 GSKGEKGEDGFPGAKGEMGVKGDGGDTGPVGMRGEDGPEGPKGQSGPLGDPGSSGIAGEKGKLGVPGLPGYPGRQGPKGTDGFPGAIGVAGEKGRKGPPGQAGIAGQRGPNGARGARGARGPTGKSGDKGSAGHDGPPGPSGERGPQGPQGRVGEIGPKGPSGPAGKDGLPGHPGQR---------------------GEPGFQGKTGPPGPSGVVGPQGNAGETGPMGERGHPGSAGPPGEQGLPGAAGKEGAKGDPGSTGVSGKNGPTGLKGFRGSRGAPGTMGPPGLKGSWGPVGSSGPGATGERGPPGLAGAIGQPGRTGTAGGPGPMGEKGEP-----------------QGEKGPIGPAGQDGEQGPVGLPGATGPPGPPGEDGDKGETGGPGQKGSKGDKGEPGPAGPTGTQGPEGQPGIPGVDGESGPPGQQGMYGQKGDEGLRGFKGATGPRGLQGMPGPPGEKGESGHSGLIGPPGQFGPRGPQGPSGGQQGPPGRPGVRGQPGGVGEKGEDGESG 980          

HSP 2 Score: 113.62 bits (283), Expect = 2.676e-24
Identity = 182/497 (36.62%), Postives = 220/497 (44.27%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPL-------GVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGT----VGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYP-GSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGD---------NGASGPQGPRGENGDLGNTGEQGPVGEVGN---AGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGP 7062
            G PG  G  G  G+PG KG         G +G  G+ G  G DG+ G +GNLG  G  GAPG++G      G PGP G  G PG +G                               QG  G++G  G DG P G  G+ G PGE G PG AG+ GP G  G  G  G  G  G +G +            G KG+ G  G  G  G++G+ G  G +G +G  G  GP+G  G  G  G +G  G +G +G+ G+PG PG+ G  G  G PG  G  G                             G+   PG  G  G+RGP G  G  G  G  G  G  G  G  GPPG SG+RG  G  G  G  G KG  GP GK G+ G           G +GP GP G  G  GN GE GP+GE G+   AG  G  G PG  GK+G  G     G  G  GP G  G RG +G  G  GPPG  G  G +GS+GP
Sbjct:  346 GPPGDRGFDGLPGLPGNKGHRQGSDGQPGPRGQPGEPGGRGVDGVQGSKGNLGSPGEPGAPGQQGNPGIMQGFPGPQGLVGLPGDKG------------------------------PQGKKGMRGLPGTDGPPQGHPGREGPPGEKGLPGLAGVQGPVGYPGARGVKGADGLRGIKGSK------------GEKGEDGFPGAKGEMGVKGDGGDTGPVGMRGEDGPEGPKGQSGPLGDPGSSGIAGEKGKLGVPGLPGYPGRQGPKGTDGFPGAIGVAGEK---------------------------GRKGPPGQAGIAGQRGPNGARGARGARGPTGKSGDKGSAGHDGPPGPSGERGPQGPQGRVGEIGPKGPSGPAGKDGLPGHPGQRGEPGFQGKTGPPGPSGVVGPQGNAGETGPMGERGHPGSAGPPGEQGLPGAAGKEGAKGDPGSTGVSGKNGPTGLKGFRGSRGAPGTMGPPGLKGSWGPVGSSGP 773          

HSP 3 Score: 112.849 bits (281), Expect = 4.327e-24
Identity = 203/553 (36.71%), Postives = 246/553 (44.48%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSG------VKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRG---------------LPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQG------------PRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTG-IQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            TG  G+ G  GP G  G  GPLG  G  G  G  GK G+ G  G  G QGP G  G  G +G  G  G  G PG  GI+G+ G  G  G +G  G              G  G KGS G DG PG  G+RG  G  G  G+ G  GPSG      + G PG+ G                     E G +G  GP GPSG  G +GN G  G +G +G PG+ GP G  G PG  G+ G+KG  G+ G++G  G  G  G  G  G PG  GPPG  G  GP+G  G      +   G AG  G PG+    G  GP+GE+G P                  G +GPIGP G  G++G                 G  G +G  G KGSKG  G+PG AG  G  GP+G            P G+ G  G  G++G  G  G  G RG+ G PG PG+ GE+G   +      IGP G  G RGPQG +G  QGPPG  G++G  G  G  G                   +G  GD G  G PG+ G  G Q
Sbjct:  519 TGPVGMRGEDGPEGPKGQSGPLGDPGSSGIAGEKGKLGVPGLPGYPGRQGPKGTDGFPGAIGVAGEKGRKGPPGQAGIAGQRGPNGARGARGARG------------PTGKSGDKGSAGHDGPPGPSGERGPQGPQGRVGEIGPKGPSGPAGKDGLPGHPGQRG---------------------EPGFQGKTGPPGPSGVVGPQGNAGETGPMGERGHPGSAGPPGEQGLPGAAGKEGAKGDPGSTGVSGKNGPTGLKGFRGSRGAPGTMGPPGLKGSWGPVGSSGPGATGERGPPGLAGAIGQPGRTGTAGGPGPMGEKGEP-----------------QGEKGPIGPAGQDGEQGPVGLPGATGPPGPPGEDGDKGETGGPGQKGSKGDKGEPGPAGPTGTQGPEGQPGIPGVDGESGPPGQQGMYGQKGDEGLRGFKGATGPRGLQGMPGPPGEKGESGHSGL------IGPPGQFGPRGPQGPSGGQQGPPGRPGVRGQPGGVGEKGE------------------DGESGDPGPVGIPGSNGEKGDQ 997          

HSP 4 Score: 108.612 bits (270), Expect = 9.859e-23
Identity = 238/565 (42.12%), Postives = 273/565 (48.32%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGP---------LGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGP------PGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGP----QGP------RGENGDLGNTGEQGPVGEVGNAGIRGVNGAPG---------------IPGKDGENGKDAVDGAKGNIGPIGSSGRRGP---QGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXX------XXXXEGFKGDKGLPGNPGTPGVIGP 7188
             GE G  GP G  G+ G +GP          G  G  G +G  G DG  GP G  GPQGP G  G  G  G  GP G  G PG  G  G           G  G  G  GP G  G QG  G  G +G+ G+PGS    G PGE G PG AG +   G KGDPG TG  G++G  G +G R         GS+G  G MGP   PGL+G+ G +GS G  G  G RGP G+ G+ G  GRTG+ G  G +G  G P   G+ G  G  G  G+ GP G PG  GP G PG  G  G+ G  G  G+ G   +PGP GP G +GP      PG  G+ G PG  G  GQ G +G  G  G +G RGL G  GP G KG  G  G  G PG  G  G  GP    QGP      RG+ G +G  GE G  G+ G  GI G NG  G               IPG  G +G+   DGAKGN GPIG +G  GP    G  GI G PGS G  G+ G  GP G  G PG PG+PG  G        G  G KGDKG PG  G  G  GP
Sbjct:  582 AGEKGRKGPPGQAGIAGQRGPNGARGARGARGPTGKSGDKGSAGHDGPPGPSGERGPQGPQGRVGEIGPKGPSGPAGKDGLPGHPGQRGE---------PGFQGKTGPPGPSGVVGPQGNAGETGPMGERGHPGS---AGPPGEQGLPGAAGKE---GAKGDPGSTGVSGKNGPTGLKGFR---------GSRGAPGTMGP---PGLKGSWGPVGSSGP-GATGERGPPGLAGAIGQPGRTGTAGGPGPMGEKGEP--QGEKGPIGPAGQDGEQGPVGLPGATGPPGPPGEDGDKGETGGPGQKGSKGDKGEPGPAGPTGTQGPEGQPGIPGVDGESGPPGQQGMYGQKGDEGLRGFKGATGPRGLQGMPGPPGEKGESGHSGLIGPPGQFGPRGPQGPSGGQQGPPGRPGVRGQPGGVGEKGEDGESGDPGPVGIPGSNGEKGDQGEKGDSGASGAGGIPGARGTSGE---DGAKGNSGPIGLTGDPGPPGEAGTDGIDGAPGSKGDNGEPGKAGPPGASGEPGPPGRPGRRGHLGPPGKEGKPGMKGDKGAPGYEGLLGKTGP 1113          

HSP 5 Score: 102.449 bits (254), Expect = 7.181e-21
Identity = 204/565 (36.11%), Postives = 262/565 (46.37%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDP-GKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXX---ELGSKGDIG---PMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLG-ERGPPGK---SXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRG---------------LPGSNGPSGTKGNKGSKGPYG------KPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVG---------NAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGS---------------TGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGT 7170
            G PG  GP G  G+PG  G  G KGD G  G  GK+G  G +G  G +G  G  G  G  GS GPVG++G PG  G                               +G  G+ G+IGQ G  G+ G  G  GE G+P G+ G  GP+G  G+ G  G PG +G  GP G  G++G  G   + GSKGD G   P GP+G+ G  G PG+ G  G  G PG    QG+ G  G  G  G KG+ G  G+ G+PG PG+ G++G  G+ G                                  PG+    GPQGP G ++GPPG+    G  G  G  G  G+SG  GP+G PG++G++G               +PG+ G SG  G KG+ GP G       PG AG +G  G  G +G+NG+ G  G  G  GE G         + G  G  G PG+ G  G  G + + G  G +G  G+ G+ GPQG+ GI GP G  GL G  G                 G  GR G  G  G  G++GPPG  G KGD+G+PGN G 
Sbjct:  703 GHPGSAGPPGEQGLPGAAGKEGAKGDPGSTGVSGKNGPTGLKGFRGSRGAPGTMGPPGLKGSWGPVGSSG-PGATG------------------------------ERGPPGLAGAIGQPGRTGTAGGPGPMGEKGEPQGEKGPIGPAGQDGEQGPVGLPGATGPPGPPGEDGDKGETGGPGQKGSKGDKGEPGPAGPTGTQGPEGQPGIPGVDGESGPPGQ---QGMYGQKGDEGLRGFKGATGPRGLQGMPGPPGEKGESGHSGLIG---------------------------------PPGQFGPRGPQGPSGGQQGPPGRPGVRGQPGGVGEKGEDGESGDPGPVGIPGSNGEKGDQGEKGDSGASGAGGIPGARGTSGEDGAKGNSGPIGLTGDPGPPGEAGTDGIDGAPGSKGDNGEPGKAGPPGASGEPGPPGRPGRRGHLGPPGKEGKPGMKGDKGAPGYEGLLGKTGPVGGQGNPGKAGPQGLPGIPGPAGEQGLNGPPGQTGPPGPMGPSGLPGLKGDHGRKGDKGHGGLIGLIGPPGEFGEKGDRGMPGNQGV 1200          

HSP 6 Score: 102.064 bits (253), Expect = 7.945e-21
Identity = 201/555 (36.22%), Postives = 250/555 (45.05%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVG------SPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIG---PMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENG------------KDAVDGAKGNIGPIGSSGRRG------PQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGT------------PGVIGPQ 7191
            G PG  GP G  G+PG+ G  G  G  G RG  G DG+ G +G+ G +G  G PG +G +G        GPVG  G  G +G  G+ G  G+PG                  S G  G KG +G  G PG  G++G  G  G PG  G+ G  G KG PG+ G  G+ G  G RG RG RG  G+ G KG  G   P GPSG  G +G  G +G +G +G  G  G  G+ G PG RG  G +G  G  G +GV G  G  G+ G +G                                       +   PG  GP GE+G PG +G +G  G+ G  G SG  GP G  G  G RG PG+ GP G KG+ G  G  G PG  G+ G  G  G  G+ G  G  G  GP+GE G    +G  G  G  G+DGE G                DG KG  G  G  G +G      P G TG QGP G  G+ G  G +GP G+ G+ G  G  G+ G  G  G +G +G+PG PG             PG  GP+
Sbjct:  451 GHPGREGPPGEKGLPGLAGVQGPVGYPGARGVKGADGLRGIKGSKGEKGEDGFPGAKGEMGVKGDGGDTGPVGMRGEDGPEGPKGQSGPLGDPG------------------SSGIAGEKGKLGVPGLPGYPGRQGPKGTDGFPGAIGVAGEKGRKGPPGQAGIAGQRGPNGARGARGARGPTGKSGDKGSAGHDGPPGPSGERGPQGPQGRVGEIGPKGPSGPAGKDGLPGHPGQRGEPGFQGKTGPPGPSGVVGPQGNAGETGPMG---------------------------------------ERGHPGSAGPPGEQGLPGAAGKEGAKGDPGSTGVSGKNGPTGLKGFRGSRGAPGTMGPPGLKGSWGPVGSSG-PGATGERGPPGLAGAIGQPGRTGTAGGPGPMGEKGEP--QGEKGPIGPAGQDGEQGPVGLPGATGPPGPPGEDGDKGETGGPGQKGSKGDKGEPGPAGPTGTQGPEGQPGIPGVDGESGPPGQQGMYGQKGDEGLRGFKGATGPRGLQGMPGPPGEKGESGHSGLIGPPGQFGPR 945          

HSP 7 Score: 101.293 bits (251), Expect = 1.433e-20
Identity = 56/180 (31.11%), Postives = 80/180 (44.44%), Query Frame = 1
Query: 8551 ALAVKYLGSDVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCR-SQRKESCIE--SKSPSYKLKHWDASDVTEYRSWFGEITGTFKFDY------QIEASQLMFLKLFSTNARQRITINCSR----LSVVGNSEHPVILYSDHDEEVLRNGDLFKYSVIRDGCK 9051
            +LA      + ++ P GT   PARTCK+L   NP L D  Y+IDPN G   DAF+  C  +   E+C++  SK  S KL  W+        +WF +     +F Y       +   QL FLKL S  ARQ  T  C      L     S    + +   +++ L + +        DGC+
Sbjct: 1297 SLASMRTEVEGLRTPQGTYHSPARTCKELWMWNPKLPD-VYWIDPNHGCHRDAFKAFCNFTAEGETCLQPHSKYQSVKLAAWNKEKPG---TWFSKFRKGSQFSYIDADGNDVHVVQLGFLKLLSATARQSFTYLCQNSVGWLDGATFSHKRALRFRGSNDQELTHANAHYIQPSYDGCQ 1472          

HSP 8 Score: 93.5893 bits (231), Expect = 3.276e-18
Identity = 157/455 (34.51%), Postives = 188/455 (41.32%), Query Frame = 1
Query: 5974 LGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGS---LGSQGFPGARGPQG----ILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPG------IAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGI---RGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQG---------------PPGSIGLKGDIGS------------TGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGN------PGTPGVIGPQ 7191
            LG+ G  G  G PG  G +G  G  G PG  G DG  G+ G+ G                          GS G  GP G  G PG RG  GV GS   LGS G PGA G QG    + G PGP+G  G  G +G  G  G+ G PG DG                                                 PG +GP GE+G PG                +G+QGP+G PG    RG+ G++G  G KG+KG KG  G PG      + GD G +GP G RGE+G  G  G+ GP+G+ G++GI   +G  G PG+PG  G  G    DG  G IG  G  GR+GP G  GI G               P G  G KG  G              GP GR+G  G  G  G  G  G  G  G +G PG       PG  GV+GPQ
Sbjct:  321 LGLNGRPGPLGNPGPTGLKGDSGLPGPPGDRGFDGLPGLPGNKGH-----------------------RQGSDGQPGPRGQPGEPGGRGVDGVQGSKGNLGSPGEPGAPGQQGNPGIMQGFPGPQGLVGLPGDKGPQGKKGMRGLPGTDGPP--------------------------------------------QGHPGREGPPGEKGLPG---------------LAGVQGPVGYPG---ARGVKGADGLRGIKGSKGEKGEDGFPGAKGEMGVKGDGGDTGPVGMRGEDGPEGPKGQSGPLGDPGSSGIAGEKGKLGVPGLPGYPGRQGPKGTDGFPGAIGVAGEKGRKGPPGQAGIAGQRGPNGARGARGARGPTGKSGDKGSAGHDGPPGPSGERGPQGPQGRVGEIGPKGPSGPAGKDGLPGHPGQRGEPGFQGKTGPPGPSGVVGPQ 690          

HSP 9 Score: 92.0485 bits (227), Expect = 1.039e-17
Identity = 202/551 (36.66%), Postives = 243/551 (44.10%), Query Frame = 1
Query: 5716 GDKGQRGRMGKDGILGPRGNL-------------------------------------GPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQ----GGLGIKGSIGQDGYPGSDGKRGAPGEHGDPG-KAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGP-------SGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRG------LPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRR------GPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIG 7185
            G  G++G  G DGI GP GN+                                     GP GP G  GR G +G+PGP G  G  G+ G  G  G  G PG+ G  G       +     Q    GG G+ G  G  G  GS G+ GAPG+ G+PG   G  GP G+ G PG                    G  G+ G +G  G  GP        G PG +G PG+ G  G  G+PGAR   G+ G+ G RG  GSKG +G  G  G  G  G  G  G  G  G  G  G  GP G  G  G PG  G  G  G  G PG    PG QGP G  G PG          +G  G+ G +GP G  G +GQRG        G+ GP+G  G+KGS G  G PG +G+    GPQGP+G  G++G  G  GP G+ G  G  G  G PG  GK G  G   V G +GN G  G  G R      GP G  G+ G  G  G KGD GSTG  G+             GP G +GF+G +G PG  G PG+ G
Sbjct:  258 GPAGRQGLAGADGIPGPPGNMLMLPQFQFGGDGQKVPVVSAQEAQAQAILQHAKLSMKGPPGPLGLNGRPGPLGNPGPTGLKGDSGLPGPPGDRGFDGLPGLPGNKGHRQGSDGQPGPRGQPGEPGGRGVDGVQGSKGNLGSPGEPGAPGQQGNPGIMQGFPGPQGLVGLPGDK------------------GPQGKKGMRGLPGTDGPPQGHPGREGPPGEKGLPGLAGVQGPVGYPGAR---GVKGADGLRGIKGSKGEKGEDGFPGAKGEMGVKGDGGDTGPVGMRGEDGPEGPKGQSGPLGDPGSSGIAGEKGKLGVPGLPGYPGRQGPKGTDGFPG---------AIGVAGEKGRKGPPGQAGIAGQRGPNGARGARGARGPTGKSGDKGSAGHDGPPGPSGER---GPQGPQGRVGEIGPKGPSGPAGKDGLPGHPGQRGEPGFQGKTGPPGPSGVVGPQGNAGETGPMGERGHPGSAGPPGEQGLPGAAGKEGAKGDPGSTGVSGK------------NGPTGLKGFRGSRGAPGTMGPPGLKG 763          

HSP 10 Score: 71.633 bits (174), Expect = 1.606e-11
Identity = 49/174 (28.16%), Postives = 82/174 (47.13%), Query Frame = -3
Query:  415 EDIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRL-ETCIEPE--VVNYKKTSYTKTIS-SWFSVLASLNKQISY------KIPKEQLVFXXXXXXXXXXXXXXSCDQIALVSDDSITQDIRYNNSVQLFGDDNQILTVNN 906
            E++F +L  + + V+ L  P G+   PAR+C ++   +  K   +++IDPN G  +DA    CNF    ETC++P     + K  ++ K    +WFS       Q SY       +   QL FL+L S ++ Q+ T  C       D +      +  +++  G ++Q LT  N
Sbjct: 1292 EEVFASLASMRTEVEGLRTPQGTYHSPARTCKELWM-WNPKLPDVYWIDPNHGCHRDAFKAFCNFTAEGETCLQPHSKYQSVKLAAWNKEKPGTWFSKFRK-GSQFSYIDADGNDVHVVQLGFLKLLSATARQSFTYLCQNSVGWLDGAT---FSHKRALRFRGSNDQELTHAN 1460          

HSP 11 Score: 68.1662 bits (165), Expect = 1.827e-10
Identity = 171/442 (38.69%), Postives = 195/442 (44.12%), Query Frame = 1
Query: 5641 TGEPGINGPTG------PTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHP----GVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSG---------VKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGP----------------MGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGS---------------------PGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGP---LGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASG 6789
            TG  G NGPTG        G PG  GP G+KG  G  G  G  G  G RG  G  G  G PGR GT G PGP+G  G P    G  G +G+ G QG  G+ G  G PG  G +G+KG  GG G KGS G  G PG  G  G  G  G PG  G+DG SG          KGD G  G  G +G RG +G  G  G  GE G  G IGP                 GP G PG+RG PG +G  G  G  G  GP GI GS                     PG RG +G  G++G  G  G+ G PG  G+AG  GI G  G                              + G N +PG  GP    GE GPPG+ G  G  G  G  G+ G++G  G P   G  GL G  GP G +GN G  GP G PGI G  G  G
Sbjct:  732 TGVSGKNGPTGLKGFRGSRGAPGTMGPPGLKGSWGPVGSSGP-GATGERGPPGLAGAIGQPGRTGTAGGPGPMGEKGEPQGEKGPIGPAGQDGEQGPVGLPGATGPPGPPGEDGDKGETGGPGQKGSKGDKGEPGPAGPTGTQGPEGQPGIPGVDGESGPPGQQGMYGQKGDEGLRGFKGATGPRGLQGMPGPPGEKGESGHSGLIGPPGQFGPRGPQGPSGGQQGPPGRPGVRGQPGGVGEKGEDGESGDPGPVGIPGSNGEKGDQGEKGDSGASGAGGIPGARGTSGEDGAKGNSGPIGLTGDPGPPGEAGTDGIDGAPG------------------------------SKGDNGEPGKAGPPGASGEPGPPGRPGRRGHLGPPGKEGKPGMKGDKGAP---GYEGLLGKTGPVGGQGNPGKAGPQGLPGIPGPAGEQG 1139          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Cavefish
Match: ENSAMXT00000052948.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001200.1:50842:55553:-1 gene:ENSAMXG00000040953.1 transcript:ENSAMXT00000052948.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.087 bits (292), Expect = 1.736e-25
Identity = 123/405 (30.37%), Postives = 148/405 (36.54%), Query Frame = 1
Query: 5977 GIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            G+KG  G  G  G+ G RGA G  G  G  G  G  G  G  G                       G  G+ G  G  G  G+ G RG  G  G+ G++G  G RG  G  G+ G RG  G++G+ GT G  G  G  G  G  G  G                                      G     G +G  G RG  G  G  G  G  G  G  G +G  G  G  G RG  G+ G  GT+G  G++G +G  G  G  GA G +G  G  G  G  G  G  G  G  G  G  GA G  G  G  G     GA G  G  G+   RG  G  G  G  G+ G +G  G+ G  G                 G  G +G  G  G  GT G  G +
Sbjct:   28 GVKGERGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRG---------------------AWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGA------------------------------------WGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGT---RGAWGTRGAWGTRGAWGTRGAWGTRGAWG---------------TRGAWGTRGAWGTRGAWGTRGAWGTR 357          

HSP 2 Score: 72.7886 bits (177), Expect = 6.036e-12
Identity = 56/170 (32.94%), Postives = 69/170 (40.59%), Query Frame = 1
Query: 6682 QRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            Q+G+ G  G  GT+G  G++G +G  G  G  GA G +G  G  G  G  G  G  G  G  G  G  GA G  G  G  G     GA G  G  G+   RG  G  G  G  G+ G +G  G+ G  G                 G  G +G  G  G  GT G  G +
Sbjct:   26 QKGVKGERGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGT---RGAWGTRGAWGTRGAWGTRGAWGTRGAWG---------------TRGAWGTRGAWGTRGAWGTRGAWGTR 177          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003197.1 (pep scaffold:Pmarinus_7.0:GL479090:2162:37629:-1 gene:ENSPMAG00000002618.1 transcript:ENSPMAT00000003197.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 154.451 bits (389), Expect = 1.491e-37
Identity = 105/297 (35.35%), Postives = 151/297 (50.84%), Query Frame = 1
Query: 8353 QGSVGPTGTKGFPGENGSPGPVGMPGRDGPAXXXXXXXXXXXXXXXXXXAVFFPVRTVR----RDLLNDDALAVKYLGSDVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASDV-TEYRSWFG-----EITGTFKFDYQIEASQLMFLKLFSTNARQRITINCS-----RLSVVGNSEHPVILYSDHDEEVLRNGD-LFKYSVIRDGCKNSAEIIDSTELEMDT-EAIRLPIRDIALNTGSSKEQQQFGLDIGQVCF 9192
            +G VG  G+ G  G NG+PGP+G  G  G  G  G  G  GPPGPPGPP+  F     +    R+L  + +++   +  + +  P G++  PARTC+ L    P+L  G Y+IDPN G   DA +V C  +  ESC+ + +PS   K+W      ++   WFG     +   T+  D      QL FL+LFST A Q+IT +C      +   VGN +  ++L   ++ E+   G+    YSV+ DGC         T +E  T +  RLPI DIA         Q+FG+D+G VCF
Sbjct:  891 RGPVGGAGSHGKDGANGAPGPLGPAGPRGRNGEAGAAGPPGPPGPPGPPSGGFAADEAQNQGERNLELEASISSLNVRVENMVSPDGSQKNPARTCRNLKLCYPDLPSGLYWIDPNEGSKSDAIQVWCNMETGESCMNADNPSIARKNWWLKPSGSKKHVWFGVTMSPDAQFTYGEDSHSTEIQLTFLRLFSTEASQKITYHCKNSVAYQDGAVGNLQQALLLQGSNEMEIRAEGNSKLAYSVLEDGCTMHTGQWGKTVIEYRTPKTSRLPIVDIAPKD-VGGPDQEFGVDVGPVCF 1186          

HSP 2 Score: 95.1301 bits (235), Expect = 2.013e-19
Identity = 69/249 (27.71%), Postives = 118/249 (47.39%), Query Frame = -3
Query:  229 ISSIDPNDEDEDIFEALLRLSSI---VDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCIEPEVVNYKKTSYTKTISS-----WFSVLASLNKQISY----KIPKEQLVFXXXXXXXXXXXXXXSCDQIALVSDDSITQDIRYNNSVQLFGDDNQILTVNNEDDLFQYKVVEDTCKDKSNN-GRAVIKVEXXXXXXXXXXXLNFKSIENSRPAMIGIEIGPVCF 936
             ++ +  ++ E   E    +SS+   V+N+  P GS+  PAR+C +++  Y +  +G+++IDPN G   DAI V CN +  E+C+  +  +  + ++    S      WF V  S + Q +Y       + QL FL+L S  +SQ +T  C       D ++        ++ L G +   +       L  Y V+ED C   +   G+ VI+    +  RLPI D+  K +        G+++GPVCF
Sbjct:  943 FAADEAQNQGERNLELEASISSLNVRVENMVSPDGSQKNPARTCRNLKLCYPDLPSGLYWIDPNEGSKSDAIQVWCNMETGESCMNADNPSIARKNWWLKPSGSKKHVWFGVTMSPDAQFTYGEDSHSTEIQLTFLRLFSTEASQKITYHCKNSVAYQDGAVGN---LQQALLLQGSNEMEIRAEGNSKL-AYSVLEDGCTMHTGQWGKTVIEYRTPKTSRLPIVDIAPKDVGGPD-QEFGVDVGPVCF 1186          

HSP 3 Score: 70.0922 bits (170), Expect = 9.144e-12
Identity = 108/323 (33.44%), Postives = 134/323 (41.49%), Query Frame = 1
Query: 6184 GSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPV---------------------------GEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGR 7071
            G +G+ GP G +G+PG     GV G  G +G PG  GP G  GSPGP G  GS+G      + G+PG  G+ G +G  G+                                     G+  + GP GP GERG  G +               G  G  G PG+SG+ G  G++G  G  G +G KG  G PG AG  GA G  GP G+ G  G TGE+G V                           G+ G AG RG  G  G  G  G  G   + G  G  GP G +G RGP G  G  G  G+ G  G +G  GP GR
Sbjct:  659 GPRGETGPPGSTGAPGA----GVTGPSGEKGAPGDDGPVGAEGSPGPSGLAGSRG------VVGLPGQRGERGFSGPAGLV------------------------------------GEAGKQGPVGPSGERGSAGPA---------------GAMGSAGSPGDSGRDGAAGADGLPGRDGPQGPKGDRGPPGNAGPAGAPGASGPSGQAGSPGRTGERGDVGPAGPSGPAGPPGPRGPVGPLGGLGERGDNGAAGERGHKGHRGFAGLPGPPGPPGLSGESGTPGPAGPAGARGPVGGAGSHGKDGANGAPGPLGPAGPRGR 920          

HSP 4 Score: 51.9878 bits (123), Expect = 2.532e-6
Identity = 59/163 (36.20%), Postives = 67/163 (41.10%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDK------GQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKT 6111
            +GE G  G  GP G  G  GP G+ G +      GQRG  G  G  G  G  G QGP G  G RG+ G  G +G+AG PG  G                                G  G  G  G+DG  G  G RG PG  G  G  G  GPSG  G PG+T
Sbjct:  681 SGEKGAPGDDGPVGAEGSPGPSGLAGSRGVVGLPGQRGERGFSGPAGLVGEAGKQGPVGPSGERGSAGPAGAMGSAGSPGDSG------------------------------RDGAAGADGLPGRDGPQGPKGDRGPPGNAGPAGAPGASGPSGQAGSPGRT 813          

HSP 5 Score: 51.2174 bits (121), Expect = 4.763e-6
Identity = 121/347 (34.87%), Postives = 153/347 (44.09%), Query Frame = 1
Query: 5998 QDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPG---LRGNPGVIGSLGSQGFPGARGPQGILGSPG------PRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQ------SGLQGPIGPPGNSGQRGLP---------------GSNGPSGTKGNKGSKG------PYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKD 6930
            ++G  G  G+ G PG  G PG AG+ GPSG KG PG                              D GP+G  GSPG   L G+ GV+G  G +G  G  GP G++G  G      P G  GS G  G +G AG PG  G+DG AG  G+                                    PG++   GPQGP G+RGPPG +G  G PG  GP GQ      +G +G +GP G SG  G P               G NG +G +G+KG +G      P G PG++G++G  GP GP          G +GPVG  G+ G  G NGAPG  G  G  G++
Sbjct:  654 KEGTKGPRGETGPPGSTGAPG-AGVTGPSGEKGAPG------------------------------DDGPVGAEGSPGPSGLAGSRGVVGLPGQRGERGFSGPAGLVGEAGKQGPVGPSGERGSAGPAGAMGSAGSPGDSGRDGAAGADGL------------------------------------PGRD---GPQGPKGDRGPPGNAGPAGAPGASGPSGQAGSPGRTGERGDVGPAGPSGPAGPPGPRGPVGPLGGLGERGDNGAAGERGHKGHRGFAGLPGPPGPPGLSGESGTPGPAGP---------AGARGPVGGAGSHGKDGANGAPGPLGPAGPRGRN 921          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001576.1 (pep scaffold:Pmarinus_7.0:GL476350:400893:424819:1 gene:ENSPMAG00000001417.1 transcript:ENSPMAT00000001576.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 135.191 bits (339), Expect = 4.977e-32
Identity = 81/247 (32.79%), Postives = 117/247 (47.37%), Query Frame = 1
Query: 8506 FFPVRTVRRDLLNDDALAVKYLGS-----DVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASDVTEYRS-WFGEITGT-FKFDY-------QIEASQLMFLKLFSTNARQRITINCSRL-----SVVGNSEHPVILYSDHDEEVLRNGD-LFKYSVIRDGCKNSAEIIDSTELEMDTEAI-RLPIRDIA-LNTGSSKEQQQFGLDIG 9180
            F+       DL   DA     L S     D ++ P G++  PARTC+ L   +P  + G Y+IDPN G   DA +V C  +  E+C+ +   +   K W  +   + +  WFGE   +  +F+Y          A Q+ FL+L ST A Q IT +C           GN +  ++L   +D E+   G+  F Y+V+ DGC         T LE  T+   RLPI DIA L+ G     Q+FG+DIG
Sbjct:  495 FYRGDQASADLRQHDAEVDATLKSLTNQIDSIRSPEGSRKNPARTCRDLKLCHPEWKSGDYFIDPNQGCTLDAIKVFCNMESGETCVYASPQNVPRKSWWTNKSKDRKHIWFGETMNSGSQFNYGDDSLPPNTAAIQMTFLRLLSTEASQNITYHCKNSIAYMDEQAGNLKKALLLQGSNDIEIRAEGNSRFTYNVLEDGCTKHTGDWGQTVLEYRTQKTSRLPIVDIAPLDIGGV--DQEFGVDIG 739          

HSP 2 Score: 87.4261 bits (215), Expect = 3.606e-17
Identity = 69/266 (25.94%), Postives = 117/266 (43.98%), Query Frame = -3
Query:  211 LFQNDQPKTEKISSIDPNDEDEDIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCIEPEVVNYKKTSYTKTISS-----WFSVLASLNKQISY---KIPKE----QLVFXXXXXXXXXXXXXXSCDQIALVSDDSITQDIRYNNSVQLFGDDNQILTVNNEDDLFQYKVVEDTC-KDKSNNGRAVIKVEXXXXXXXXXXXLNFKSIENSRPAMIGIEIGPVCFSGLSEE 969
             ++ DQ      +S D    D ++   L  L++ +D++  P GS+  PAR+C D++  +    +G ++IDPN G   DAI V CN +  ETC+     N  + S+    S      WF    +   Q +Y    +P      Q+ FL+L S  +SQ +T  C       D+   Q      ++ L G  N I      +  F Y V+ED C K   + G+ V++               +++ + SR  +  ++I P+   G+ +E
Sbjct:  495 FYRGDQ------ASADLRQHDAEVDATLKSLTNQIDSIRSPEGSRKNPARTCRDLKLCHPEWKSGDYFIDPNQGCTLDAIKVFCNMESGETCVYASPQNVPRKSWWTNKSKDRKHIWFGETMNSGSQFNYGDDSLPPNTAAIQMTFLRLLSTEASQNITYHCKNSIAYMDE---QAGNLKKALLLQG-SNDIEIRAEGNSRFTYNVLEDGCTKHTGDWGQTVLE---------------YRTQKTSRLPI--VDIAPLDIGGVDQE 733          

HSP 3 Score: 58.151 bits (139), Expect = 3.530e-8
Identity = 138/313 (44.09%), Postives = 164/313 (52.40%), Query Frame = 1
Query: 5977 GIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX---XXXTPGKNMQPGPQG---PLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPG 6897
            G+ G  G  G PG  G RG  GE G  G  G DG  G+ G  G  G  G +G +G  GP G  G  G  GS G+ G  GP G  G  G PG  G  G++G  G  G +G  G+PGP+G  GS G QG  G+ G  G  G  G +G  G PG  G  G PGP G  G PG PG  GK GP G     G  G++ +PG QG   P GE+G PG+ G  G  G  GP G +G +G +G PG  G+RG  G  GPSG  G +GS GP G+ G  G NG  G  GP GE G  GN G  GP G  G++G +G  G  G
Sbjct:    7 GMPGERGTAGAPGPKGDRGDGGEKGPEGAPGKDGSRGLTGPIGPPGPSGSAGDKGEAGPPGPTGPAGTRGSPGERGETGPPGPAGFAGPPGSDGQPGAKGEQGESGQKGDAGAPGPQGPAGSPGPQGPNGVPGPKGARGAQGPSGATGFPGAAGRVGPPGPNGNPGPPGPPGPGGKDGPKGIRGDSGPAGRSGEPGLQGAAGPPGEKGEPGEDGPSGPEGPPGPMGLAGQRGIVGLPGQRGERGFSGLPGPSGEPGKQGSPGPSGERGPPGPNGPPGLSGPPGEQGRDGNPGSDGPPGRDGSSGQKGERGENG 319          

HSP 4 Score: 51.9878 bits (123), Expect = 2.174e-6
Identity = 180/463 (38.88%), Postives = 204/463 (44.06%), Query Frame = 1
Query: 5779 GPQGPTGAPGRRGTVGSPGPVGN---------AGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARG------------------------PQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGK------------AGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIG 7032
            GP G  G PG RGT G+PGP G+          G PG  G  G  G  G PG  G  G  G  GP G  G  G  G  G  G+ G PG  G  G PG  G PG  G  G SG KGD G  G                       G  G  GP GP+G PG +G  G  G  G+ GFPGA G                        P+GI G  GP GR+G  G QG  G  G  G PG+DG             AGQ GI G  G  G                             G +  PGP G  G++G PG SG+ G PG  GPPG SG  G  G  GN G  G PG +G SG KG +G  G  G+PG  G  GA GP GP G+NG+ G +G QGP+G  G AG RG+ G  G  G  GENG+    G KG+ G  G  G  GP G  G QG  GS+G
Sbjct:    1 GPPGLQGMPGERGTAGAPGPKGDRGDGGEKGPEGAPGKDGSRGLTGPIGPPGPSGSAGDKGEAGPPGPTGPAGTRGSPGERGETGPPGPAGFAGPPGSDGQPGAKGEQGESGQKGDAGAPGPQ---------------------GPAGSPGPQGPNGVPGPKGARGAQGPSGATGFPGAAGRVGPPGPNGNPGPPGPPGPGGKDGPKGIRGDSGPAGRSGEPGLQGAAGPPGEKGEPGEDGPSGPEGPPGPMGLAGQRGIVGLPGQRGER---------------------------GFSGLPGPSGEPGKQGSPGPSGERGPPGPNGPPGLSGPPGEQGRDGNPGSDGPPGRDGSSGQKGERGENGSPGQPGAPGAPGAPGPVGPTGKNGERGESGPQGPIGPPGPAGARGLPGPQGPRGDKGENGEHGERGMKGHRGFTGLQGLPGPPGSPGDQGTAGSLG 415          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001071.1 (pep scaffold:Pmarinus_7.0:GL476837:726:42204:1 gene:ENSPMAG00000000855.1 transcript:ENSPMAT00000001071.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 133.65 bits (335), Expect = 4.440e-31
Identity = 98/302 (32.45%), Postives = 141/302 (46.69%), Query Frame = 1
Query: 8356 GSVGPTGTKGFPGENGS------PGPVGMPGRDGPAXXXXXXXXXXXXXXXXXXAVFFPVRTVRRDLLNDDALAVKYLGSDVVKKPLGTKDIPARTCKQLLDANPNLQD--GFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASDVTEYRS-WFGE-ITGTFKFDY-----QIEASQLMFLKLFSTNARQRITINCSRL-----SVVGNSEHPVILYSDHDEEVLRNGD-LFKYSVIRDGCKNSAEIIDSTELEMDTEAI-RLPIRDIA-LNTGSSKEQQQFGLDIGQVCF 9192
            G  GP G +G  GE G       PGP G PG  G     G           G  A       +   L+ D ++       + +  P G++  PAR+C+ L+  +P  +   G Y+IDPN G   DA +V C  +  ESC+    PS   K+W  S   + +  W GE ++   +F Y      +E  QL FL+L ST+A Q+IT +C        S  GN +  ++L    D E+   G+  F YSV+ DGC     +   T +E  T+   RLP  DIA ++ G S   Q+FG+D+G VCF
Sbjct:  980 GPAGPAGPRGRTGETGPPGPPGSPGPPGPPGSSGAGYDMGAYAGLMARRKMGDQATDM----LPYGLVLDASIKALNAQVESITSPDGSRKHPARSCRDLMLCHPEYKSDTGEYWIDPNEGCRADAIKVWCNMETGESCVNPGMPSLPRKNWWRSQAADKKHVWLGETMSPGSQFTYGDGSPNMEV-QLTFLRLLSTDASQKITYHCKNSVAYLDSRAGNLKKALMLQGSSDVEIRAEGNSRFTYSVLEDGCTTHTGVWGKTVIEYRTQKTSRLPFMDIAPMDVGGS--DQEFGVDVGPVCF 1274          

HSP 2 Score: 93.2041 bits (230), Expect = 8.983e-19
Identity = 67/253 (26.48%), Postives = 118/253 (46.64%), Query Frame = -3
Query:  229 IFEALLR-LSSIVDNLYKPPGSKLYPARSCADI---QRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCIEPEVVNYKKTSYTKTISS-----WFSVLASLNKQISY----KIPKEQLVFXXXXXXXXXXXXXXSCDQIALVSDDSITQDIRYN--NSVQLF----GDDNQILTVNNEDDL---------FQYKVVEDTCKDKSN-NGRAVIKVEXXXXXXXXXXXLNFKSIENSRPAMIGIEIGPVCF 900
            + +A ++ L++ V+++  P GS+ +PARSC D+     +Y++ + G ++IDPN G   DAI V CN +  E+C+ P + +  + ++ ++ ++     W     S   Q +Y       + QL F                  + L+S D+ +Q I Y+  NSV       G+  + L +    D+         F Y V+ED C   +   G+ VI+    +  RLP  D+    +  S     G+++GPVCF
Sbjct: 1043 VLDASIKALNAQVESITSPDGSRKHPARSCRDLMLCHPEYKSDT-GEYWIDPNEGCRADAIKVWCNMETGESCVNPGMPSLPRKNWWRSQAADKKHVWLGETMSPGSQFTYGDGSPNMEVQLTF------------------LRLLSTDA-SQKITYHCKNSVAYLDSRAGNLKKALMLQGSSDVEIRAEGNSRFTYSVLEDGCTTHTGVWGKTVIEYRTQKTSRLPFMDIAPMDVGGSD-QEFGVDVGPVCF 1274          

HSP 3 Score: 63.1586 bits (152), Expect = 1.148e-9
Identity = 177/520 (34.04%), Postives = 208/520 (40.00%), Query Frame = 1
Query: 5698 GPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSL---------------------GSQGFPGARGP------------------QGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNK---------------------------------GSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGN------------------AGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRG 6987
            G  G++G  G+RG  G  G  G RG  GP G  G PG+ G  G  GPVG AG  G  G                    G  GP G  G  GG G  G  G+ G PGS G  GAPG  G PG  G  G +G +G+PG+ G PG SG  GP GP G        G+KGD GP GP   PG  G PG  G +                     GS+G  G  GP                  +G  GS GP G  G+ GS G  G  G+ G PG+ G+ G  G+PG                                  PG+  + GP GP GER   G SG  G PG  GP G+SG        GN G  GLPG +G  G KG++                                 G  GP G  G  G  G +GP GPRG+ GD G+ GE G  G  G                   AG+ G  GA G+PG  G +GKD + G  G  GP G  GR G
Sbjct:  542 GAAGLQGMPGERGASGLPGAKGERGEAGPVGIAGGPGKDGPRGLSGPVGPAGPTGSNGER------------------GEGGPPGPAGPAGGRGAPGERGEPGPPGSAGFPGAPGADGMPGARGEAGETGARGEPGQAGPPGNSGPSGPVGPPGA------TGAKGDRGPAGP---PGATGFPGAAGRVGPPGSAGGPGAPGPAGPDGKDGSRGMRGETGPPGKSGEVGAAGPAGPPGEKGSSGSDGPAGPQGAPGSAGLAGSRGLVGMPGQRGERGFSGLPG---------------------------------APGEPGRQGPPGPAGER---GASGPAGPPGIPGPSGESGRD------GNPGSDGLPGRDGIQGNKGDRGPGGNAGPPGSPGPAGPPGAPGPAGNNGNKGEPGPAGPSGASGTTGARGPAGPAGPRGDKGDAGSAGEGGIKGHRGFSGLPGLPGPPGAPGDRGIAGVFGSAGARGLPGPTGPSGKDGISGNPGPAGPAGPRGRTG 992          

HSP 4 Score: 51.9878 bits (123), Expect = 3.066e-6
Identity = 187/556 (33.63%), Postives = 227/556 (40.83%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPR------------GNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXX---------------XXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGS------------------------KGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNG---------------------PSGTKGNKGSKGPYGKPGIA------------GDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
            GE G+ GP G TG PG  G  G  G  G  G  G  G  G              G  GP G +G PG +G+VG  GP+         G+ G+ G+ G  G  GP G  G RG  G  G+ G  G+ G+ G  G  G  G+ G PGE+G PG A   GP G +G PG+ G  G  G  GPRG  G                 G +G  G +G  G  G SG PG +G  G  G +G  G PG  GP+G+ G  GP G TGS                        +G  G  G AG PG PG DG  G                                         G+  + G +G  G+ GPPG SG  G  G  G  G  G +GP GPPG +   G PG+ G                       G++G +G  GP GK G              G +G+ GP GP+G  G  G  G +G VG  G  G RG +G PG PG+ G  G     G +G  GP G  G  GP G +G  G PGS GL G  G  G
Sbjct:  350 GEAGLPGPRGSTGSPGHAGSDGKTGPPGPAGNDGSPGSPGAAGARGAPGAMGFPGAKGPSGESGKPGEKGSVGPVGPI---------GLPGKDGDAGPAGPAGPAGPGGERGEAGPVGAPGFQGLPGAPGAPGESGKAGEPGLPGENGMPGGA---GPRGERGAPGERGESGAGGPPGPRGSNGAPGQDGSRGAAGPPGPAGTVGAAGLQGMPGERGASGLPGAKGERGEAGPVGIAGGPGKDGPRGLSGPVGPAGPTGSNGERGEGGPPGPAGPAGGRGAPGERGEPGPPGSAGFPGAPGADGMPGAR---------------------------------------GEAGETGARGEPGQAGPPGNSGPSGPVGPPGATGAKGDRGPAGPPGAT---GFPGAAGRVGPPGSAGGPGAPGPAGPDGKDGSRGMRGETGPPGKSGEVGAAGPAGPPGEKGSSGSDGPAGPQGAPGSAGLAGSRGLVGMPGQRGERGFSGLPGAPGEPGRQGPPGPAGERGASGPAGPPGIPGPSGESGRDGNPGSDGLPGRDGIQG 851          

HSP 5 Score: 50.8322 bits (120), Expect = 6.651e-6
Identity = 101/262 (38.55%), Postives = 122/262 (46.56%), Query Frame = 1
Query: 6301 GILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGS---------------------KGPYGKPGIAGDNGASGPQGPRGENGD------------LGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRG 6987
            G +G PGPRG +G  G  G  G  G  G PG  G AG  G     G  G+ G  G  G  G PG  G+ G  G  G PG +  PG +GP GERG  G +G  G  G+ G PG++GL GP G  G+ G  G  G  GP G  GN GS                     KGP G+ G  G+ G+ GP GP G  G              G  GE+G  G VG  G +G+ GAPG PG+ G+ G+  + G  G  G  G  G RG
Sbjct:  242 GSVGPPGPRGASGEPGLNGNKGEPGAKGDPGPSGSAGPSG---PTGAAGKRGGRGEPGSGGPPGPVGERGAPGSRGAPGGDGSPGAKGPPGERGATGPAGAKGNSGDPGRPGEAGLPGPRGSTGSPGHAGSDGKTGPPGPAGNDGSPGSPGAAGARGAPGAMGFPGAKGPSGESGKPGEKGSVGPVGPIGLPGKDGDAGPAGPAGPAGPGGERGEAGPVGAPGFQGLPGAPGAPGESGKAGEPGLPGENGMPGGAGPRGERG 500          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005318.1 (pep scaffold:Pmarinus_7.0:GL477895:43798:56979:-1 gene:ENSPMAG00000004829.1 transcript:ENSPMAT00000005318.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 129.798 bits (325), Expect = 1.038e-30
Identity = 83/251 (33.07%), Postives = 125/251 (49.80%), Query Frame = 1
Query: 8509 FPVRTVRRDLLND-DA---LAVKYLGSDV--VKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASD-VTEYRS-WFGE-ITGTFKFDY-------QIEASQLMFLKLFSTNARQRITINC----SRLSVVGNSEHPVILYSDHDEEVLRNG-DLFKYSVIRDGCKNSAEIIDSTELEMDTEA-IRLPIRDIA-LNTGSSKEQQQFGLDIGQVCF 9192
            +P R    + L + DA   + +K L + +  +  P GTK  PAR+C+ L+  + + + G Y+IDPN G   DA +V C  +  E+C+  K  +   K+W ++    E++  WFGE + G F F Y        I   QL FL+L +  A Q IT  C    +     G+    V L    + E+  +G + F YS++ DGC         T L+  T    RLPI DIA L+ G    +Q+FG++IG VCF
Sbjct:  362 YPYRYRADEALKEHDAEVDVTLKSLTNQLENIMSPEGTKTDPARSCRDLMLCHSDWKSGEYWIDPNEGSVLDAMKVWCNMETGETCVYPKPKNVPSKNWWSNKGSREHKHVWFGEAMPGGFHFSYGDDTMSANIAEVQLNFLRLVAAEASQNITYLCRNSVAYADAAGSLRKAVRLMGSGELELRADGKNRFTYSMLEDGCAKHTGEWGKTVLQYKTNKPSRLPIVDIAPLDIGGP--EQEFGVEIGPVCF 610          

HSP 2 Score: 92.4337 bits (228), Expect = 7.630e-19
Identity = 66/244 (27.05%), Postives = 113/244 (46.31%), Query Frame = -3
Query:  229 DEDEDIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCIEPEVVNYKKTSYTKTISS------WFSVLASLNKQISY-------KIPKEQLVFXXXXXXXXXXXXXXSCDQIALVSDDSITQDIRYNNSVQLFGDDNQILTVNNEDDLFQYKVVEDTC-KDKSNNGRAVIKVEXXXXXXXXXXXLNFKSIENSRPAM-IGIEIGPVCF 915
            + D ++   L  L++ ++N+  P G+K  PARSC D+   + +  +G ++IDPN G   DA+ V CN +  ETC+ P+  N    ++     S      WF          SY        I + QL FL+L +  +SQ +T  C      +D + +       +V+L G     L  + ++  F Y ++ED C K     G+ V++ +    +   +  ++   ++   P    G+EIGPVCF
Sbjct:  374 EHDAEVDVTLKSLTNQLENIMSPEGTKTDPARSCRDLMLCHSDWKSGEYWIDPNEGSVLDAMKVWCNMETGETCVYPKPKNVPSKNWWSNKGSREHKHVWFGEAMPGGFHFSYGDDTMSANIAEVQLNFLRLVAAEASQNITYLCRNSVAYADAAGS----LRKAVRLMGSGELELRADGKNR-FTYSMLEDGCAKHTGEWGKTVLQYK--TNKPSRLPIVDIAPLDIGGPEQEFGVEIGPVCF 610          

HSP 3 Score: 85.8853 bits (211), Expect = 7.506e-17
Identity = 116/360 (32.22%), Postives = 154/360 (42.78%), Query Frame = 1
Query: 5986 GSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGP---QGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGST 7056
            G+ G+DG  G  G  G PGE G+PG  G+ G  G +G+ G +                        G++G  G  G SG  G  G  G+ G  G +G PG  GP G LG  GP G  G +G+ G +G  G+ G PG+ G+ G  G                                    T G + + G  G  G+RG PG                       G PGN G  G PG +G +G  G++G  GP G  GI G  G++GP   QGP G +G+ G++GE+G  G  G +G +G+ G PG  G  G  G +   G +G  GP G  G+ G  G  G  GP G  G  G+ GS 
Sbjct:   47 GAQGKDGSMGPRGDTGTPGEPGEPGPTGLLGNQGERGERGPS------------------------GTRGTAGAPGSSGFLGSHGIQGLSGQRGERGVPGLNGPTGSLGKSGPTGEQGERGAPGNVGSPGLNGAPGESGREGSSG------------------------------------TDGASGRDGLAGVRGDRGEPGTP---------------------GRPGNPGNMGNPGLSGANGKDGHRGETGPQGDSGIVGRPGSAGPLGPQGPNGAHGERGDSGERGIKGHRGWSGFQGLPGLPGPHGHQGGPGINGGSGPRGPTGPAGGRGKDGHNGQAGPLGPSGHRGRPGEAGSA 325          

HSP 4 Score: 75.485 bits (184), Expect = 1.210e-13
Identity = 117/341 (34.31%), Postives = 140/341 (41.06%), Query Frame = 1
Query: 6211 GPSGSPGLRGNPGVIGSLGSQGFPGA------------------RGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGV 7179
            GPSG  G +G  G +G +G  GFPGA                   G QG  GS GPRG TG+            PG PG+ G  G +G                                              QG  GERGP G  G  G PG+ G  G  G+Q   G  G  G+RG+PG NGP+G+ G  G  G  G+ G  G+ G+ G  G  GE+G  G++G  G  G  G AG+RG  G PG PG+ G  G     G  G  G  G  G  GPQG +GI G PGS G  G  G  G  G              G  G  G KG +G  G  G PG+
Sbjct:    2 GPSGEGGPKGALGEVGGMGMTGFPGAPGESGTGGPPGGIGPQGASGAQGKDGSMGPRGDTGT------------PGEPGEPGPTGLLGN---------------------------------------------QGERGERGPSGTRGTAGAPGSSGFLGSHGIQ---GLSGQRGERGVPGLNGPTGSLGKSGPTGEQGERGAPGNVGSPGLNGAPGESGREGSSGTDGASGRDGLAGVRGDRGEPGTPGRPGNPGNMGNPGLSGANGKDGHRGETGPQGDSGIVGRPGSAGPLGPQGPNGAHGE------------RGDSGERGIKGHRGWSGFQGLPGL 270          

HSP 5 Score: 70.8626 bits (172), Expect = 3.323e-12
Identity = 72/180 (40.00%), Postives = 93/180 (51.67%), Query Frame = 1
Query: 6652 GPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            GP G  GN G+RG  G +G  GT G  GS G  G  GI G +G  G +G  G NG  G+ G+ GP GE G  G  G  G+PG+ G  GE+G++   G  G  G  G +G RG +G  G  G PG+ G  G+ G +G  G+ G  G              G +GD G+ G PG+ G +GPQ
Sbjct:   71 GPTGLLGNQGERGERGPSGTRGTAGAPGSSGFLGSHGIQGLSGQRGERGVPGLNGPTGSLGKSGPTGEQGERGAPGNVGSPGLNGAPGESGREGSSGTDGASGRDGLAGVRGDRGEPGTPGRPGNPGNMGNPGLSGANGKDGHRGET------------GPQGDSGIVGRPGSAGPLGPQ 238          

HSP 6 Score: 66.2402 bits (160), Expect = 8.697e-11
Identity = 92/258 (35.66%), Postives = 120/258 (46.51%), Query Frame = 1
Query: 5677 TGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQ---GILGSP------GPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGI 6423
            +G  G  G +G +GD G  G  G+ G  G  GN G +G  G  G RGT G+PG  G  G  G+QG+SG+                G RG  G  G  G LG  G  G+ G  G+ G  G+PG +G PG++G +G SG  G  G+ G  G                    G +G+ G  G  G+PG  GNPG+ G+ G  G  G  GPQ   GI+G P      GP+G  G+ G +G  G  G+ G  G  G  G  G+
Sbjct:   46 SGAQGKDGSMGPRGDTGTPGEPGEPGPTGLLGNQGERGERGPSGTRGTAGAPGSSGFLGSHGIQGLSGQ---------------RGERGVPGLNGPTGSLGKSGPTGEQGERGAPGNVGSPGLNGAPGESGREGSSGTDGASGRDGLAGVR------------------GDRGEPGTPGRPGNPGNMGNPGLSGANGKDGHRGETGPQGDSGIVGRPGSAGPLGPQGPNGAHGERGDSGERGIKGHRGWSGFQGLPGL 270          

HSP 7 Score: 63.929 bits (154), Expect = 5.135e-10
Identity = 120/402 (29.85%), Postives = 151/402 (37.56%), Query Frame = 1
Query: 5734 GRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGAS------------GPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIP 6903
            G  GKDG +GPRG+      TG PG  G  G  G +GN G  G +G SG                                G  G+ G  G+ GS G +G  G+ G+ G  G++GP+G  G  G T                        G +G+ G  G  GSPGL G PG  G  GS G  GA G  G+ G  G RG  G+ G  G  G  G PG  G +GK G  G                                          + GPQG  G  G PG +                  GP+GP G +G  G  G +G  G KG++G  G  G PG+ G +G              GP GP G  G  G+ G+ GP+G  G+ G  G  G+ G  
Sbjct:   47 GAQGKDGSMGPRGD------TGTPGEPGEPGPTGLLGNQGERGERGPSGTR------------------------------GTAGAPGSSGFLGSHGIQGLSGQRGERGVPGLNGPTGSLGKSGPT------------------------GEQGERGAPGNVGSPGLNGAPGESGREGSSGTDGASGRDGLAGVRGDRGEPGTPGRPGNPGNMGNPGLSGANGKDGHRG------------------------------------------ETGPQGDSGIVGRPGSA------------------GPLGPQGPNGAHGERGDSGERGIKGHRGWSGFQGLPGLPGPHGHQGGPGINGGSGPRGPTGPAGGRGKDGHNGQAGPLGPSGHRGRPGEAGSAGPA 328          

HSP 8 Score: 62.7734 bits (151), Expect = 9.492e-10
Identity = 99/304 (32.57%), Postives = 127/304 (41.78%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGV------------------------PGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGT---VGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARG---------------------PQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKA 6408
            TG PG  G  GPTG+                         G  G  G++G  GQRG  G  G+ GP G+LG  GPTG  G RG    VGSPG  G  G  G +G SG                          G+ G  G+ G  G  G PG+ G+ G PG  G+PG +G +G  G +G+ G  G+ G  GR                GS G +GP GP+G+ G RG+ G  G  G +G+ G +G                     P+G  G  G RG+ G  G  G +G +G  G PG+ G A
Sbjct:   61 TGTPGEPGEPGPTGLLGNQGERGERGPSGTRGTAGAPGSSGFLGSHGIQGLSGQRGERGVPGLNGPTGSLGKSGPTGEQGERGAPGNVGSPGLNGAPGESGREGSSG------------------------TDGASGRDGLAGVRGDRGEPGTPGRPGNPGNMGNPGLSGANGKDGHRGETGPQGDSGIVGRP---------------GSAGPLGPQGPNGAHGERGDSGERGIKGHRGWSGFQGLPGLPGPHGHQGGPGINGGSGPRGPTGPAGGRGKDGHNGQAGPLGPSGHRGRPGEAGSA 325          

HSP 9 Score: 61.6178 bits (148), Expect = 2.171e-9
Identity = 65/158 (41.14%), Postives = 79/158 (50.00%), Query Frame = 1
Query: 6712 SGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIG 7185
            SG +G  GS GP G  G  G+ G  GP G  G  G+ G  G  G  G  G  G  G  G+ GI G  G+ G+  V G     GP GS G+ GP G  G +G PG++G  G  G+ G  GR G  G  G  G  G  G  G +G+ G PG PG PG +G
Sbjct:   46 SGAQGKDGSMGPRGDTGTPGEPGEPGPTGLLGNQGERGERGPSGTRGTAGAPGSSGFLGSHGIQGLSGQRGERGVPGLN---GPTGSLGKSGPTGEQGERGAPGNVGSPGLNGAPGESGREGSSGTDGASGRDGLAGVRGDRGEPGTPGRPGNPGNMG 200          

HSP 10 Score: 61.6178 bits (148), Expect = 2.757e-9
Identity = 138/446 (30.94%), Postives = 174/446 (39.01%), Query Frame = 1
Query: 5722 KGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
            KG  G  G  G LG  G +G  G  GAPG  GT G PG +G  G  G Q                                          G+DG  G  G  G PGE G+PG  G+ G  G +G+ G +                        G++G  G  G SG  G  G  G+ G  G +G PG  GP G LG  GP G  G +G+ G +G  G+ G PG+ G+ G  G                                    T G + + G  G  G+RG PG              G+ G  G +G PG SG          +G  G++G  GP G  GI G  G++GP GP+G NG  G  G+ G  G  G+ G  G  G PG+PG  G  G   ++G  G  GP G +G RG  G  G  GP G  G +G  G  G
Sbjct:    1 KGPSGEGGPKGALGEVGGMGMTGFPGAPGESGTGGPPGGIGPQGASGAQ------------------------------------------GKDGSMGPRGDTGTPGEPGEPGPTGLLGNQGERGERGPS------------------------GTRGTAGAPGSSGFLGSHGIQGLSGQRGERGVPGLNGPTGSLGKSGPTGEQGERGAPGNVGSPGLNGAPGESGREGSSG------------------------------------TDGASGRDGLAGVRGDRGEPGTP------------GRPGNPGNMGNPGLSGA---------NGKDGHRGETGPQGDSGIVGRPGSAGPLGPQGPNGAHGERGDSGERGIKGHRGWSGFQGLPGLPGPHGHQGGPGINGGSGPRGPTGPAGGRGKDGHNGQAGPLGPSGHRGRPGEAG 323          

HSP 11 Score: 57.3806 bits (137), Expect = 4.632e-8
Identity = 128/416 (30.77%), Postives = 161/416 (38.70%), Query Frame = 1
Query: 5695 KGPLGVKGDKGQRGRMGKDGILGPRG------------NLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGAS------------GPQGPRGENGDLGNTGEQGPVGEVGNAG 6870
            KGP G  G KG  G +G  G+ G  G             +GPQG +GA G+ G++G  G  G  G PG  G +G                               LG +G  G+ G  G+ G  GAPG  G  G  GI G SG +G+ G  G                       G  G +G  GP+G  G RG PG +GS G  G PG  G +G  G+ G  GR G  G +G  G  G PG PG  G  G  G+ G NG                                G   + GPQG  G  G PG +                  GP+GP G +G  G  G +G  G KG++G  G  G PG+ G +G              GP GP G  G  G+ G+ GP+G  G+ G
Sbjct:    1 KGPSGEGGPKGALGEVGGMGMTGFPGAPGESGTGGPPGGIGPQGASGAQGKDGSMGPRGDTGTPGEPGEPGPTGL------------------------------LGNQGERGERGPSGTRGTAGAPGSSGFLGSHGIQGLSGQRGERGVPGLN---------------------GPTGSLGKSGPTGEQGERGAPGNVGSPGLNGAPGESGREGSSGTDGASGRDGLAGVRGDRGEPGTPGRPGNPGNMGNPGLSGANGKD------------------------------GHRGETGPQGDSGIVGRPGSA------------------GPLGPQGPNGAHGERGDSGERGIKGHRGWSGFQGLPGLPGPHGHQGGPGINGGSGPRGPTGPAGGRGKDGHNGQAGPLGPSGHRG 317          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009617.1 (pep scaffold:Pmarinus_7.0:GL476473:139194:170406:1 gene:ENSPMAG00000008685.1 transcript:ENSPMAT00000009617.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 131.339 bits (329), Expect = 1.330e-30
Identity = 79/255 (30.98%), Postives = 119/255 (46.67%), Query Frame = 1
Query: 8512 PVRTVRRD-----LLNDDA---LAVKYLGSDV--VKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASDVTEYRS-WFGE-ITGTFKFDY-------QIEASQLMFLKLFSTNARQ-----RITINCSRL-----SVVGNSEHPVILYSDHDEEVLRNGD-LFKYSVIRDGCKNSAEIIDSTELEMDTEAI-RLPIRDIA-LNTGSSKEQQQFGLDIG 9180
            P+R  R D     L   DA    ++K L   +  ++ P GT+  PARTC+ L   +P  + G Y+IDPN G   DA +V C  +  E+C+ +   +   K+W  S   + +  WFGE ++G   F+Y          A Q+ FL+L S  A        IT +C           GN +  ++L   +D E+   G+  F Y+V+ D C         T +E  T+   RLP  D+A ++ G     Q+FGLDIG
Sbjct:  635 PLRYYRSDQALPELRQHDAEVDASIKSLSGQIEGLRSPEGTRKNPARTCRDLKLCHPEWESGNYWIDPNQGCTLDALKVFCNMETGETCVYANPQTISRKNWWQSKSADRKHVWFGEAMSGGLHFNYGDDNLPANTAAIQMTFLRLLSMEAYDLPAAANITYHCKNSIAYMDEETGNLKKALLLQGSNDMEIRAEGNSRFTYNVLEDSCTKHTGEWGRTVVEYRTQKTSRLPFVDVAPMDVGGP--DQEFGLDIG 887          

HSP 2 Score: 89.7373 bits (221), Expect = 7.252e-18
Identity = 214/512 (41.80%), Postives = 251/512 (49.02%), Query Frame = 1
Query: 5671 GPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGR------------------RGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGD---PGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDI---GPMGPSGSPGLRGNPGVIGSLGSQGF----PGAR---GP---------QGILGSPGPRGRTGS------KGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMG 7068
            G  GVPG  G +GV G +G+RG  G+ G  GP+G  G +G  G PG                    G  G PG  G  G  G +G  G  G +G  G  G  G  G+ GP G  G  G  G KG  G  G  G  G RGAPGE G+   PG AG  GP G  G PG                    G  GE G KGD    GP GPSG+PG +G  GV G  G++G     PGAR   GP         QG  GSPGP G  G       +G  G +G AG PG  G  G  G+ G  G++GPPG  GP G  GL G  G  G PG  G  G PG    PGP G  G++G  G SG+ G PG VGPPG SG  G  G  GN+G  G PG +G +G KG +G  G  G+PG  G  GA GP GP G+NG  G+ G QGP+G  G +G RG+ G  G  G  GE G+    G KG+ G  G  G  GP G +G QG  GS+G  G  G +GP G
Sbjct:   80 GAQGVPGEAGKVGVSGARGERGFPGERGAPGPQGLQGARGLPGTPGTDGPKGATGPGGPPGAQGPPGLQGMPGERGATGISGAKGDRGDSGEKGPEGAPGKDGGRGVTGPIGPPGPAGAHGDKGDAGPAGPTGPSGARGAPGERGETGPPGPAGFAGPPGSDGQPGAK------------------GEQGETGQKGDAGAPGPQGPSGAPGPQGPNGVSGPKGARGAQGPPPGARALCGPAVDVAPVPFQGNPGSPGPAGPNGKDGPKGIRGDSGPVGRAGEPGLQGPIGAPGEKGDAGEDGPPGPDGPPGAQGLSGQRGIVGLPGQRGERGFPG---LPGPAGEPGKQGSTGASGERGPPGPVGPPGLSGPPGEQGREGNAGSDGAPGRDGAAGAKGERGEAGAAGQPGAPGSPGAPGPVGPTGKNGARGDQGPQGPMGPPGPSGARGLPGPQGPRGDKGETGEAGERGIKGHRGFTGLQGLPGPPGSSGDQGLAGSVGPSGPRGLSGPTG 570          

HSP 3 Score: 83.1889 bits (204), Expect = 8.231e-16
Identity = 55/219 (25.11%), Postives = 95/219 (43.38%), Query Frame = -3
Query:  334 EDEDIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCI--EPEVVNYKKTSYTKTISS---WFSVLASLNKQISY---KIPKE----QLVFXXXXXXXXXXXXXXSCDQIALVSDDSITQDIRYNNSVQLF----GDDNQILTVNNEDDL---------FQYKVVEDTC-KDKSNNGRAVIKV 912
             D ++  ++  LS  ++ L  P G++  PAR+C D++  +    +G ++IDPN G   DA+ V CN +  ETC+   P+ ++ K    +K+      WF    S     +Y    +P      Q+ F             LS +   L +  +IT   +  NS+       G+  + L +   +D+         F Y V+ED+C K     GR V++ 
Sbjct:  651 HDAEVDASIKSLSGQIEGLRSPEGTRKNPARTCRDLKLCHPEWESGNYWIDPNQGCTLDALKVFCNMETGETCVYANPQTISRKNWWQSKSADRKHVWFGEAMSGGLHFNYGDDNLPANTAAIQMTF----------LRLLSMEAYDLPAAANITYHCK--NSIAYMDEETGNLKKALLLQGSNDMEIRAEGNSRFTYNVLEDSCTKHTGEWGRTVVEY 857          

HSP 4 Score: 73.559 bits (179), Expect = 7.409e-13
Identity = 176/501 (35.13%), Postives = 205/501 (40.92%), Query Frame = 1
Query: 5653 GINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDG---------------ILGPRGNLGPQGPTG------APGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGY----PGSDGK------------RGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNP---------------GVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGS------------------------QGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGK 6927
            G+ G  G TG+ G KG  G  G+KG  G  GKDG                 G +G+ GP GPTG      APG RG  G PGP G AG PG  G  G  G QGE G +G  G PG +GP G  G QG  G+ G  G  G     PG+               +G PG  G  G  G DGP G++GD G                         +G  G+ G  GP G+PG +G+                G+ G  G  G PG RG +G  G PGP G  G +GS                        QG  G AG  G PG+DG AG  G                        + G+ G AG PG PG    PGP GP G+ G  G  G  G  G                PG SG RGLPG  GP G KG  G  G  G  G  G  G  G  GP G +GD      QG  G VG +G RG++G  G PGKDG NG+
Sbjct:  149 GMPGERGATGISGAKGDRGDSGEKGPEGAPGKDGGRGVTGPIGPPGPAGAHGDKGDAGPAGPTGPSGARGAPGERGETGPPGPAGFAGPPGSDGQPGAKGEQGETGQKGDAGAPGPQGPSGAPGPQGPNGVSGPKGARGAQGPPPGARALCGPAVDVAPVPFQGNPGSPGPAGPNGKDGPKGIRGDSGP------------------------VGRAGEPGLQGPIGAPGEKGDAGEDGPPGPDGPPGAQGLSGQRGIVGLPGQRGERGFPGLPGPAGEPGKQGSTGASGERGPPGPVGPPGLSGPPGEQGREGNAGSDGAPGRDGAAGAKG------------------------ERGEAGAAGQPGAPGSPGAPGPVGPTGKNGARGDQGPQGPMGP---------------PGPSGARGLPGPQGPRGDKGETGEAGERGIKGHRGFTGLQGLPGPPGSSGD------QGLAGSVGPSGPRGLSGPTGPPGKDGNNGQ 580          

HSP 5 Score: 70.8626 bits (172), Expect = 4.496e-12
Identity = 138/373 (37.00%), Postives = 162/373 (43.43%), Query Frame = 1
Query: 6184 GSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARG------------------------PQGILGSPGPRGRT---GSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGS---KGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGP-------VGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            G  G+ G +G SG+ G RG PG  G+ G QG  GARG                        P G+ G PG RG T   G+KG +G  G  G  G PGKDG  G  G  G  GP G  G                          G     GP GP G RG PG+                  +G  GPPG +G  G PGS+G  G KG +G    KG  G PG  G +GA GPQGP G +G  G  G QGP        G   +       G PG PG  G NGKD   G +G+ GP+G +G        G+QGP G+ G KGD G  GP G  G PG  G  G  G  G  G +G++G PG PG  G  G Q
Sbjct:   83 GVPGEAGKVGVSGARGERGFPGERGAPGPQGLQGARGLPGTPGTDGPKGATGPGGPPGAQGPPGLQGMPGERGATGISGAKGDRGDSGEKGPEGAPGKDGGRGVTGPIGPPGPAGAHGDK------------------------GDAGPAGPTGPSGARGAPGE------------------RGETGPPGPAGFAGPPGSDGQPGAKGEQGETGQKGDAGAPGPQGPSGAPGPQGPNGVSGPKGARGAQGPPPGARALCGPAVDVAPVPFQGNPGSPGPAGPNGKDGPKGIRGDSGPVGRAGE------PGLQGPIGAPGEKGDAGEDGPPGPDGPPGAQGLSGQRGIVGLPGQRGERGFPGLPGPAGEPGKQ 407          

HSP 6 Score: 62.7734 bits (151), Expect = 1.314e-9
Identity = 180/511 (35.23%), Postives = 207/511 (40.51%), Query Frame = 1
Query: 5845 NAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQD---------------------GYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPR---GRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTP-GKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGN---------------------SGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGAS---------------------GPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPG 7176
             AG PG QG+ G  G  G  G +G  G PG RG  G +G QG  G+ G+ G D                     G PG  G  G  G  GD G +G  GP G  G  G          RG  GP G  G  G  G KGD GP GP+G  G RG PG  G  G  G  G  GP G  G PG +   G TG KG  G  G  G  G PG  G  G  G  G  G  G P     +  P                 P G N + GP+G  G+ GP G++            G+ GLQGPIG PG                      SGQRG+ G  G  G +G  G  GP G+PG  G  GAS                     G +G  G +G  G  G  G  GE G AG  G  GAPG PG  G  G    +GA+G+ GP G  G  GP G  G+ GP G  G KG+ G  G  G                 G  GF G +GLPG PG+ G
Sbjct:   75 EAGKPGAQGVPGEAGKVGVSGARGERGFPGERGAPGPQGLQGARGLPGTPGTDGPKGATGPGGPPGAQGPPGLQGMPGERGATGISGAKGDRGDSGEKGPEGAPGKDG---------GRGVTGPIGPPGPAGAHGDKGDAGPAGPTGPSGARGAPGERGETGPPGPAGFAGPPGSDGQPGAKGEQGETGQKGDAGAPGPQGPSGAPGPQGPNGVSGPKGARGAQGPPPGARALCGPAVDVAPVPFQGNPGSPGPAGPNGKDGPKGIRGDSGPVGRA------------GEPGLQGPIGAPGEKGDAGEDGPPGPDGPPGAQGLSGQRGIVGLPGQRGERGFPGLPGPAGEPGKQGSTGASGERGPPGPVGPPGLSGPPGEQGREGNAGSDGAPGRDGAAGAKGERGEAGAAGQPGAPGSPGAPGPVGPTGKNGARGDQGPQGPMGPPGPSGARGLPGPQGPRGDKGETGEAGERG---------------IKGHRGFTGLQGLPGPPGSSG 549          

HSP 7 Score: 53.5286 bits (127), Expect = 9.526e-7
Identity = 162/473 (34.25%), Postives = 194/473 (41.01%), Query Frame = 1
Query: 5740 MGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQ---GGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXX------------XXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVI------------GSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNG-PSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGK------DGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGST 7056
            MG  G  G  G  G  G  G PG  G  G PG  G  G  G  G +G  G +GE G  GPPG  GL GP G  G     G  G+ G  G+ G  G+ G+RG PGE G PG  G+ G  G+ G PG  G  G +G  GP G             RG  GI G  G +GD G  GP G+PG  G  GV             G  G  G  G  GP G  G+PG RG TG  G  G  G  G  G PG  G+ G+ G                                      G    PGPQGP                        SG  GP GP G SG +G  G+ G P G +   G           G+ G+ GP GP G++G  G  G+ GPVG  G  G++G  GAPG  G        G +G     G  G  G +G  G+RG +G  G+ GP G  G +G  G++
Sbjct:    1 MGFPGPKGAGGEPGKPGEKGIPGAPGLRGLPGKDGETGAQGPPGPAGPAGERGEGGPPGPPGFQGLPGPSGPPGEAGKPGAQGVPGEAGKVGVSGARGERGFPGERGAPGPQGLQGARGLPGTPGTDGPKGATGPGGPPGAQGPPGLQGMPGERGATGISGAKGDRGDSGEKGPEGAPGKDGGRGVTGPIGPPGPAGAHGDKGDAGPAGPTGPSGARGAPGERGETGPPGPAGFAGPPGSDGQPGAKGEQGETGQK------------------------------------GDAGAPGPQGP------------------------SGAPGPQGPNGVSGPKGARGAQGPPPGARALCGPAVDVAPVPFQGNPGSPGPAGPNGKDGPKGIRGDSGPVGRAGEPGLQGPIGAPGEKGDAGEDGPPGPDGPPGAQGLSGQRGIVGLPGQRGERGFPGLPGPAGEPGKQGSTGAS 413          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Nematostella
Match: EDO42953 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S046])

HSP 1 Score: 149.443 bits (376), Expect = 1.172e-35
Identity = 73/218 (33.49%), Postives = 110/218 (50.46%), Query Frame = 1
Query: 8551 ALAVKYLGSDVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASDVTEYRSWFGE-ITGTFKFDYQIEASQLMFLKLFSTNARQRITINCSRLSVVGNSEHPVILYSDHDEEV-LRNGDLFKYSVIRDGCKNSAEIIDSTELEMDT-EAIRLPIRDIALNTGSSKEQQQFGLDIGQVCFS 9195
            AL    +  + ++KP G K+ PA+TCK L   +P+   G+Y+IDPN G   DA RV C      SCI S + +  L     ++V +   W  E      + DY  E SQ+ FL++FS  A Q +T NC       N +H + L  D+D     ++   F+ +VI + C    +    T L +DT +  RLPI D+AL     K  Q+  +++G VCF+
Sbjct: 1185 ALEKMEIDVNTIRKPTGMKNNPAKTCKDLRMDHPDYVSGYYWIDPNEGSKKDAIRVYCDFSNDFSCI-SPTKAKLLNLRVQANVNKKDKWLSEAFEEESQIDYSAEQSQIAFLRVFSKRAYQNVTYNCQNYKAWTNRKHSIKLRGDNDLIFHAKSPKKFQPTVILNECTTKDDQWHKTILAIDTKQKHRLPIVDMALFD-FGKPHQKVTVEVGSVCFA 1400          

HSP 2 Score: 105.531 bits (262), Expect = 2.460e-22
Identity = 60/236 (25.42%), Postives = 115/236 (48.73%), Query Frame = -3
Query:  226 PNDEDEDIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCIEP---EVVNYKKTSYTKTISSWFSVLASLNKQISYKIPKEQLVFXXXXXXXXXXXXXXSCDQIALVSDDSITQDIRYNNSVQLFGDDNQILTVNNEDDLFQYKVVEDTCKDKSNNGRAVIKVEXXXXXXXXXXXLNFKSIENSRPAM-IGIEIGPVCFS 921
            P++       AL ++   V+ + KP G K  PA++C D++ D+ +  +G ++IDPN G  KDAI V+C+F    +CI P   +++N +  +       W S       QI Y   + Q+ FL++ S+ + Q +T +C      ++          +S++L GD++ I    +    FQ  V+ + C  K +     I + +D  ++  +  ++    +  +P   + +E+G VCF+
Sbjct: 1175 PDNPSVSFMTALEKMEIDVNTIRKPTGMKNNPAKTCKDLRMDHPDYVSGYYWIDPNEGSKKDAIRVYCDFSNDFSCISPTKAKLLNLRVQANVNKKDKWLSEAFEEESQIDYSAEQSQIAFLRVFSKRAYQNVTYNCQNYKAWTN--------RKHSIKLRGDNDLIFHAKSPKK-FQPTVILNECTTKDDQWHKTI-LAIDTKQKHRLPIVDMALFDFGKPHQKVTVEVGSVCFA 1400          

HSP 3 Score: 102.064 bits (253), Expect = 2.932e-21
Identity = 199/509 (39.10%), Postives = 243/509 (47.74%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGK---------DGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPS---------GVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGP---------------QGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQV---GIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
            +G  G  G +GP G PG+ G  G  G++G++G  G           G  G  GNLG +G  G PGR G  G+PG  G+ G  G  G++G+             G  G  GP G +G +G  G +G+ G  G PG  GKRGA G  G PG  G  GPS         G+ G PG+ G PG  G  G  GP G  GI G  G+ G  G  G +G  G RG PG  G +GS+G  G+ GP               +G +G  GP G  G  GS+G  G  G PG  G +G+ G+    G  G  G  G  G  G  G PG  G  G PG  G PG  GK   PG  G  G+ G PGK              +  LQG  G PG SG  G  G+NG  G  G+ G +GP G  G +G  G+ G  G  G+NG+ G  GE+GPVG  G  G  G  G PG+PGK GE+G     G +G  G  G+ G RGPQG TG  G  G  G  GD GS G
Sbjct:  185 SGSAGRRGASGPPGSPGIDGFSGAPGEQGEKGEAGPSGPPGFPGLKGQKGEEGNLGERGMVGRPGRPGFDGAPGAPGSPGAEGKVGLTGQ------------TGPRGPTGPPGLQGVRGAPGNEGARGLPGNPGLKGKRGATGSRGSPGNQGPQGPSGPQGSKGQAGIDGRPGEPGLPGDKGAMGGPGPAGQPGIRGPSGAPGITGNPGATGINGDRGAPGRPGKIGSKGEKGSEGPNGSPGPRGAPGPPGKRGKIGRVGPMGPIGDPGSRGATGPRGFPGAAGPNGRKGEQGSPGAAGFPGSKGDKGSSGKNGEPGRVGLRGPPGQPGSPGREGKTGLPGDDGQDGKPGAPGKP------------DRLSLQGMTGMPGPSGVAGAKGANGEPGKDGDTGPQGPAGAKGESGLAGSRGMPGVAGKNGNAGEPGERGPVGPQGPQGAPGTQGPPGLPGKTGESGP---RGERGTDGKPGAMGERGPQGETGPTGLTGPTGKPGDRGSNG 666          

HSP 4 Score: 99.7525 bits (247), Expect = 1.418e-20
Identity = 196/537 (36.50%), Postives = 236/537 (43.95%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKG------------------QRGRMGKDGILGP------RGNLGPQGPTGAP---GRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQ---GPLGERGPPGKSXXXXXXXXXXXX-------------XQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGK---PGIAGDNGASGPQG---------PRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGA---------KGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
            TG PG  G  G  G PG  G +G KG+KG                  +RG++G+ G +GP      RG  GP+G  GA    GR+G  GSPG  G  G  G +G SG+       G  G  GL G  G  G  G +G  G+ G  GQDG PG+ GK   P      G  G+ GPSGV G  G                       GE G  GD GP GP+G+ G        G  GS+G PG  G  G  G PG RG  G +G QG  G  G PG PGK G++G  G                                G  G PG   + GPQ   GP G  GP GK GD G  G  G P             G+ G QGP G PG  G++G+PG++G  G  G KGS+G  G+   PGI G +GA G  G         P GE G+ G  G  G  G+ G+ G RG+ G PG PG++GE G     G          KG  G +GSSGR G  G  G +G  GS G +G  GS G
Sbjct:  377 TGNPGATGINGDRGAPGRPGKIGSKGEKGSEGPNGSPGPRGAPGPPGKRGKIGRVGPMGPIGDPGSRGATGPRGFPGAAGPNGRKGEQGSPGAAGFPGSKGDKGSSGK------NGEPGRVGLRGPPGQPGSPGREGKTGLPGDDGQDGKPGAPGK---PDRLSLQGMTGMPGPSGVAGAKGAN---------------------GEPGKDGDTGPQGPAGAKGES------GLAGSRGMPGVAGKNGNAGEPGERGPVGPQGPQGAPGTQGPPGLPGKTGESGPRG------------------------------ERGTDGKPGAMGERGPQGETGPTGLTGPTGKPGDRGSNGADGTPVSKHEFIRYFAIIGEPGAQGPSGNPGTPGRQGMPGASGRRGAPGAKGSRGERGRVGPPGIDGKDGAPGSDGLNGPPGPQGPAGEKGEAGQPGTNGFNGKNGDQGPRGLPGTPGAPGRNGEQGASGPTGPVGPRGPGGIKGAKGVMGSSGRPGITGTLGQRGRLGSKGGEGTPGSQG 847          

HSP 5 Score: 99.3673 bits (246), Expect = 2.161e-20
Identity = 222/569 (39.02%), Postives = 275/569 (48.33%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGP---RGNLGPQGPTGAPG------------------RRGTVGSPGPVGNAGHPGVQGISG----------RXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGA------------RGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGP---LGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGE------------NGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTP 7173
             GEPG +G TGP G  G KG  G+ G +G  G  GK+G  G    RG +GPQGP GAPG                   RGT G PG +G  G  G  G +G          R  N  +                GE G+QG  G  G+ G+ G PG+ G+RGAPG  G  G+ G  GP G+ G  G  G+ G +G  GP+GP G +G  G+ G+ G  G  G  G  GL G PG  G  G QG  G             +G +G++GS G  G TG+ G +G +G  G  GTPG  G  G  G PG+ GPPG PGP GP G  G  G++G  G  G  G PG++ +PG  G     GE G PG  G  G  G  G  G+ G +GP GPPG +G RG PGS G  G +G  G  G  G+PG  G  G +G  G  G  G+ G  G  G  G  G  G++G  G+PG PGK G+            NG+  V GAKG  G  G  G++GP G  G  GP      +GD G+ GP G  G  G  G  G  G PG +G +G  G+ G  G P
Sbjct:  551 NGEPGKDGDTGPQGPAGAKGESGLAGSRGMPGVAGKNGNAGEPGERGPVGPQGPQGAPGTQGPPGLPGKTGESGPRGERGTDGKPGAMGERGPQGETGPTGLTGPTGKPGDRGSNGADGTPVSKHEFIRYFAIIGEPGAQGPSGNPGTPGRQGMPGASGRRGAPGAKGSRGERGRVGPPGIDGKDGAPGSDGLNGPPGPQGPAGEKGEAGQPGTNGFNGKNGDQGPRGLPGTPGAPGRNGEQGASGPTGPVGPRGPGGIKGAKGVMGSSGRPGITGTLGQRGRLGSKGGEGTPGSQGMPGMSGPPGRPGPPGPPGPPGPSGPSGSNGRNGVKGSTGEGGRPGRDGEPGEPGTPGRDGEPGIPGPDGRPGERGPGGEIGRKGEKGPSGPPGITGNRGPPGSPGIKGERGYPGKDGRAGEPGAVGLRGPTGQPGENGLPGEPGKPGINGTNGRGGIPGLKGERGSPGEPGKAGKQGPPGPSGPLGANGEPGVQGAKGARGDDGKDGKQGPAGPQGPNGP------QGDKGNRGPRGEKGDKGFTGSDGSPGAPGQQGEQGPPGVAGTDGPP 1113          

HSP 6 Score: 93.9745 bits (232), Expect = 8.658e-19
Identity = 221/572 (38.64%), Postives = 268/572 (46.85%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPG--------MKGP------LGVKGDKGQRGRMGKDGILGPRGNLGPQG---PTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGP------------SGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQG---------ILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAG------------DNGASGPQGPRGENGDLGNTGE------QGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            G+PG  G  GP G PG        +KGP       G+KG  G  G  G  G+ GPRG+ GP+G     G PG  G+ G  G  G  G PG+ G SG PG QGE G  GP G PG  G +G+KG +G LG +G +G+ G PG DG  GAPG  G  GK G+ G              GV+G PG  G  G  G  G +G RG  G     GS G+ GP GPSG  G +G  G+ G  G  G PG +G  G         I G  G  G TG+ G+ G  G  G PG PGK G  G+ G  G NG PG  G  GP G                     K  + G  GP+G  G PG  G  G           G  G  GP G  G++G PG+ G  G+KG+KGS G  G+PG  G              G +G  G  G++G  G  G+      QG  G  G +G+ G  GA G PGKDG+ G     GAKG  G  GS      +GM G+ G  G+ G  G+ G  GP G  G PG  G PG+ G  G  G +G++G  G PG  G  GPQ
Sbjct:  112 GDPGPQGDQGPQGPPGGSTQAAGGIKGPDPNDLAAGIKGSNGAPGPRGSPGLPGPRGSDGPRGQRGEVGLPGESGSAGRRGASGPPGSPGIDGFSGAPGEQGEKGEAGPSGPPGFPGLKGQKGEEGNLGERGMVGRPGRPGFDGAPGAPGSPGAEGKVGLTGQTGPRGPTGPPGLQGVRGAPGNEGARGLPGNPGLKGKRGATG---SRGSPGNQGPQGPSGPQGSKGQAGIDGRPGEPGLPGDKGAMGGPGPAGQPGIRGPSGAPGITGNPGATGINGDRGAPGRPGKIGSKGEKGSEGPNGSPGPRGAPGPPG---------------------KRGKIGRVGPMGPIGDPGSRGATGP---------RGFPGAAGPNGRKGEQGSPGAAGFPGSKGDKGSSGKNGEPGRVGLRGPPGQPGSPGREGKTGLPGDDGQDGKPGAPGKPDRLSLQGMTGMPGPSGVAGAKGANGEPGKDGDTGPQGPAGAKGESGLAGS------RGMPGVAGKNGNAGEPGERGPVGPQGPQGAPGTQGPPGLPGKTGESGPRGERGTDGKPGAMGERGPQ 644          

HSP 7 Score: 89.3521 bits (220), Expect = 2.373e-17
Identity = 200/521 (38.39%), Postives = 242/521 (46.45%), Query Frame = 1
Query: 5680 GVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXEL-GSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAG------------DNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGN------IGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIG 7185
            G+ GM GP GV G KG  G  GKDG  GP+G  G +G +G  G RG  G  G  GNAG PG +G  G                   +GP+G  G+QG  G+ G  G+ G  G  G  G PG  G+ G  G  GP+G+ G  GK G+ G +G  G    +        + G  G  GP G  G+PG +G PG  G  G+ G  G+RG +G +G PG  G+ G+ GS G  G  G  G  G+ G+AGQ G  G N                                 GKN   GP+G  G  G PG++G+ G  G  GP G  G  G  G  G  G  G PG  G  G +G  GSKG  G PG  G              G  GP GP G +G  G  G +G  GE G  G  G  G PG PG+DGE G    DG  G       IG  G  G  GP G+TG +GPPGS G+KG+ G  G  GR       G+PG VG  GP G  G+ GLPG PG PG+ G
Sbjct:  534 GMTGMPGPSGVAGAKGANGEPGKDGDTGPQGPAGAKGESGLAGSRGMPGVAGKNGNAGEPGERGPVG------------------PQGPQGAPGTQGPPGLPGKTGESGPRGERGTDGKPGAMGERGPQGETGPTGLTGPTGKPGDRGSNGADGTPVSKHEFIRYFAIIGEPGAQGPSGNPGTPGRQGMPGASGRRGAPGAKGSRGERGRVGPPGIDGKDGAPGSDGLNGPPGPQGPAGEKGEAGQPGTNGFN---------------------------------GKNGDQGPRGLPGTPGAPGRNGEQGASGPTGPVGPRGPGGIKGAKGVMGSSGRPGITGTLGQRGRLGSKGGEGTPGSQGMPGMSGPPGRPGPPGPPGPPGPSGPSGSNGRNGVKGSTGEGGRPGRDGEPGEPGTPGRDGEPGIPGPDGRPGERGPGGEIGRKGEKGPSGPPGITGNRGPPGSPGIKGERGYPGKDGR------AGEPGAVGLRGPTGQPGENGLPGEPGKPGING 997          

HSP 8 Score: 84.3445 bits (207), Expect = 7.437e-16
Identity = 213/597 (35.68%), Postives = 261/597 (43.72%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGP--------------------------TGAPGRRGTVGSPGPVGN---------------------------AGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGP------------SGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGAR---------GPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGE---------RGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPG---------------SNGPSGTKGNKGSKGPYGKPG------------IAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGS------------SGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMG 7068
            G PG  G  GP+G  G  GPLG  G   Q G  G  G  GP+G+ GPQGP                           GAPG RG+ G PGP G+                            G PG+ G SG PG QGE G  GP G PG  G +G+KG +G LG +G +G+ G PG DG  GAPG  G  GK G+ G              GV+G PG     G  G  G  G +G RG  G  GS G+ GP GPSG  G +G  G+ G  G  G PG +         G  GI G  G  G TG+ G+ G  G  G PG PGK G  G+ G  G NG PG  G  GP G                    GK  + GP GP+G+         RG PG +G +G  G  G PG +G  G  G  G+SG+ G PG                 G +G  G+ G  G  G PG            + G +G +G +G  GE G  G+TG QGP G  G +G+ G  G PG+ GK+G  G+    G  G  GP G+            +G  GP+G  G  G PG++G +G  G TGP G
Sbjct:   79 GPPGDIGDQGPSGEAGKPGPLGYNG---QPGNQGMRGDPGPQGDQGPQGPPGGSTQAAGGIKGPDPNDLAAGIKGSNGAPGPRGSPGLPGPRGSDGPRGQRGEVGLPGESGSAGRRGASGPPGSPGIDGFSGAPGEQGEKGEAGPSGPPGFPGLKGQKGEEGNLGERGMVGRPGRPGFDGAPGAPGSPGAEGKVGLTGQTGPRGPTGPPGLQGVRGAPGNE---GARGLPGNPGLKGKRGATGSRGSPGNQGPQGPSGPQGSKGQAGIDGRPGEPGLPGDKGAMGGPGPAGQPGIRGPSGAPGITGNPGATGINGDRGAPGRPGKIGSKGEKGSEGPNGSPGPRGAPGPPGKR------------------GKIGRVGPMGPIGDPGSRGATGPRGFPGAAGPNGRKGEQGSPGAAGFPGSKGDKGSSGKNGEPGRVGLRGPPGQPGSPGREGKTGLPGDDGQDGKPGAPGKPDRLSLQGMTGMPGPSGVAGAKGANGEPGKDGDTGPQGPAGAKGESGLAGSRGMPGVAGKNGNAGEPGERGPVGPQGPQGAPGTQGPPGLPGKTGESGPRGERGTDGKPGAMGERGPQGETGPTG 651          

HSP 9 Score: 75.8702 bits (185), Expect = 2.864e-13
Identity = 174/446 (39.01%), Postives = 203/446 (45.52%), Query Frame = 1
Query: 6007 YPGSDGKRGAPGEHGD------PGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSG-----------------SPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGE---------VGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQ------------------GMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGF---KGDKGLPGNPGTPGVIG 7185
            YP   G+RG  G  GD       G+AG  GP G  G PG                    G+ G+ G +GD GP GP G                 + G++G+ G  G  GS G PG RG  G  G  G  G  G  GS G  G +G PG+PG DG +G  G  G+ G  G  GP G  GL G  G++G  G  G  G PG+    G  G  G  G  GK G  G  G  GP G  GLQG  G PGN G RGLPG+    G KG +G+ G  G PG  G  G SGPQG +G+ G  G  GE G  G+          G  GIRG +GAPGI G  G  G +   GA G  G IGS G +G +                  G  G  GP G IG  G  G+TGP G  G  G  G+ G  G PG  GF   KGDKG  G  G PG +G
Sbjct:   68 YPPVKGQRGPDGPPGDIGDQGPSGEAGKPGPLGYNGQPGNQ------------------GMRGDPGPQGDQGPQGPPGGSTQAAGGIKGPDPNDLAAGIKGSNGAPGPRGSPGLPGPRGSDGPRGQRGEVGLPGESGSAGRRGASGPPGSPGIDGFSGAPGEQGEKGEAGPSGPPGFPGLKGQKGEEGNLGERGMVGRPGRPGFDGAPGAPGSPGAEGKVGLTGQTGPRGPTGPPGLQGVRGAPGNEGARGLPGN---PGLKGKRGATGSRGSPGNQGPQGPSGPQGSKGQAGIDGRPGEPGLPGDKGAMGGPGPAGQPGIRGPSGAPGITGNPGATGINGDRGAPGRPGKIGSKGEKGSEGPNGSPGPRGAPGPPGKRGKIGRVGPMGPIGDPGSRGATGPRGFPGAAGPNGRKGEQGSPGAAGFPGSKGDKGSSGKNGEPGRVG 492          

HSP 10 Score: 63.5438 bits (153), Expect = 1.423e-9
Identity = 167/454 (36.78%), Postives = 200/454 (44.05%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGP------------RGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPI 6966
             G+PG NG  G  G    +GP G+ G  G  GR G+ G  GP            +G  G  G +G PG  GT+G  G +G+ G  G  G  G PG  G PG  GPPG PG  GP G  GS G  G+KGS G+ G PG DG+ G PG  G  G+ GI GP G                       G RG  GE+G KG+ GP GP G  G RG PG  G  G +G+PG  G  G  G+ G RG TG  G  G   + G PG PG +G  G+ GI                                          PG +G  G  G PGK+G  G PG  GP G +G           G +G  G+ G  G  G +G  GP G  G  GD G    +GPRGE GD G TG     G  G  G +G  G PG+ G DG        G +GN+GP+
Sbjct:  759 AGQPGTNGFNGKNGD---QGPRGLPGTPGAPGRNGEQGASGPTGPVGPRGPGGIKGAKGVMGSSGRPGITGTLGQRGRLGSKGGEGTPGSQGMPGMSGPPGRPGPPGPPGPPGPSGPSGSNGRNGVKGSTGEGGRPGRDGEPGEPGTPGRDGEPGIPGPDGRP---------------------GERGPGGEIGRKGEKGPSGPPGITGNRGPPGSPGIKGERGYPGKDGRAGEPGAVGLRGPTGQPGENG---LPGEPGKPGINGTNGRGGI------------------------------------------PGLKGERGSPGEPGKAGKQGPPGPSGPLGANG---------EPGVQGAKGARGDDGKDGKQGPAGPQGPNGPQGDKGN---RGPRGEKGDKGFTGSD---GSPGAPGQQGEQGPPGVAGTDGP------PGPRGNVGPM 1122          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Nematostella
Match: EDO44729 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV66])

HSP 1 Score: 127.872 bits (320), Expect = 3.702e-29
Identity = 107/342 (31.29%), Postives = 149/342 (43.57%), Query Frame = 1
Query: 8203 GSPGKPGTIGHPGWMGTVGNPGARGKSXXXXXXXXXXXXXXXXXXXXXXXQGSVGPTGTKGFPGENGSPGPVGMPGRDGPAXXXXXXXXXXXXXXXXXXAVFFPVRTVRRD---LLNDDALAVKYLGSDVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQR-KESCIESKSPSYKLKHWDASDVTEYRSWFGEITGTFKFDYQIEASQLMFLKLFSTNARQRITINCSRLSVVGNSEHPVILYSDHDEEVLRNGDLFKY-------SVIRDGCKNSAEIIDSTELEMDTEAIR-LPIRDIALNTGSSKEQQQFGLDIGQVCF 9192
            G+PG  G  G  G  GT G  G RGK G  G+                   G +G  GT G PG  GS G +G  G  G  G  G  G  GPPG PG P     +  ++++   ++ND          D  K PLG++  PA TC +L   N  ++DG Y+IDPN G + DA +V C+ +   ESC+         + W+ +    +   F ++   +K  Y     QL FL+L +T   Q+I + C  + V  +       YS        NG  F Y       +V+RD CK        TEL  +T  +R LPI D      S    ++FG+ I  VCF
Sbjct:  792 GNPGLLGRKGRQGEKGTAGRLGERGKKGPFGE------------------NGVLGKRGTLGPPGSPGSIGDMGAKGHPGSLGSKGRRGKLGPPGEPGKPGEILNLHLLKQNTHLIVNDKKSLYLSEMDDKSKTPLGSRANPALTCHELKHVN-GIKDGEYWIDPNQGCSSDAIKVYCKFKTGGESCVRPALKMIPKETWNNATTAGWYQ-FSKLERGYKITYLTNKVQLNFLRLLTTKVTQKIIVKCKSVVVWFHRHSKSYDYSWKFHGF--NGHQFTYNSSRSSLNVLRDACKYDDGRWRRTELLFETTKLRTLPIVDFTYYHRSLTTPEEFGVKIEPVCF 1111          

HSP 2 Score: 92.4337 bits (228), Expect = 2.112e-18
Identity = 186/469 (39.66%), Postives = 219/469 (46.70%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPL---GVKGDKGQRGRMGKDGILGPRGNLGPQGPTGA---------PGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXX------XXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPG-KAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGR---------------------TGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGK 6927
            +G  G  G  GP G+ G +GP+   GV G KG  G  G+ G+ G RG  GP GP GA         PG  G VG  GP G  G  GV G  G+PG  G  G +G  G        G RG  G +GS G  G+KG  G  G PG  G+ G PG+ G PG ++G+ G +G++G  G  G  G  G  G RG +G  G+ G+ GS+GD GP+G     G +G  G  G +G QG  G  G QG  G  GP+G+                      GSKG  G IG  G PG  G  G  G VG  G  G  G  G  G  G  G  G+ G PGP G  G  GK    GPQGP+G +G  G S                  GPIG  G  G  GL G  GP G  G  G KG  G+ G AG  G  G +GP GENG LG  G  GP G  G+ G  G  G PG  G  G  GK
Sbjct:  412 SGPRGALGHPGPQGLEGDRGPIGKPGVSGTKGNIGAKGRIGLQGDRGEQGPFGPKGAGGEMGSKGPPGDFGEVGVRGPNGELGSEGVPGEVGKPGPIGYQGREGFKGPNGLPGLPGKRGLRGSEGSTGVYGMKGMKGPIGVPGFRGQHGTPGDIGPPGSESGVPGKTGLRGPMGHKGPDGEKGYVGKRGEKGFMGLQGDQGSRGDRGPIGERAKDGEKGLKGETGPIGGQGLEGRTGVQGDDGIRGPQGKQGGVGPTGGHGPPGPMGDDGDAGSKGKAGKIGTKGEPGRKGSPGDIGYVGPKGFLGDVGPLGEKGGQGAYGPLGEPGGPGPKGGGGPKGKLGDRGPQGPVGIKGIRGAS------------------GPIGDSGIKGGYGLMGPRGPDGNPGLLGRKGRQGEKGTAGRLGERGKKGPFGENGVLGKRGTLGPPGSPGSIGDMGAKGHPGSLGSKGRRGK 862          

HSP 3 Score: 85.8853 bits (211), Expect = 2.313e-16
Identity = 61/223 (27.35%), Postives = 101/223 (45.29%), Query Frame = -3
Query:  229 LRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDR-LETCIEPEVVNYKKTSYTKTISSWFSVLASLNK--QISYKIPKEQLVFXXXXXXXXXXXXXXSCDQIALVSDDSITQDIRYNNSVQLFGDDNQILTVNNEDDLFQYKVVEDTCK-DKSNNGRAVIKVEXXXXXXXXXXXLNFKSIENSRPAMIGIEIGPVCF 885
            L LS + D    P GS+  PA +C ++ +      +G ++IDPN G   DAI V+C F    E+C+ P +    K ++    ++ +   + L +  +I+Y   K QL FL+L +   +Q + + C  + +           Y+ S +  G +    T N+        V+ D CK D     R  +  E  + R LPI D  +     + P   G++I PVCF
Sbjct:  895 LYLSEMDDKSKTPLGSRANPALTCHEL-KHVNGIKDGEYWIDPNQGCSSDAIKVYCKFKTGGESCVRPALKMIPKETWNNATTAGWYQFSKLERGYKITYLTNKVQLNFLRLLTTKVTQKIIVKCKSVVVWFH---RHSKSYDYSWKFHGFNGHQFTYNSSRS--SLNVLRDACKYDDGRWRRTELLFETTKLRTLPIVDFTYYHRSLTTPEEFGVKIEPVCF 1111          

HSP 4 Score: 83.1889 bits (204), Expect = 1.397e-15
Identity = 145/439 (33.03%), Postives = 178/439 (40.55%), Query Frame = 1
Query: 5689 GMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTG 7005
            G+ G  G  GD+G RG  G  G+LG RG  GP G  G  G +G VGS G +G  G  G +G  G  G +G  G  G PG  G  GP G  G +G +GI   IG+ G PG DG  G  GE          GP+G  G  G+                           KG +G +GPSG  G +G  G+ G  G  G  G +G  G  G PGP+G  G  G++G +G  G PG PG  G  G  G+                                           G QG +G +G  G                 G+ G  G  GN+G  G  G+ GP G KG  G  G  G PG  G NG  GP+      GDLG++G  GP          G  G PG PG  G  G   V G  G+IG  G  G  G +G+ G
Sbjct:    2 GLMGSRGTPGDQGGRGPQGVQGLLGDRGPRGPPGEQGFSGVKGAVGSHGLIGRKGEKGKEGRDGVKGERGSKGKSGLPGDKGPVGPPGHPGHKGAIGI---IGKSGSPGKDGSEGPTGE---------SGPTGALGAKGQ---------------------------KGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGGVGSIGPSGLQ------------------------------------------GFQGRMGLKGDAG---------------YDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGSRGLNGTRGPE------GDLGHSGLPGPP---------GFQGDPGKPGIRGHEGLQGVSGKAGSIGDPGDPGDEGNEGLPG 329          

HSP 5 Score: 82.8037 bits (203), Expect = 2.132e-15
Identity = 85/192 (44.27%), Postives = 104/192 (54.17%), Query Frame = 1
Query: 6544 MQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGP------QGPRGENGDLGN------TGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKD---AVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGS-IGLKGDIGSTGPMGR 7071
            M P    PL  RG  G SG  G  G+ GP G  G +GPIG PG SG +G  G+ G  G +G++G +GP+G  G  G+ G+ GP       G RG NG+LG+       G+ GP+G  G  G +G NG PG+PGK G  G +    V G KG  GPIG  G RG  G  G  GPPGS  G+ G  G  GPMG 
Sbjct:  395 MYPILSNPLLSRGAAGPSGPRGALGHPGPQGLEGDRGPIGKPGVSGTKGNIGAKGRIGLQGDRGEQGPFGPKGAGGEMGSKGPPGDFGEVGVRGPNGELGSEGVPGEVGKPGPIGYQGREGFKGPNGLPGLPGKRGLRGSEGSTGVYGMKGMKGPIGVPGFRGQHGTPGDIGPPGSESGVPGKTGLRGPMGH 586          

HSP 6 Score: 82.0333 bits (201), Expect = 3.306e-15
Identity = 132/337 (39.17%), Postives = 162/337 (48.07%), Query Frame = 1
Query: 6199 IGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGP------PGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            +G MG  G+PG +G     G  G QG  G RGP+   G PG +G +G KG+ G+ G+ G  G  GK+G+ G  G  G  G  G PG  GP+G PGHPG  G  G  G  G+PGK+   G +GP GE GP G          +G  GQ G  G IGP G  G +G  G  G +G  G  G KG  G  GI G  G  GP G +G  GD+G  G  G VG +G +G++G  G  G+ G  G +G D   G  GN G  G  G  GP G  GI G       PGS GL G  G  G +G                    G  G  G  G+PG PG+ G +
Sbjct:    1 MGLMGSRGTPGDQGGR---GPQGVQGLLGDRGPR---GPPGEQGFSGVKGAVGSHGLIGRKGEKGKEGRDGVKGERGSKGKSGLPGDKGPVGPPGHPGHKGAIGIIGKSGSPGKD---GSEGPTGESGPTG---------ALGAKGQKGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGSRGLNGTRGPEGDLGH------------------SGLPGPPGFQGDPGKPGIRGHE 301          

HSP 7 Score: 80.1073 bits (196), Expect = 1.276e-14
Identity = 110/270 (40.74%), Postives = 140/270 (51.85%), Query Frame = 1
Query: 6262 LGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRG-ENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAV---DGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
            L S+G  G  GP+G LG PGP+G    +G +G IG  GV GT G  G  G++G+             G  G  G  G  G  G  G  G PG   + G +GP GE G  G  G+ G PG +G  G+ G +GP G PG  G+RGL GS G +G  G KG KGP G PG  G +G  G  GP G E+G  G TG +GP+G       +G +G  G  GK GE G   +    G++G+ GPIG   + G +G+ G  GP G  GL+G  G  G
Sbjct:  403 LLSRGAAGPSGPRGALGHPGPQGL---EGDRGPIGKPGVSGTKGNIGAKGRIGL------------QGDRGEQGPFGPKGAGGEMGSKGPPGDFGEVGVRGPNGELGSEGVPGEVGKPGPIGYQGREGFKGPNGLPGLPGKRGLRGSEGSTGVYGMKGMKGPIGVPGFRGQHGTPGDIGPPGSESGVPGKTGLRGPMGH------KGPDGEKGYVGKRGEKGFMGLQGDQGSRGDRGPIGERAKDGEKGLKGETGPIGGQGLEGRTGVQG 651          

HSP 8 Score: 78.5666 bits (192), Expect = 3.729e-14
Identity = 170/488 (34.84%), Postives = 203/488 (41.60%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPS----GSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGP------------YGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
            G  G  GP G  GV G KG +G KG  G +G  G+ G  GP+G  G  G  G PG  G VG  GP G  G  GV G  G+PG  G                      QG  G KG  G  G PG  G RG+ G  G  G  G+ GP GV G  G+                         G+ GDIGP G      G  GLRG  G  G  G +G+ G RG +G +G  G +G  G +G  G     G  G  G+ G  G  G+ G+ G  G  G  GP G  G  G  G  GP G  G  G     G  G +G +G PG+                  +G  G  G  G +G  G  GP G KG +G+ GP             G  G  GD G  GP G +G  G  G  G+ G  G  G  G RG +G PG+ G+ G  G+    G  G  G  G  G  G  G  G  GPPGS G  GD+G+ G
Sbjct:  425 GLEGDRGPIGKPGVSGTKGNIGAKGRIGLQGDRGEQGPFGPKGAGGEMGSKGPPGDFGEVGVRGPNGELGSEGVPGEVGKPGPIG---------------------YQGREGFKGPNGLPGLPGKRGLRGSEGSTGVYGMKGMKGPIGVPGFRGQH------------------------GTPGDIGPPGSESGVPGKTGLRGPMGHKGPDGEKGYVGKRGEKGFMGLQGDQGSRGDRGPIGERAKDGEKGLKGETGPIGGQGLEGRTGVQGDDGIRGPQGKQGGVGPTGGHGPPGPMGDDGDAGSKGKAGKIGTKGEPGR------------------KGSPGDIGYVGPKGFLGDVGPLGEKGGQGAYGPLGEPGGPGPKGGGGPKGKLGDRGPQGPVGIKGIRGASGPIGDSGIKGGYGLMGPRGPDGNPGLLGRKGRQGEKGTAGRLGERGKKGPFGENGVLGKRGTLGPPGSPGSIGDMGAKG 849          

HSP 9 Score: 77.0258 bits (188), Expect = 1.156e-13
Identity = 165/493 (33.47%), Postives = 205/493 (41.58%), Query Frame = 1
Query: 5812 RGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAG------VPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGP---QGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPR------GENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGI------------------QGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            RG  G  GP G  GHPG QG+ G                       G  G  G  G KG+IG  G  G  G RG  G  G  G  G  G  G  GD G                        E+G +G  G +G  G PG  G PG IG  G +GF   +GP G+ G PG RG  GS+GS G  G+ G      VPG  G+ G  G +G                              P    G PGK    GP   +GP GE+G  GK G+ G  G  G  G  G +GPIG     G++GL G  GP G +G +      G+ G+ GD+G  GPQG +      G +G  G  G+ G  G  G AG  G  G PG  G  G+ G     G  G++GP+G  G +G  G  G                   +GP G +G+KG  G++GP+G  G+ G  G  G  GP G  G  G KG  G  GT G +G +
Sbjct:  406 RGAAGPSGPRGALGHPGPQGLEG---------------------DRGPIGKPGVSGTKGNIGAKGRIGLQGDRGEQGPFGPKGAGGEMGSKGPPGDFG------------------------EVGVRGPNGELGSEGVPGEVGKPGPIGYQGREGF---KGPNGLPGLPGKRGLRGSEGSTGVYGMKGMKGPIGVPGFRGQHGTPGDIG-----------------------------PPGSESGVPGKTGLRGPMGHKGPDGEKGYVGKRGEKGFMGLQGDQGSRGDRGPIGERAKDGEKGLKGETGPIGGQGLE------GRTGVQGDDGIRGPQGKQGGVGPTGGHGPPGPMGDDGDAGSKGKAGKIGTKGEPGRKGSPGDIGYVGPKGFLGDVGPLGEKGGQGAYGPLGEPGGPGPKGGGGPKGKLGDRGPQGPVGIKGIRGASGPIGDSGIKGGYGLMGPRGPDGNPGLLGRKGRQGEKGTAGRLGER 815          

HSP 10 Score: 75.485 bits (184), Expect = 3.766e-13
Identity = 116/314 (36.94%), Postives = 143/314 (45.54%), Query Frame = 1
Query: 6184 GSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGS------------------QGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGR 7071
            G +G +G  GP G PG +G  GV G++GS G  G +G +G  G  G +G  GSKG                   +G IGI G  G+PGKDG  G  G  G  G  G  G  G +G  G  G  G  G  G  G  G +   G +G  G  G PG                 G  GPIG  G  G  G PG  G  G+ G  G +G  G+ G+ GD G  G  G +G  G+ G  G QG +G +G  GI G  GAPG+PG  G NG       +G  G +G SG  GP    G QG PG  G++G  G  G  G+
Sbjct:   20 GVQGLLGDRGPRGPPGEQGFSGVKGAVGSHGLIGRKGEKGKEGRDGVKGERGSKGKSGLPGDKGPVGPPGHPGHKGAIGIIGKSGSPGKDGSEGPTGESGPTGALGAKGQKGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQ---------------GTMGPIGAKGILGDVGAPGMPGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGSRGLNG------TRGPEGDLGHSGLPGP---PGFQGDPGKPGIRGHEGLQGVSGK 309          

HSP 11 Score: 67.781 bits (164), Expect = 8.481e-11
Identity = 105/281 (37.37%), Postives = 127/281 (45.20%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDK------------------GQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGS---PGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGI 6423
            GE G  G  G  G  G KG  G+ GDK                  G+ G  GKDG  GP G  GP G  GA G++G VGS GP       G+QG  GR                              +G+KG     GY G DG +G  G  G PG  G  GP G KG  G  G PG  G  G  GP G +G  G +G KGD G  G  G  G  GN G+ G  G+ G  GA+G  G +G+   PG RG  G++G +G +G +G+PG PG  G  G+ GI
Sbjct:   56 GEKGKEGRDGVKGERGSKGKSGLPGDKGPVGPPGHPGHKGAIGIIGKSGSPGKDGSEGPTGESGPTGALGAKGQKGGVGSIGP------SGLQGFQGR------------------------------MGLKGDA---GYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGSRGLNGTRGPEGDLGHSGLPGPPGFQGDPGKPGI 297          

HSP 12 Score: 51.6026 bits (122), Expect = 6.848e-6
Identity = 98/261 (37.55%), Postives = 118/261 (45.21%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGK------------------DGILGPRGNLGPQGPTGAPGRRGT------VGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGS------IGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRT 6336
            GE G+ G TGP G  G++G  GV+GD G RG  GK                  DG  G +G  G  G  G PGR+G+      VG  G +G+ G  G +G  G  G  GEPG  GP G  G +G  G++G QG +GIKG       IG  G  G  G  G  G  G+PG  G  G  G KG  G+                        LG +G  GP G +G  G RG  G  GS GS G  GA+G  G LGS G RG+ 
Sbjct:  627 GEKGLKGETGPIGGQGLEGRTGVQGDDGIRGPQGKQGGVGPTGGHGPPGPMGDDGDAGSKGKAGKIGTKGEPGRKGSPGDIGYVGPKGFLGDVGPLGEKGGQGAYGPLGEPGGPGPKGGGGPKGKLGDRGPQGPVGIKGIRGASGPIGDSGIKGGYGLMGPRGPDGNPGLLGRKGRQGEKGTAGR------------------------LGERGKKGPFGENGVLGKRGTLGPPGSPGSIGDMGAKGHPGSLGSKGRRGKL 863          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Nematostella
Match: EDO33050 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STC3])

HSP 1 Score: 115.161 bits (287), Expect = 1.826e-25
Identity = 185/490 (37.76%), Postives = 230/490 (46.94%), Query Frame = 1
Query: 5656 INGPTGPTGVPGMKGPLGVKGDKGQRG---RMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXX---SQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLP------GSNGPSGTKGNKGSKGPYGKPGIAGD---NGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNI---GPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGR 7071
            I GP G  G PG  G  GV+G KG+RG     G  G++GP G  GP+G  G PG++G  G+ G  G  G PG  G+ G  G  G+ G +GP G+ GL G  G +G    QG  G+KG++G  G  G  G++G  G  G  G+ G  G SG+ GD                  +G  G  G  G KG IG +G SGSPG  G+ G  G  G  G  GA+G +G +GS GP G  G +G  G  G AG  G  G  G AG  GI                                          PGPQG +G   P G  G  G  G  G PG  GL G  GP G+ G  GLP      G  G  G +G++G +G  GK G  GD    G  G +GP GE G  G+ G++G  G  G+ GI G+ G PG+ GKDG+ G     G +G +   GP G  G RGP G  G+ G  G+IG KG IG  G  G 
Sbjct:  289 IKGPQGLKGRPGYAGHQGVQGAKGKRGLPGEAGSPGLVGPVGLPGPEGIQGDPGQKGFEGAKGIKGFPGSPGSMGLMGSRGTPGDQGGRGPQGVQGLLGDRGPRGPPGEQGFRGVKGAVGSHGLIGRKGEKGKEGRDGVKGERGSKGKSGLPGD------------------KGPVGPPGHPGHKGAIGIIGKSGSPGKDGSEGPTGESGPTGALGAKGQKGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGI------------------------------------------PGPQGTMG---PIGAKGILGDVGAPGMPGSRGLNGTRGPEGDLGHSGLPGPPGFQGDPGKPGIRGHEGLQGVSGKAGSIGDPGKKGNIGEKGPSGEQGMKGDPGDEGNEGLPGDIGIIGMQGPPGVTGKDGQQGAAGPSGPRGALGHPGPQGLEGDRGPIGKPGVSGTKGNIGAKGRIGLQGDRGE 715          

HSP 2 Score: 112.464 bits (280), Expect = 1.198e-24
Identity = 193/498 (38.76%), Postives = 233/498 (46.79%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDG---------PSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPG---PRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGN---------KGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGS-IGLKGDIGSTGPMGR 7071
            G  GI G  G  G  G+ G  G  GD+G RG  G  G+LG RG  GP G  G  G +G VGS G +G  G  G +G  G  G +G  G  G PG  G  GP G  G +G +GI   IG+ G PG DG  G  GE G  G  G  G         PSG++G  G+                        +G KGD G  G  G  G  GN G+ G  G+ G  GA+G  G +G+PG    RG  G++G +G +G +G+PG PG  G  G+ GI G  G  G  G  G IG                   PGK    G +GP GE+G  G  GD+G  G  G  G  G+QGP   PG +G+ G  G+ GPSG +G          +G +GP GKPG++G  G  G +G  G  GD    GEQGP G  G  G  G  G P      G  G   V G KG  GPIG  G RG  G  G  GPPGS  G+ G  G  GPMG 
Sbjct:  348 GAKGIKGFPGSPGSMGLMGSRGTPGDQGGRGPQGVQGLLGDRGPRGPPGEQGFRGVKGAVGSHGLIGRKGEKGKEGRDGVKGERGSKGKSGLPGDKGPVGPPGHPGHKGAIGI---IGKSGSPGKDGSEGPTGESGPTGALGAKGQKGGVGSIGPSGLQGFQGR------------------------MGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGSRGLNGTRGPEGDLGHSGLPGPPGFQGDPGKPGIRGHEGLQGVSGKAGSIG------------------DPGKKGNIGEKGPSGEQGMKGDPGDEGNEGLPGDIGIIGMQGP---PGVTGKDGQQGAAGPSGPRGALGHPGPQGLEGDRGPIGKPGVSGTKGNIGAKGRIGLQGD---RGEQGPFGPKGAGGDMGSKGPP------GSEGSTGVYGMKGMKGPIGVPGFRGQHGTPGDIGPPGSESGVPGKTGLRGPMGH 788          

HSP 3 Score: 108.227 bits (269), Expect = 2.728e-23
Identity = 155/467 (33.19%), Postives = 190/467 (40.69%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPG----------IPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQ 7011
            +G PG +G  GPTG  G  G LG KG KG  G +G  G+ G +G +G +G  G  G  G  G     GN G PG QG  G                             G  GI G +G  G PGS G  G  G  GD G +G+ GP G +GDPGK                         G +G  G  G SG  G  G+PG  G++G +G     G QG+ G PG  G  G  G  G IG+ G PG  GKDG+ G  G                                            GP+G LG  GP G                 G +GPIG PG SG +G  G+ G  G +G++G +GP+G  G  GD G+ GP G  G  G  G  G +GP+G     G RG +G PG          +PGK G  G     G KG  G  G  G+RG +G  G Q
Sbjct:  464 SGSPGKDGSEGPTGESGPTGALGAKGQKGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGH---AGNTGIPGPQGTMG---------------------------PIGAKGILGDVGAPGMPGSRGLNGTRGPEGDLGHSGLPGPPGFQGDPGKP------------------------GIRGHEGLQGVSGKAGSIGDPGKKGNIGEKG---PSGEQGMKGDPGDEGNEGLPGDIGIIGMQGPPGVTGKDGQQGAAGPS------------------------------------------GPRGALGHPGPQG---------------LEGDRGPIGKPGVSGTKGNIGAKGRIGLQGDRGEQGPFGPKGAGGDMGSKGPPGSEGSTGVYGMKGMKGPIG---VPGFRGQHGTPGDIGPPGSESGVPGKTGLRGP---MGHKGPDGEKGYVGKRGEKGFMGKQ 810          

HSP 4 Score: 97.8265 bits (242), Expect = 4.270e-20
Identity = 148/434 (34.10%), Postives = 184/434 (42.40%), Query Frame = 1
Query: 5965 QGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAG---IDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKG------------PYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNI---------GPIGSSGRRGPQGMTGIQGPPGSI---GLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIG 7185
            QG  G  G  G  G  G+ GKRG PGE G PG  G   + GP G++GDPG+                           KG  G  G  G PG  G+ G++GS G+ G  G RGPQG+ G  G RG  G  G QG  G+ G  G+ G  G+ G+ G                                      G++   G +G  G+ G PG  G  G PG+ G  G  G+ G  G PG  G  G  G +GP+G  G KG KG              G+ G+ GD G  G  G +G  G+ G  G QG +G +G  GI G  GAPG+PG  G NG    +G  G+          G  G  G RG +G+ G+ G  GSI   G KG+IG  GP G                   +G KGD G  GN G PG IG
Sbjct:  293 QGLKGRPGYAGHQGVQGAKGKRGLPGEAGSPGLVGPVGLPGPEGIQGDPGQ---------------------------KGFEGAKGIKGFPGSPGSMGLMGSRGTPGDQGGRGPQGVQGLLGDRGPRGPPGEQGFRGVKGAVGSHGLIGRKGEKG------------------------------------KEGRDGVKGERGSKGKSGLPGDKGPVGPPGHPGHKGAIGIIGKSGSPGKDGSEGPTGESGPTGALGAKGQKGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGSRGLNGTRGPEGDLGHSGLPGPPGFQGDPGKPGIRGHEGLQGVSGKAGSIGDPGKKGNIGEKGPSGE------------------QGMKGDPGDEGNEGLPGDIG 645          

HSP 5 Score: 97.8265 bits (242), Expect = 4.270e-20
Identity = 169/432 (39.12%), Postives = 205/432 (47.45%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPP---GNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRG-ENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENG 6924
            +G PG  GP GP G PG KG +G+    G+ G  GKDG  GP G  GP G  GA G++G VGS GP G  G  G  G+ G  G  G  G +G  G  G+ GP+G  G  G  GI G +G  G PGS G  G  G  GD G +G+ GP G +GDPGK                         G +G  G  G SG  G  G+PG  G++G +   G  G QG+ G PG  G  G  G  G IG+ G PG  GKDG+ G  G                             GP G  G PG     G +GP+G+ G  G  G+ G  G +G  G  G QGP GP    G+ G +G PGS G +G  G KG KGP G PG  G +G  G  GP G E+G  G TG +GP+G       +G +G  G  GK GE G
Sbjct:  437 SGLPGDKGPVGPPGHPGHKGAIGI---IGKSGSPGKDGSEGPTGESGPTGALGAKGQKGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGSRGLNGTRGPEGDLGHSGLPGPPGFQGDPGKP------------------------GIRGHEGLQGVSGKAGSIGDPGKKGNIGEK---GPSGEQGMKGDPGDEGNEGLPGDIGIIGMQGPPGVTGKDGQQGAAG---------------------------PSGPRGALGHPGPQGLEGDRGPIGKPGVSGTKGNIGAKGRIGLQGDRGEQGPFGPKGAGGDMGSKGPPGSEGSTGVYGMKGMKGPIGVPGFRGQHGTPGDIGPPGSESGVPGKTGLRGPMGH------KGPDGEKGYVGKRGEKG 805          

HSP 6 Score: 86.2705 bits (212), Expect = 1.604e-16
Identity = 197/560 (35.18%), Postives = 231/560 (41.25%), Query Frame = 1
Query: 5704 LGVKGDKGQRGRMGKDG------------------------ILGPR------GNLGPQGPTGAPGRRGT---VGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKG---------------SQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGP------YGKPGIAGDNGASGPQGPRGENGD---LGNTGEQGPVGE---------VGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIG 7185
             G +G KG+ G  G+ G                        I GP+      G  G QG  GA G+RG     GSPG VG  G PG +GI G                             G  G +G+ G  G+PGS G  G  G  G PG  G  GP GV+                              G  GD GP GP G  G RG  G +GS G  G  G +G +G  G  G RG  G  G                +G IGI G  G+PGKDG  G  G  G  G  G  G  G +G  G  G  G  G  G  G  G +   G +G  G  G PG  G  G  G        G+ G +G PG  G RGL G+ GP G  G+ G  GP       GKPGI G  G  G  G  G  GD    GN GE+GP GE          GN G+ G  G  G+ G  G  GKD   GA G  GP G+ G  GPQG+ G +GP G  G+ G  G+ G  GRIG+ G  G+ G  GP G  G  G KG PG+ G+ GV G
Sbjct:  248 RGYRGPKGEPGPKGEPGYKVCIGLYRESHSYQKAIEIAYQLIKGPQGLKGRPGYAGHQGVQGAKGKRGLPGEAGSPGLVGPVGLPGPEGIQG---------------------------DPGQKGFEGAKGIKGFPGSPGSMGLMGSRGTPGDQGGRGPQGVQ------------------------------GLLGDRGPRGPPGEQGFRGVKGAVGSHGLIGRKGEKGKEGRDGVKGERGSKGKSGLPGDKGPVGPPGHPGHKGAIGIIGKSGSPGKDGSEGPTGESGPTGALGAKGQKGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGA------KGILGDVGAPGMPGSRGLNGTRGPEGDLGHSGLPGPPGFQGDPGKPGIRGHEGLQGVSGKAGSIGDPGKKGNIGEKGPSGEQGMKGDPGDEGNEGLPGDIGIIGMQGPPGVTGKDGQQGAAGPSGPRGALGHPGPQGLEGDRGPIGKPGVSGTKGNIGAKGRIGLQGDRGEQGPFGPKGAGGDMGSKGPPGSEGSTGVYG 744          

HSP 7 Score: 77.411 bits (189), Expect = 7.236e-14
Identity = 97/255 (38.04%), Postives = 119/255 (46.67%), Query Frame = 1
Query: 6532 PGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQG---PRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGN------------------------------IGPIGSSGRRGPQGMTGIQGPPGSIGLKGD---IGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGP 7188
            PG     G QG  G+RG PG++G              GL GP+G PG  G +G PG  G  G KG KG  G  G  G+ G  G  G QG   P+G  G LG+ G +GP GE G  G++G  G+ G+ G+ GE GK+  DG KG                               IG  GS G+ G +G TG  GP G++G KG    +GS GP G  G  G  G  G  G  G +GFKG  G  G PG  G +GP
Sbjct:  299 PGYAGHQGVQGAKGKRGLPGEAG------------SPGLVGPVGLPGPEGIQGDPGQKGFEGAKGIKGFPGSPGSMGLMGSRGTPGDQGGRGPQGVQGLLGDRGPRGPPGEQGFRGVKGAVGSHGLIGRKGEKGKEGRDGVKGERGSKGKSGLPGDKGPVGPPGHPGHKGAIGIIGKSGSPGKDGSEGPTGESGPTGALGAKGQKGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGP 541          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Nematostella
Match: EDO49401 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGC7])

HSP 1 Score: 106.686 bits (265), Expect = 2.426e-25
Identity = 81/230 (35.22%), Postives = 118/230 (51.30%), Query Frame = 1
Query: 8545 DDALAVKYLGSDVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASDVTEYRSWFGE-ITGTFKFDYQIEASQLMFLKLFSTNARQRITINCSRLSVVGNSEHPVILYSDHDEEV-LRNG----------DLFKYSVIRDGCKNSAEIIDSTELEMDTEAI-RLPIRDIALNTGSSKEQQQFGLDIGQVCFS 9195
            D A     L   + K PLGT   PARTC+ L    P  + G Y+IDPNGG  +D+  V C      SCI   +P+  +K +   D  +   WF + + G+ +F Y  + SQL+FL+L S  A Q+IT +C R SV            D D+ + L++G          + +K ++I+D C         T LE++TE+  RLPI DIA+     ++ ++FGL IG VCFS
Sbjct:    9 DTAFWSLSLRVGLFKNPLGTHRHPARTCRDLKLCRPEAESGQYWIDPNGGITEDSILVYCDFALNASCI---TPNQFMKWYSGRDGYK---WFAQDLHGSQQFHYTSDPSQLLFLRLLSDRASQKITYHC-RNSVAWYDSRS----RDFDKSIKLKSGNGIELYAASSNKYKPTIIKDDCGVKDGKWRKTVLEVNTESTHRLPIVDIAVFDIGDRD-EEFGLQIGSVCFS 226          

HSP 2 Score: 64.3142 bits (155), Expect = 6.642e-11
Identity = 69/230 (30.00%), Postives = 115/230 (50.00%), Query Frame = -3
Query:  226 EDEDIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCIEPEVVNYKKTSYTKTISSWFSVLASLNKQISYKIPKEQLVFXXXXXXXXXXXXXXSCDQIALVSDDSITQDIRYNNSVQLFGDDNQILTVNNEDDLFQYKVVEDTCKDKSNNGR-AVIKVEXXXXXXXXXXXLNFKSIENSRPAMIGIEIGPVCFS 912
            +  D+  A   LS  V     P G+  +PAR+C D++       +G ++IDPNGG  +D+I V+C+F    +CI P    + K    +    WF+     ++Q  Y     QL+FL+L S+ +SQ +T  C   ++   DS ++D  ++ S++L    N I       + ++  +++D C  K    R  V++V  +   RLPI D+    I + R    G++IG VCFS
Sbjct:    4 QTTDVDTAFWSLSLRVGLFKNPLGTHRHPARTCRDLKLCRPEAESGQYWIDPNGGITEDSILVYCDFALNASCITPN--QFMKWYSGRDGYKWFAQDLHGSQQFHYTSDPSQLLFLRLLSDRASQKITYHCRN-SVAWYDSRSRD--FDKSIKL-KSGNGIELYAASSNKYKPTIIKDDCGVKDGKWRKTVLEVNTESTHRLPIVDIAVFDIGD-RDEEFGLQIGSVCFS 226          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Nematostella
Match: EDO30432 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0T5])

HSP 1 Score: 109.768 bits (273), Expect = 7.418e-25
Identity = 168/481 (34.93%), Postives = 205/481 (42.62%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILG---PRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQ---GPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMG 7068
            G  G  G  G  G+PG +G  G+KG KGQRG  G  G  G   PRG  G +GP G    RG  G  GP+G  G  G +G  G                            +G  G+KG+ G  GY G  G RG  G  G  G  G  G  G +G  GK G  G  G +G RG  G RG  G  G +G  G  G +G+PG  G PG  G++G +G+   RG  G  G+ G RG+ G +G+ G  G  GVPG PG  GK G  G                                            GP+G  G R                           GP GN G RGL GS G  G  G  G+KG  G PG  G  G  GP+   G +G  G  G TG +GP G  G  G+RGV   PG  GK G NGK  + G +G  G  G +G  GP+G+ G++G  G  G +G  G+TGP G
Sbjct:   31 GLKGARGYRGWRGLPGQRGYRGLKGAKGQRGLRGLTGATGKQGPRGWTGARGPKGI---RGLRGLKGPIGPRGLKGSRGFMG---------------------------PRGLRGLKGTTGSRGYRGLKGSRGLTGPQGKTGARGPQGLRGYRGFTGKPGLTGPRGLKGARGATGPRGYTGRTGLRGVPGKSGRNGTPGKNGRPGAKGAMGPRGY---RGLTGSKGARGARGKQGLRGATGRPGRNGVPGRPGSKGKTGARGAT------------------------------------------GPRGLRGLR---------------------------GPQGNQGLRGLKGSRGVQGRPGKNGAKGRNGAPGRTGARGKIGPRGFTGLKGAKGVRGATGLRGPRGFTGKQGLRGV---PGRTGKTGANGKPGLRGPQGLKGLKGKTGATGPRGLRGLKGSRGWTGPRGKTGATGPQG 406          

HSP 2 Score: 103.605 bits (257), Expect = 9.954e-23
Identity = 145/415 (34.94%), Postives = 183/415 (44.10%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNG 6888
            G  G  GP G  G+ G+KGP+G +G KG RG MG  G+ G +G  G +G  G  G RG  G  G  G  G  G++G  G           G PGL G RG +G +G+ G  G  G  G  G PG  G+ G PG++G PG  G  GP G +G  G                       G  G++G  G  G +G PG  G PG  GS G  G  GA GP+G+ G  GP+G  G +G +G+ G+ G PG  G  G+ G                                        PG+    G  GP G  G  G  G  G          +GL+GP G  G  G RG+PG  G +G  G  G +GP G  G+ G  GA+GP+G RG  G  G TG +G  G  G  G+RG  G
Sbjct:   76 GWTGARGPKGIRGLRGLKGPIGPRGLKGSRGFMGPRGLRGLKGTTGSRGYRGLKGSRGLTGPQGKTGARGPQGLRGYRG---------FTGKPGLTGPRGLKGARGATGPRGYTGRTGLRGVPGKSGRNGTPGKNGRPGAKGAMGPRGYRGLTG---------------------SKGARGARGKQGLRGATGRPGRNGVPGRPGSKGKTGARGATGPRGLRGLRGPQGNQGLRGLKGSRGVQGRPGKNGAKGRNG---------------------------------------APGRTGARGKIGPRGFTGLKGAKGVRGA---------TGLRGPRGFTGKQGLRGVPGRTGKTGANGKPGLRGPQGLKGLKGKTGATGPRGLRGLKGSRGWTGPRGKTGATGPQGLRGYRG 412          

HSP 3 Score: 100.523 bits (249), Expect = 9.727e-22
Identity = 157/389 (40.36%), Postives = 201/389 (51.67%), Query Frame = 1
Query: 5977 GIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGN------KGSKGPYGKPGIAGDNGASGPQG------PRGENGDLGNTGEQGPVGEVGNAGIRG---VNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGR---RGPQGMTGIQG------PPGSIGLKGDIGSTGPMGR 7071
            G++G  G  G  G+ G RG  G  G  G  G+ G  G +G  G TG  G+ G RG  G RG +GI G  G KG IGP G  GS G  G  G+ G  G+ G  G RG +G  G  GP+G+TG++G QG  G  G  G PG  G  G  G  G  GP G  G  G  G+PG  G++G         TPGKN +PG +G +G RG  G +G  G  G  G   + GL+G  G PG +G  G PGS G +G +G       +G +GP G  G+ G  G+ G QG       +G NG  G TG +G +G  G  G++G   V GA G+ G  G  GK  + G  G  G  G++G+   RGPQG+ G++G      P G  GLKG  G TGP G+
Sbjct:   22 GLRGYTGARGLKGARGYRGWRGLPGQRGYRGLKGAKGQRGLRGLTGATGKQGPRGWTGARGPKGIRGLRGLKGPIGPRGLKGSRGFMGPRGLRGLKGTTGSRGYRGLKGSRGLTGPQGKTGARGPQGLRGYRGFTGKPGLTGPRGLKGARGATGPRGYTGRTGLRGVPGKSGRNG---------TPGKNGRPGAKGAMGPRGYRGLTGSKGARGARG---KQGLRGATGRPGRNGVPGRPGSKGKTGARGATGPRGLRGLRGPQGNQGLRGLKGSRGVQGRPGKNGAKGRNGAPGRTGARGKIGPRGFTGLKGAKGVRGATGLRGPRGFTGKQGLRGVPGRTGKTGANGKPGLRGPQGLKGLKGKTGATGPRGLRGLKGSRGWTGPRGK 398          

HSP 4 Score: 85.1149 bits (209), Expect = 1.115e-16
Identity = 141/432 (32.64%), Postives = 182/432 (42.13%), Query Frame = 1
Query: 5977 GIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMG------PSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGS---------PGPRGRTGSKGS---QGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNP---------GTPGVIGPQ 7191
            G +G  G  G PG  G RG  G  G  G  G+ G +G +G  G TG  G  G RG RG +G  G  G  GS+G +GP G       +GS G RG  G  G  G QG  GARGPQG+ G           GPRG  G++G+   +G  G  G+ G PGK G+ G                                       TPGKN +PG +G +G RG                                  RGL GS G  G +G +G +G  G+PG  G  G  G +G  G  G  G  G +G  G  GN G+RG+ G+ G+ G+ G+NG    +GA G  G   + G+ GP+G TG++G   + G++G  G  GP                      GF G +GL G P         G PG+ GPQ
Sbjct:   34 GARGYRGWRGLPGQRGYRGLKGAKGQRGLRGLTGATGKQGPRGWTGARGPKGIRGLRGLKGPIGPRGLKGSRGFMGPRGLRGLKGTTGSRGYRGLKGSRGLTGPQGKTGARGPQGLRGYRGFTGKPGLTGPRGLKGARGATGPRGYTGRTGLRGVPGKSGRNG---------------------------------------TPGKNGRPGAKGAMGPRG---------------------------------YRGLTGSKGARGARGKQGLRGATGRPGRNGVPGRPGSKGKTGARGATGPRGLRGLRGPQGNQGLRGLKGSRGVQGRPGKNGAKGRNGAPGRTG---ARGKIGPRGFTGLKG---AKGVRGATGLRGP---------------------RGFTGKQGLRGVPGRTGKTGANGKPGLRGPQ 366          

HSP 5 Score: 79.337 bits (194), Expect = 7.320e-15
Identity = 112/276 (40.58%), Postives = 139/276 (50.36%), Query Frame = 1
Query: 5641 TGEPGINGP---------TGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGP---TGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSD---GKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGI 6423
            TG+PG+ GP         TGP G  G  G  GV G  G+ G  GK+G  G +G +GP+G    TG+ G RG  G  G  G  G PG  G+ GRPG++G+ G +G  G  GLRG  G +G+QG  G+KGS G  G PG +   G+ GAPG  G  GK G  G +G+KG  G                          G+ G  GP G +G  GLRG PG  G  G+ G PG RGPQG+ G  G  G TG +G +G  G  G  G  GK G  G  G+
Sbjct:  156 TGKPGLTGPRGLKGARGATGPRGYTGRTGLRGVPGKSGRNGTPGKNGRPGAKGAMGPRGYRGLTGSKGARGARGKQGLRGATGRPGRNGVPGRPGSKGKTGARGATGPRGLRGLRGPQGNQGLRGLKGSRGVQGRPGKNGAKGRNGAPGRTGARGKIGPRGFTGLKGAKG------------------------VRGATGLRGPRGFTGKQGLRGVPGRTGKTGANGKPGLRGPQGLKGLKGKTGATGPRGLRGLKGSRGWTGPRGKTGATGPQGL 407          

HSP 6 Score: 78.5666 bits (192), Expect = 1.413e-14
Identity = 114/325 (35.08%), Postives = 143/325 (44.00%), Query Frame = 1
Query: 6247 GVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGP------------PGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIG 7185
            G+ G  G++G  GARG +G  G PG RG  G KG++G  G+ G+ G  GK G  G  G                                            GP+G  G RG  G  G  G+ G+ G  G  GL+G  G  G+ G RGL GS G +G +G  G++GP G  G  G  G  G  GPRG  G  G TG +G  G  G  G+ G +G  G PGK+G  G     G +G  G  GS G RG +G  G++G             PGS G  G  G+TGP G      + G  G  G  G  G KG +G+ G PG  G  G
Sbjct:   22 GLRGYTGARGLKGARGYRGWRGLPGQRGYRGLKGAKGQRGLRGLTGATGKQGPRGWTGAR------------------------------------------GPKGIRGLRGLKGPIGPRGLKGSRGFMGPRGLRGLKGTTGSRGYRGLKGSRGLTGPQGKTGARGPQGLRGYRGFTGKPGLTGPRGLKGARGATGPRGYTGRTGLRGVPGKSGRNGTPGKNGRPGAKGAMGPRGYRGLTGSKGARGARGKQGLRGATGRPGRNGVPGRPGSKGKTGARGATGPRG------LRGLRGPQGNQGLRGLKGSRGVQGRPGKNGAKG 298          

HSP 7 Score: 55.0694 bits (131), Expect = 3.712e-7
Identity = 62/173 (35.84%), Postives = 80/173 (46.24%), Query Frame = 1
Query: 6691 LP------GSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
             P      G  G  G KG +G +G  G PG  G  G  G +G RG  G  G TG+QGP G  G  G +G+ G  G+ G  G  G   + G++G +GP      RG +G+ G  G  G  GLKG  G TGP G+                G  G +G +G  G  G PG+ GP+
Sbjct:   17 FPGPRGLRGYTGARGLKGARGYRGWRGLPGQRGYRGLKGAKGQRGLRGLTGATGKQGPRGWTGARGPKGIRGLRGLKGPIGPRG---LKGSRGFMGP------RGLRGLKGTTGSRGYRGLKGSRGLTGPQGK---------------TGARGPQGLRGYRGFTGKPGLTGPR 165          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Medaka
Match: col1a2 (collagen type I alpha 2 chain [Source:NCBI gene;Acc:105355091])

HSP 1 Score: 162.155 bits (409), Expect = 3.877e-39
Identity = 88/242 (36.36%), Postives = 124/242 (51.24%), Query Frame = 1
Query: 8521 TVRRDLLNDDALAVKYLGSDV--VKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASDVTEYRSWFGE-ITGTFKFDYQIE-------ASQLMFLKLFSTNARQRITINCSRLSVV-----GNSEHPVILYSDHDEEVLRNGD-LFKYSVIRDGCKNSAEIIDSTELEMDT-EAIRLPIRDIA-LNTGSSKEQQQFGLDIGQVCF 9192
            T+R      DA  +K L + +  +  P G++  PARTC+ +   +P    GFY+IDPN G  +DA +V C    +E+CI S   S   K+W  S   +   WFGE I G  +F Y  E       A+QL F++L S  A Q IT +C           G+ +  V+L   +D E+  +G+  F +SV+ DGC         T +E  T +  RLPI DIA L+ G +   Q+FGLDIG VCF
Sbjct: 1117 TLRAKDYEVDAT-IKSLNTQIENLLTPEGSRKNPARTCRDIKLGHPEWSSGFYWIDPNQGCINDAIKVFCDFTTRETCIYSHPESIARKNWYRSTENKKHVWFGETINGGTEFAYNDETLSPQSMATQLAFMRLLSNQASQNITYHCKNSIAYMDGESGSLKKAVLLQGSNDVELRADGNSRFIFSVLEDGCTRHTGEWSKTVIEYRTNKPSRLPILDIAPLDIGEA--DQEFGLDIGPVCF 1355          

HSP 2 Score: 102.064 bits (253), Expect = 7.407e-21
Identity = 73/263 (27.76%), Postives = 124/263 (47.15%), Query Frame = -3
Query:  229 DLFQNDQPKTEKISSIDPNDEDEDIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCI--EPEVVN----YKKTSYTKTISSWF-------SVLASLNKQISYKIPKEQLVFXXXXXXXXXXXXXXSC-DQIALVSDDSITQDIRYNNSVQLFGDDNQILTVNNEDDLFQYKVVEDTCKDKSNNGRAVIKVEXXXXXXXXXXXLNFKSIE-NSRPAMIGIEIGPVCF 972
            D ++ DQP            +D ++   +  L++ ++NL  P GS+  PAR+C DI+  +   S+G ++IDPN G   DAI V C+F   ETCI   PE +     Y+ T   K +  WF       +  A  ++ +S +    QL F++L S  +SQ +T  C + IA +  +S +       +V L G ++  L  +  +  F + V+ED C   +      + +E    +   +  L+   ++        G++IGPVCF
Sbjct: 1109 DEYRADQPTLRA--------KDYEVDATIKSLNTQIENLLTPEGSRKNPARTCRDIKLGHPEWSSGFYWIDPNQGCINDAIKVFCDFTTRETCIYSHPESIARKNWYRSTENKKHV--WFGETINGGTEFAYNDETLSPQSMATQLAFMRLLSNQASQNITYHCKNSIAYMDGESGS----LKKAVLLQGSNDVELRADG-NSRFIFSVLEDGCTRHTGEWSKTV-IEYRTNKPSRLPILDIAPLDIGEADQEFGLDIGPVCF 1355          

HSP 3 Score: 87.8113 bits (216), Expect = 1.875e-16
Identity = 191/518 (36.87%), Postives = 227/518 (43.82%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPR---------GNLGPQGPTGAPGRRGTVGSPGP------VGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQS---------------------GLQGPIGPPGNSGQR------------------GLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGP------RGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQG 7014
            TG  G  G  GP G PG +G  G +G  G+ G  G  G  G R         G+ G  GP G PG RG+ GS GP       G AG PG  G+ G PG+ G  G  G  G  G  G +G  G  G  G +G  G  G+    G +G  GE G PG+ G  GP+G++G PG                          G+ G  GP+G  G+PG +G  G  G+ G QG PG  GP G  G PG RG  G +G  G  G  G  GT G  G  G  G  G  GP G PG  G  G PG  G  G  G  G  G PG+    G  GP GE+G PG  G DG  G  G  G                       G  GP GP G SG+R                  G PG+ G  G  G KG  GP G  G AG +G SGP GP      RG+ G +G TG  G  G VG  G  G+ G PG+ G  G++G   + G  G  GP G  G  GP G++G +G
Sbjct:  351 TGPKGEPGNAGPQGAPGPQGEEGKRGPTGEIGATGAAGNRGARGAPGSRGLPGSEGRTGPIGMPGARGSTGSAGPRGPPGDAGRAGEPGPAGLRGLPGSPGSSGPPGKEGAAGPSGQDGRPGPPGPSGPRGQPGNSGF---TGPKGPSGEPGKPGERGSTGPTGLRGPPGPD------------------------GNNGAAGPVGAVGAPGEKGEQGPAGAAGFQGLPGPAGPAGEAGKPGERGIPGDQGVSGPAGAKGERGTNGSPGATGPQGPIGPRGPAGAPGADGGKGEPGAAGAAGAQGHQGAGGMPGERGAAGTPGPKGEKGEPGHKGPDGNSGRDGARGMPGPAGPPGPNGANGDKGESGSFGPAGPAGPRGPSGERGEVGPAGPPGFAGPPGADGQPGARGERGPSGGKGETGPSGPAGPAGQSGPSGPSGPAGAPGARGDTGPVGLTGFPGAAGRVGAPGQAGIVGPPGLAGPAGKDGPRGLRGDPGPAGPSGEQGMVGPPGVSGEKG 841          

HSP 4 Score: 74.3294 bits (181), Expect = 2.574e-12
Identity = 209/629 (33.23%), Postives = 247/629 (39.27%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKG------PLGVKGDKGQRGRMG------------------KDGILGPR---------------------GNLGPQGPTGAPGRRGTVGS---------PGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGL---------------------------RGNPGVIGSLGSQGFPGARGPQGILGSPGPRGR------------TGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQR------GLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGV---------------------NGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGT 7170
            G PG  G TGP G+PG +G      P G  GD G+ G  G                  K+G  GP                      G  GP+GP+G PG+ G  GS         PGP GN G  G  G  G                       GEKG QG  G  G  G  G  G  G+ G PGE G PG  G+ GP+G KG+ G  G+PG                    G +G IGP GP+G+PG                            RG  G  G  G +G PG +GP G  G  G RG              G KG  G+ G AG  G  G  G+ G+V                     G  G  G  GP G  G PG   + GP G  GE GP G +         GP GQSG  GP GP G  G R      GL G  G +G  G  G  G  G PG+AG  G  GP+G RG+ G  G +GEQG VG  G +G +G                       G  G+ G  G+ G     GA      +G  GR GP G  G +GPPG+IG+    G +GP G  G  G PG  G  G PG  GFKGD+G PG  G+
Sbjct:  400 GLPGSEGRTGPIGMPGARGSTGSAGPRGPPGDAGRAGEPGPAGLRGLPGSPGSSGPPGKEGAAGPSGQDGRPGPPGPSGPRGQPGNSGFTGPKGPSGEPGKPGERGSTGPTGLRGPPGPDGNNGAAGPVGAVG---------------------APGEKGEQGPAGAAGFQGLPGPAGPAGEAGKPGERGIPGDQGVSGPAGAKGERGTNGSPGA------------------TGPQGPIGPRGPAGAPGADGGKGEPGAAGAAGAQGHQGAGGMPGERGAAGTPGPKGEKGEPGHKGPDGNSGRDGARGMPGPAGPPGPNGANGDKGESGSFGPAGPAGPRGPSGERGEV---------------------GPAGPPGFAGPPGADGQPGARGERGPSGGKGETGPSGPA---------GPAGQSGPSGPSGPAGAPGARGDTGPVGLTGFPGAAGRVGAPGQAGIVGPPGLAGPAGKDGPRGLRGDPGPAGPSGEQGMVGPPGVSGEKGSPGEPGPAGAPGPPGTTGPLGLQGFVGLSGARGDRGTPGAAGA------VGEPGRAGPPGAAGPRGPPGNIGMP---GMSGPQGEAGRDGNPGNDGPPGRPGAAGFKGDRGEPGPAGS 950          

HSP 5 Score: 70.0922 bits (170), Expect = 4.397e-11
Identity = 176/498 (35.34%), Postives = 210/498 (42.17%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSP------GPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGS---------------------PGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRT---GSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQR------------------------GLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGS 6972
            TG  G+ GP GP G  G  GP+G  G  G++G  G  G  G +G  GP GP G  G+ G  G P      GP G  G  G  G  G  G QG  G +GP G PG  G +GE G+ G  G +G  G  G PG  G  G PG  G+ G+ G  GP G  G  G  G PG +G  GP G  G++G  G  G  G  GP GPSG                      PG RG  G  G  G  G  G  GP G  G  GP G     G++G  G +G+ G PG  G+ G  GQ GI                                  G PG     G  GP G RG PG +G             SG QG +GPPG SG++                        G  G +G  G +G  G+ G  G+PG AG  GA+GP+GP    G++G  G  GP GE G  G  G +G PG PG  G        G +G  GP GS
Sbjct:  507 TGPTGLRGPPGPDGNNGAAGPVGAVGAPGEKGEQGPAGAAGFQGLPGPAGPAGEAGKPGERGIPGDQGVSGPAGAKGERGTNGSPGATGPQGPIGPRGPAGAPGADGGKGEPGAAGAAGAQGHQGAGGMPGERGAAGTPGPKGEKGEPGHKGPDGNSGRDGARGMPGPAGPPGPNGANGDKGESGSFGPAGPAGPRGPSGERGEVGPAGPPGFAGPPGADGQPGARGERGPSGGKGETGPSGPAGPAGQSGPSGPSGPAGAPGARGDTGPVGLTGFPGAAGRVGAPGQAGI---------------------------------VGPPGLAGPAGKDGPRGLRGDPGPAGP------------SGEQGMVGPPGVSGEKGSPGEPGPAGAPGPPGTTGPLGLQGFVGLSGARGDRGTPGAAGAVGEPGRAGPPGAAGPRGP---PGNIGMPGMSGPQGEAGRDGNPGNDGPPGRPGAAG------FKGDRGEPGPAGS 950          

HSP 6 Score: 65.0846 bits (157), Expect = 1.601e-9
Identity = 187/564 (33.16%), Postives = 229/564 (40.60%), Query Frame = 1
Query: 5653 GINGPTGPTGVPGMKGPLGVKGD---------KGQRGRMGKDGILGPRGNLGPQGPTGAPG---------------------------RRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIG------------------------QDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGD---------------------NGASGPQGPR------------------GENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAV---------------DGAKGNIGPIGSSGRRGPQGMT 7002
            G+ GP GP G  G  G  G+ GD         KG+RG  G  G  GP+G +GP+GP GAPG                            RG  G+PGP G  G PG +G  G  G  G  GM GP G PG  G  G+KG  G  G  G  G                         DG PG+ G+RG  G  G+ G +G  GP+G  G  G +G  G                    G++GD GP+G +G PG  G  G  G  G  G PG  GP G  G  G RG  G  G  G  G+ G PG  G+ G  G+ G  G  GPPG  GP+G  G  G  G  G  G  G  G  G+  + GP G  G RGPPG                 G+ G  GP G +G+ G PG++GP G  G  G KG  G+PG AG                       G +GP GP                   GE G  G+ GE+G  G  G+ G++G+ G  G  G  G  G + +               DG  G  G IG+ G RGP G +
Sbjct:  550 GLPGPAGPAGEAGKPGERGIPGDQGVSGPAGAKGERGTNGSPGATGPQGPIGPRGPAGAPGADGGKGEPGAAGAAGAQGHQGAGGMPGERGAAGTPGPKGEKGEPGHKGPDGNSGRDGARGMPGPAGPPGPNGANGDKGESGSFGPAGPAGPRGPSGERGEVGPAGPPGFAGPPGADGQPGARGERGPSGGKGETGPSGPAGPAGQSGPSGPSGPAGAP------------------GARGDTGPVGLTGFPGAAGRVGAPGQAGIVGPPGLAGPAGKDGPRGLRGDPGPAGPSGEQGMVGPPGVSGEKGSPGEPGPAGAPGPPGTTGPLGLQGFVGLSGARGDRGTPGAAGAVGEPGRAGPPGAAGPRGPPG---------------NIGMPGMSGPQGEAGRDGNPGNDGPPGRPGAAGFKGDRGEPGPAGSMGLGGAPGPAGPTGAPGRPGGRGEAGPAGPTGPAGIAGARGGAGPAGPRGEKGVAGDKGERGMKGLRGHPGLQGMPGPSGPAGDSGPAGPNGLSGPRGPAGPHGPPGKDGRAGAHGTIGAPGARGPPGFS 1080          

HSP 7 Score: 64.6994 bits (156), Expect = 1.895e-9
Identity = 197/496 (39.72%), Postives = 234/496 (47.18%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPG---RRGTVGS---PGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSG------QRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGN---------AGIRGVNGAPGIPGKDGENGK---DAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
            G PG  G  G  G PG+ G  G +G  G  GR G+ G  G +G  G  G  G+PG   +RG  G    PGP G AG  G  G  G  G  G  G  GPPG PG  GP+GE G  G  G  G  G  G PGS+G  G  G  G+PG  G++G  G  G PG  G PG +G RG  GP+G +G  G  G  GD GP G  G  G +G PG   + G QG PG +G +G  G  G  G TG+ G++G  G  G  G PG +G+ G +G+PG  G  G                           + G    PG  G  GE GP G  G  G PG+ GPPG+ G  GP G  G  G       RG        G  G  G KGP G+PG  G+ G++GP G RG  G  GN G  GPVG VG          AG  G  G PG  G  GE GK     + G +G  GP G+ G RG  G  G  GP G IG +G  G+ G
Sbjct:  151 GAPGPQGARGFPGTPGLPGMKGHRGYTGLDGRKGEPGAAGAKGEPGAHGAAGSPGLAGQRGLAGERGRPGPAGPAGARGADGNVGPAGPAGPMGAAGPPGFPGGPGPKGEVGPIGATGPSGPQGNRGEPGSNGAVGPVGPPGNPGANGLNGAKGAAGTPGPGGAPGFAGARGGPGPQGPQGAAGPRGLSGDPGPQGTKGDTGPKGEPG---NAGPQGAPGPQGEEGKRGPTGEIGATGAAGNRGARGAPGSRGLPGSEGRTGPIGMPGARGSTG---------------------------SAGPRGPPGDAGRAGEPGPAGLRGLPGSPGSSGPPGKEGAAGPSGQDGRPGPPGPSGPRGQ------PGNSGFTGPKGPSGEPGKPGERGSTGPTGLRGPPGPDGNNGAAGPVGAVGAPGEKGEQGPAGAAGFQGLPGPAGPAGEAGKPGERGIPGDQGVSGPAGAKGERGTNGSPGATGPQGPIGPRGPAGAPG 610          

HSP 8 Score: 58.151 bits (139), Expect = 1.800e-7
Identity = 172/524 (32.82%), Postives = 207/524 (39.50%), Query Frame = 1
Query: 5842 GNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLG---------------------------------------SQGFPGARGPQGILGSPGPRGRT------------GSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQP---GPQGPLGERGPPGK------------SXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKG---------------PYGKPGIAGDNGASGPQGPRGENGDL------------------GNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPI------GSSGRRGPQGMTGIQGPPGSI---------GLKGDIGSTGPMGR 7071
            G +G PG QG  G      + G +G PG  G +G  G +G +G  G  G IG  G  G+ G RGAPG  G PG  G  GP G+ G                             GS G  GP GP G  G  G PG  G  G                                       + GF G +GP G  G PG RG T            G+ G+ G +G  G PG  G+ G AG  G  G  GP G  G  G  G  G PG  G  GPAG  G  G N  P   GPQGP+G RGP G             +G  G  G+ G  G  G +G  G PG  G++G PG  GP G  G  G++G                 G+ G  G  G +GP+GP GE G++                  G  GE+GP G  G  G  G  G  G  G  G +G     GA+G+ GP+      G++GR G  G  GI GPPG           GL+GD G  GP G 
Sbjct:  337 GLSGDPGPQGTKG------DTGPKGEPGNAGPQGAPGPQGEEGKRGPTGEIGATGAAGNRGARGAPGSRGLPGSEGRTGPIGMPG---------------------------ARGSTGSAGPRGPPGDAGRAGEPGPAGLRGLPGSPGSSGPPGKEGAAGPSGQDGRPGPPGPSGPRGQPGNSGFTGPKGPSGEPGKPGERGSTGPTGLRGPPGPDGNNGAAGPVGAVGAPGEKGEQGPAGAAGFQGLPGPAGPAGEAGKPGERGIPGDQGVSGPAGAKGERGTNGSPGATGPQGPIGPRGPAGAPGADGGKGEPGAAGAAGAQGHQGAGGMPGERGAAGTPGPKGEKGEPGHKGPDGNSGRDGARGMPGPAGPPGPNGANGDKGESGSFGPAGPAGPRGPSGERGEVGPAGPPGFAGPPGADGQPGARGERGPSGGKGETGPSGPAGPAGQSGPSGPSGPAGAPGARGDTGPVGLTGFPGAAGRVGAPGQAGIVGPPGLAGPAGKDGPRGLRGDPGPAGPSGE 827          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Medaka
Match: col1a2 (collagen type I alpha 2 chain [Source:NCBI gene;Acc:105355091])

HSP 1 Score: 161.77 bits (408), Expect = 4.829e-39
Identity = 88/242 (36.36%), Postives = 124/242 (51.24%), Query Frame = 1
Query: 8521 TVRRDLLNDDALAVKYLGSDV--VKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASDVTEYRSWFGE-ITGTFKFDYQIE-------ASQLMFLKLFSTNARQRITINCSRLSVV-----GNSEHPVILYSDHDEEVLRNGD-LFKYSVIRDGCKNSAEIIDSTELEMDT-EAIRLPIRDIA-LNTGSSKEQQQFGLDIGQVCF 9192
            T+R      DA  +K L + +  +  P G++  PARTC+ +   +P    GFY+IDPN G  +DA +V C    +E+CI S   S   K+W  S   +   WFGE I G  +F Y  E       A+QL F++L S  A Q IT +C           G+ +  V+L   +D E+  +G+  F +SV+ DGC         T +E  T +  RLPI DIA L+ G +   Q+FGLDIG VCF
Sbjct: 1063 TLRAKDYEVDAT-IKSLNTQIENLLTPEGSRKNPARTCRDIKLGHPEWSSGFYWIDPNQGCINDAIKVFCDFTTRETCIYSHPESIARKNWYRSTENKKHVWFGETINGGTEFAYNDETLSPQSMATQLAFMRLLSNQASQNITYHCKNSIAYMDGESGSLKKAVLLQGSNDVELRADGNSRFIFSVLEDGCTRHTGEWSKTVIEYRTNKPSRLPILDIAPLDIGEA--DQEFGLDIGPVCF 1301          

HSP 2 Score: 102.064 bits (253), Expect = 7.960e-21
Identity = 73/263 (27.76%), Postives = 124/263 (47.15%), Query Frame = -3
Query:  229 DLFQNDQPKTEKISSIDPNDEDEDIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCI--EPEVVN----YKKTSYTKTISSWF-------SVLASLNKQISYKIPKEQLVFXXXXXXXXXXXXXXSC-DQIALVSDDSITQDIRYNNSVQLFGDDNQILTVNNEDDLFQYKVVEDTCKDKSNNGRAVIKVEXXXXXXXXXXXLNFKSIE-NSRPAMIGIEIGPVCF 972
            D ++ DQP            +D ++   +  L++ ++NL  P GS+  PAR+C DI+  +   S+G ++IDPN G   DAI V C+F   ETCI   PE +     Y+ T   K +  WF       +  A  ++ +S +    QL F++L S  +SQ +T  C + IA +  +S +       +V L G ++  L  +  +  F + V+ED C   +      + +E    +   +  L+   ++        G++IGPVCF
Sbjct: 1055 DEYRADQPTLRA--------KDYEVDATIKSLNTQIENLLTPEGSRKNPARTCRDIKLGHPEWSSGFYWIDPNQGCINDAIKVFCDFTTRETCIYSHPESIARKNWYRSTENKKHV--WFGETINGGTEFAYNDETLSPQSMATQLAFMRLLSNQASQNITYHCKNSIAYMDGESGS----LKKAVLLQGSNDVELRADG-NSRFIFSVLEDGCTRHTGEWSKTV-IEYRTNKPSRLPILDIAPLDIGEADQEFGLDIGPVCF 1301          

HSP 3 Score: 88.9669 bits (219), Expect = 8.862e-17
Identity = 191/518 (36.87%), Postives = 227/518 (43.82%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPR---------GNLGPQGPTGAPGRRGTVGSPGP------VGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQS---------------------GLQGPIGPPGNSGQR------------------GLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGP------RGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQG 7014
            TG  G  G  GP G PG +G  G +G  G+ G  G  G  G R         G+ G  GP G PG RG+ GS GP       G AG PG  G+ G PG+ G  G  G  G  G  G +G  G  G  G +G  G  G+ G  G  G PG+   PG+ G  GP+G++G PG                          G+ G  GP+G  G+PG +G  G  G+ G QG PG  GP G  G PG RG  G +G  G  G  G  GT G  G  G  G  G  GP G PG  G  G PG  G  G  G  G  G PG+    G  GP GE+G PG  G DG  G  G  G                       G  GP GP G SG+R                  G PG+ G  G  G KG  GP G  G AG +G SGP GP      RG+ G +G TG  G  G VG  G  G+ G PG+ G  G++G   + G  G  GP G  G  GP G++G +G
Sbjct:  351 TGPKGEPGNAGPQGAPGPQGEEGKRGPTGEIGATGAAGNRGARGAPGSRGLPGSEGRTGPIGMPGARGSTGSAGPRGPPGDAGRAGEPGPAGLRGLPGSPGSSGPPGKEGAAGPSGQDGRPGPPGPSGPRGQPGNSGFTGPKGPSGEPGK---PGERGSTGPTGLRGPPGPD------------------------GNNGAAGPVGAVGAPGEKGEQGPAGAAGFQGLPGPAGPAGEAGKPGERGIPGDQGVSGPAGAKGERGTNGSPGATGPQGPIGPRGPAGAPGADGGKGEPGAAGAAGAQGHQGAGGMPGERGAAGTPGPKGEKGEPGHKGPDGNSGRDGARGMPGPAGPPGPNGANGDKGESGSFGPAGPAGPRGPSGERGEVGPAGPPGFAGPPGADGQPGARGERGPSGGKGETGPSGPAGPAGQSGPSGPSGPAGAPGARGDTGPVGLTGFPGAAGRVGAPGQAGIVGPPGLAGPAGKDGPRGLRGDPGPAGPSGEQGMVGPPGVSGEKG 841          

HSP 4 Score: 79.7221 bits (195), Expect = 4.569e-14
Identity = 207/626 (33.07%), Postives = 246/626 (39.30%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKG------PLGVKGDKGQRGRMG------------------KDGILGPR---------------------GNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGL---------------------------RGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTG------------SKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRG------LPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGV---------------------NGAPGIPGKDGENGKDAVDGAKGN---IGPIGSSGRRGPQG---MTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGT 7170
            G PG  G TGP G+PG +G      P G  GD G+ G  G                  K+G  GP                      G  GP+GP+G PG+ G  GS GP G  G PG  G +G              G  G  G  GEKG QG  G  G  G  G  G  G+ G PGE G PG  G+ GP+G KG+ G  G+PG                    G +G IGP GP+G+PG                            RG  G  G  G +G PG +GP G  G  G RG  G             KG  G+ G AG  G  G  G+ G+V                     G  G  G  GP G  G PG   + GP G  GE GP G +G  G         QSG  GP GP G  G RG      L G  G +G  G  G  G  G PG+AG  G  GP+G RG+ G  G +GEQG VG  G +G +G                       G  G+ G  G+ G     GA G     GP G++G RGP G   M G+ GP G  G  G+ G+ GP GR G                 GFKGD+G PG  G+
Sbjct:  400 GLPGSEGRTGPIGMPGARGSTGSAGPRGPPGDAGRAGEPGPAGLRGLPGSPGSSGPPGKEGAAGPSGQDGRPGPPGPSGPRGQPGNSGFTGPKGPSGEPGKPGERGSTGPTGLRGPPGPDGNNG------------AAGPVGAVGAPGEKGEQGPAGAAGFQGLPGPAGPAGEAGKPGERGIPGDQGVSGPAGAKGERGTNGSPGA------------------TGPQGPIGPRGPAGAPGADGGKGEPGAAGAAGAQGHQGAGGMPGERGAAGTPGPKGEKGEPGHKGPDGNSGRDGARGMPGPAGPPGPNGANGDKGESGSFGPAGPAGPRGPSGERGEV---------------------GPAGPPGFAGPPGADGQPGARGERGPSGGKGETGPSGPAGPAG---------QSGPSGPSGPAGAPGARGDTGPVGLTGFPGAAGRVGAPGQAGIVGPPGLAGPAGKDGPRGLRGDPGPAGPSGEQGMVGPPGVSGEKGSPGEPGPAGAPGPPGTTGPLGLQGFVGLSGARGDRGTPGAAGAVGEPGRAGPPGAAGPRGPPGNIGMPGMSGPQGEAGRDGNPGNDGPPGRPGAA---------------GFKGDRGEPGPAGS 950          

HSP 5 Score: 74.3294 bits (181), Expect = 2.203e-12
Identity = 175/513 (34.11%), Postives = 210/513 (40.94%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDG---------------------YPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGS---------------------PGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGS---KGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQR------------------------GLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGS 6972
            +GEPG  G  G TG  G++GP G  G+ G  G +G  G  G +G    QGP GA G +G  G  GP G AG PG +GI G  G  G  G +G  G  G  G  G +G  G  G  G+ G DG                      PG  G  G PG  G+ G+ G  GP G  G  G  G PG +G  GP G  G++G  G  G  G  GP GPSG                      PG RG  G  G  G  G  G  GP G  G  GP G  G+   +G  G +G+ G PG  G+ G  GQ GI G                                  PG     G  GP G RG PG +G             SG QG +GPPG SG++                        G  G +G  G +G  G+ G  G+PG AG  GA+GP+GP    G++G  G  GP GE G  G  G +G PG PG  G        G +G  GP GS
Sbjct:  495 SGEPGKPGERGSTGPTGLRGPPGPDGNNGAAGPVGAVGAPGEKGE---QGPAGAAGFQGLPGPAGPAGEAGKPGERGIPGDQGVSGPAGAKGERGTNGSPGATGPQGPIGPRGPAGAPGADGGKGEPGAAGAAGAQGHQGAGGMPGERGAAGTPGPKGEKGEPGHKGPDGNSGRDGARGMPGPAGPPGPNGANGDKGESGSFGPAGPAGPRGPSGERGEVGPAGPPGFAGPPGADGQPGARGERGPSGGKGETGPSGPAGPAGQSGPSGPSGPAGAPGARGDTGPVGLTGFPGAAGRVGAPGQAGIVG---------------------------------PPGLAGPAGKDGPRGLRGDPGPAGP------------SGEQGMVGPPGVSGEKGSPGEPGPAGAPGPPGTTGPLGLQGFVGLSGARGDRGTPGAAGAVGEPGRAGPPGAAGPRGP---PGNIGMPGMSGPQGEAGRDGNPGNDGPPGRPGAAG------FKGDRGEPGPAGS 950          

HSP 6 Score: 65.855 bits (159), Expect = 8.356e-10
Identity = 197/496 (39.72%), Postives = 234/496 (47.18%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPG---RRGTVGS---PGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSG------QRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGN---------AGIRGVNGAPGIPGKDGENGK---DAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
            G PG  G  G  G PG+ G  G +G  G  GR G+ G  G +G  G  G  G+PG   +RG  G    PGP G AG  G  G  G  G  G  G  GPPG PG  GP+GE G  G  G  G  G  G PGS+G  G  G  G+PG  G++G  G  G PG  G PG +G RG  GP+G +G  G  G  GD GP G  G  G +G PG   + G QG PG +G +G  G  G  G TG+ G++G  G  G  G PG +G+ G +G+PG  G  G                           + G    PG  G  GE GP G  G  G PG+ GPPG+ G  GP G  G  G       RG        G  G  G KGP G+PG  G+ G++GP G RG  G  GN G  GPVG VG          AG  G  G PG  G  GE GK     + G +G  GP G+ G RG  G  G  GP G IG +G  G+ G
Sbjct:  151 GAPGPQGARGFPGTPGLPGMKGHRGYTGLDGRKGEPGAAGAKGEPGAHGAAGSPGLAGQRGLAGERGRPGPAGPAGARGADGNVGPAGPAGPMGAAGPPGFPGGPGPKGEVGPIGATGPSGPQGNRGEPGSNGAVGPVGPPGNPGANGLNGAKGAAGTPGPGGAPGFAGARGGPGPQGPQGAAGPRGLSGDPGPQGTKGDTGPKGEPG---NAGPQGAPGPQGEEGKRGPTGEIGATGAAGNRGARGAPGSRGLPGSEGRTGPIGMPGARGSTG---------------------------SAGPRGPPGDAGRAGEPGPAGLRGLPGSPGSSGPPGKEGAAGPSGQDGRPGPPGPSGPRGQ------PGNSGFTGPKGPSGEPGKPGERGSTGPTGLRGPPGPDGNNGAAGPVGAVGAPGEKGEQGPAGAAGFQGLPGPAGPAGEAGKPGERGIPGDQGVSGPAGAKGERGTNGSPGATGPQGPIGPRGPAGAPG 610          

HSP 7 Score: 59.3066 bits (142), Expect = 9.412e-8
Identity = 172/524 (32.82%), Postives = 207/524 (39.50%), Query Frame = 1
Query: 5842 GNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLG---------------------------------------SQGFPGARGPQGILGSPGPRGRT------------GSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQP---GPQGPLGERGPPGK------------SXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKG---------------PYGKPGIAGDNGASGPQGPRGENGDL------------------GNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPI------GSSGRRGPQGMTGIQGPPGSI---------GLKGDIGSTGPMGR 7071
            G +G PG QG  G      + G +G PG  G +G  G +G +G  G  G IG  G  G+ G RGAPG  G PG  G  GP G+ G                             GS G  GP GP G  G  G PG  G  G                                       + GF G +GP G  G PG RG T            G+ G+ G +G  G PG  G+ G AG  G  G  GP G  G  G  G  G PG  G  GPAG  G  G N  P   GPQGP+G RGP G             +G  G  G+ G  G  G +G  G PG  G++G PG  GP G  G  G++G                 G+ G  G  G +GP+GP GE G++                  G  GE+GP G  G  G  G  G  G  G  G +G     GA+G+ GP+      G++GR G  G  GI GPPG           GL+GD G  GP G 
Sbjct:  337 GLSGDPGPQGTKG------DTGPKGEPGNAGPQGAPGPQGEEGKRGPTGEIGATGAAGNRGARGAPGSRGLPGSEGRTGPIGMPG---------------------------ARGSTGSAGPRGPPGDAGRAGEPGPAGLRGLPGSPGSSGPPGKEGAAGPSGQDGRPGPPGPSGPRGQPGNSGFTGPKGPSGEPGKPGERGSTGPTGLRGPPGPDGNNGAAGPVGAVGAPGEKGEQGPAGAAGFQGLPGPAGPAGEAGKPGERGIPGDQGVSGPAGAKGERGTNGSPGATGPQGPIGPRGPAGAPGADGGKGEPGAAGAAGAQGHQGAGGMPGERGAAGTPGPKGEKGEPGHKGPDGNSGRDGARGMPGPAGPPGPNGANGDKGESGSFGPAGPAGPRGPSGERGEVGPAGPPGFAGPPGADGQPGARGERGPSGGKGETGPSGPAGPAGQSGPSGPSGPAGAPGARGDTGPVGLTGFPGAAGRVGAPGQAGIVGPPGLAGPAGKDGPRGLRGDPGPAGPSGE 827          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Medaka
Match: col2a1a (collagen type II A [Source:NCBI gene;Acc:100682394])

HSP 1 Score: 159.844 bits (403), Expect = 2.165e-38
Identity = 86/254 (33.86%), Postives = 127/254 (50.00%), Query Frame = 1
Query: 8512 PVRTVRRD------LLNDDA---LAVKYLGSDV--VKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASDVTEYRSWFGE-ITGTFKFDY-------QIEASQLMFLKLFSTNARQRITINCSRL-----SVVGNSEHPVILYSDHDEEVLRNGD-LFKYSVIRDGCKNSAEIIDSTELEMDTEAI-RLPIRDIA-LNTGSSKEQQQFGLDIGQVCF 9192
            P+R +R D      L   DA     +K L + +  ++ P G+K  PARTC+ L   +P+ + G Y+IDPN G   DA +V C  +  ESC+     S   K+W +S       WFGE + G F F+Y          A Q+ FL+L ST A Q +T +C        +  GN +  ++L   +D E+   G+  F YSV+ D C         T +E  ++   RLPI DIA ++ G +   Q+FG+D+G VCF
Sbjct: 1169 PLRYMRADQAAAGNLRQHDAEVDATIKSLNNQIENIRSPEGSKKNPARTCRDLKLCHPDWKSGDYWIDPNQGCTVDAIKVFCNMETGESCVYPNPSSIPRKNWWSSKSRNKHVWFGETMNGGFHFNYGDDSLAPNTAAIQMNFLRLLSTEASQNLTYHCKNSVAYMDASTGNLKKALLLQGSNDVEIRAEGNSRFTYSVMEDSCTEHTGKWGKTVMEYRSQKTSRLPIVDIAPMDIGGA--DQEFGVDVGPVCF 1420          

HSP 2 Score: 99.3673 bits (246), Expect = 5.629e-20
Identity = 190/513 (37.04%), Postives = 235/513 (45.81%), Query Frame = 1
Query: 5656 INGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILG---PRGNLGPQGPTGAPGRRGTVGSPGPVG---NAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPG---------LRGNPGVIG---SLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVG------IXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGA---------------------SGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
              GP GP G  G  G  G KG+ G +G +G  G+ G   P+G  G +GP G PG  G +G PG  G   N G PG  G++G+                                 KG+ G+ G PG+ G +GA G+ G PG++G+ G  G+ G PG                        + G +G +GP G  G  G          RG PGV+G     G+ G PG  G +G+LG+PG RG  G  G  G+ G  G  G  G+ G+ GQ G      +PG  GPPG  G  G  G+PG  G  G  GP G  G PG+    GPQG  G RG PG  G DG  G +GP G  G QGP G  G  G+RG  G  GP G +G+ G KGP G    AG +GA                     SGP GP G  G  G  G++G  G  G AG  G  GA G PG  GE G+    G  G  GP G SG  GP G TG+ GP G+ G +G  G+TG
Sbjct:  379 ATGPLGPKGTSGDPGIAGFKGEAGPKGEIGPPGLQGAPGPQGEEGKRGPRGEPGAAGPLGPPGERGAPGNRGFPGQDGLAGQ---------------------------------KGAPGERGPPGASGAKGATGDPGRPGESGLPGARGLTGRPG------------------------DAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMGFPGPKGATGEPGKSGEKGLLGAPGLRGLPGKDGETGSAGPPGPAGPAGERGEQGQPGPSGFQGLPGPPGPPGEGGKPGDQGVPGEAGAAGATGPRGERGFPGERGPAGPQGLQGPRGLPGTPGTDGPKGAIGPAGSRGAQGPQGLQGMPGERGAAGIPGPKGDRGDLGEKGPEG---AAGKDGARGLTGPIGPPGPGGPNGEKGESGPAGPSGAPGTRGAPGDRGETGPPGPAGFAGPPGADGQPGTKGEQGEPGQKGEAGAPGPQGPSGAPGPAGPTGVSGPKGARGAQGPPGATG 831          

HSP 3 Score: 96.2857 bits (238), Expect = 4.907e-19
Identity = 60/274 (21.90%), Postives = 124/274 (45.26%), Query Frame = -3
Query:  229 KTEKISSIDPNDEDEDIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCIEPEVVNYKKTSYTKTISS----WFSVLASLNKQISYKIPKEQLVFXXXXXXXXXXXXXXSCDQIALVSDDSITQDIRYN--NSVQLF----GDDNQILTVNNEDDL---------FQYKVVEDTCKDKSNN-GRAVIKVEXXXXXXXXXXXLNFKSIENSRPAMI--------------GIEIGPVCF 948
            + ++ ++ +    D ++   +  L++ ++N+  P GSK  PAR+C D++  + +  +G ++IDPN G   DAI V CN +  E+C+ P   +  + ++  + S     WF    ++N    +    + L            T  +  + + L+S ++ +Q++ Y+  NSV       G+  + L +   +D+         F Y V+ED+C + +   G+ V++               ++S + SR  ++              G+++GPVCF
Sbjct: 1174 RADQAAAGNLRQHDAEVDATIKSLNNQIENIRSPEGSKKNPARTCRDLKLCHPDWKSGDYWIDPNQGCTVDAIKVFCNMETGESCVYPNPSSIPRKNWWSSKSRNKHVWFG--ETMNGGFHFNYGDDSLA---------PNTAAIQMNFLRLLSTEA-SQNLTYHCKNSVAYMDASTGNLKKALLLQGSNDVEIRAEGNSRFTYSVMEDSCTEHTGKWGKTVME---------------YRSQKTSRLPIVDIAPMDIGGADQEFGVDVGPVCF 1420          

HSP 4 Score: 91.6633 bits (226), Expect = 1.414e-17
Identity = 209/570 (36.67%), Postives = 241/570 (42.28%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPS------------GVKGDPGKTXXXXX---------------XXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNG------------PSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGK---------------DGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            GEPG  GP GP G  G  G  G  G  G  G+ G  G  GP G  G +G TG PGR G  G PG  G  G PG  G  G+ G  G PG  G PG PG +G  G+ G  G  G KG+ G+ G  G  G  GAPG  G PGK G  G +            G +G PG +G  G                 G  G  G  G  G  GE G  G+ GP GP G  G RG PG          PG  GP+G +G  G RG  G +G QG  G  G  G PG  G  G +G                                          + GP+G  G+ G  G +G  G PG  GP G+ G  GP GP G  G RG PG  G            P G  G  G+KG  G+PG  G+ GA GPQGP G  G  G TG  GP G  G  G  G  G PG  G+                G  GKD   G +G+ GP G       QG  G++GP G+ G KGD G  GP G  G  G  G  G  G  G  G +G++G PG PG  G  G Q
Sbjct:  429 GEPGAAGPLGPPGERGAPGNRGFPGQDGLAGQKGAPGERGPPGASGAKGATGDPGRPGESGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMGFPGPKGATGEPGKSGEKGLLGAPGLRGLPGKDGETGSAGPPGPAGPAGERGEQGQPGPSGFQGLPGPPGPPGEGGKPGDQGVPGEAGAAGATGPRGERGFPGERGPAGPQGLQGPRGLPGT---------PGTDGPKGAIGPAGSRGAQGPQGLQGMPGERGAAGIPGPKGDRGDLG------------------------------------------EKGPEGAAGKDGARGLTGPIGPPGPGGPNGEKGESGPAGPSGAPGTRGAPGDRGETGPPGPAGFAGPPGADGQPGTKGEQGEPGQKGEAGAPGPQGPSGAPGPAGPTGVSGPKGARGAQGPPGATGFPGAAGRVGPPGPNGNPGPAGPAGPPGKDGPKGVRGDPGPAGR------QGDAGLRGPAGAPGEKGDAGEDGPNGPSGPSGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQ 941          

HSP 5 Score: 84.3445 bits (207), Expect = 2.368e-15
Identity = 206/528 (39.02%), Postives = 248/528 (46.97%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKG---PYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGN---------PGTPGVIGPQ 7191
            G+ G  GP+GP G  G  G  G+ G KG RG  G DG  G  G +G +G  GAPG     G+PGP+G  G PG +G  G  G  G  G  G PG  G  GP G  G+ G  G  GS G+ G  G+ G  GA G  G+ G  G  GPSG  G+PG  G PG  G  G  G  G  G  G  G  G  G  GP G  G  G+PG+ G  G  G  G  GP G+ G+PGP+G  G +G +G  G AG  G PG+ G  G  G                                     PG++   G +G  GERGPPG S               G +G  G PG  G+ GLPG+ G +G  G+ G +G   P G PG  G  G  GPQG RG+ G +G  G +G  GE G +G +G+ GAPG+    G  GKD   G+ G  GP G +G RG QG  G  G  G  G  G  G  G  G  GVPG  G  G  GP G  GF G++G  G          PGTPG  GP+
Sbjct:  195 GKSGERGPSGPQGARGFPGTPGLPGIKGHRGYPGLDGAKGETGAVGAKGEAGAPGE---SGAPGPMGPRGLPGERGRPGSTGAAGARGNDGLPGPAGPPGPVGPAGAPGFPGSPGSKGEAGPTGARGPEGAQGPRGESGTPGSPGPSGASGNPGTDGIPGAKGSAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGTSGDPGIAGFKGEAGPKGEIGPPGLQGAPGPQGEEGKRGPRGEPGAAGPLGPPGERGAPGNRGF------------------------------------PGQDGLAGQKGAPGERGPPGAS---------------GAKGATGDPGRPGESGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMGFPGPKGATGEPGKSGEKGLLGAPGL---RGLPGKDGETGSAGPPGPAGPAGERGEQGQPGPSGFQGLPGPPGPPGEGGKPGDQGVPGEAGAAGATGPRGERGFPGERGPAGPQGLQGPRGLPGTPGTDGPK 665          

HSP 6 Score: 72.0182 bits (175), Expect = 1.249e-11
Identity = 167/446 (37.44%), Postives = 194/446 (43.50%), Query Frame = 1
Query: 5794 TGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGT---PGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKP---GIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVD------------------GAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
             G PG+ G  G  GP G  G PG  G+ G                         KG +G  G+ G+ G+ G  G+ G+ GAPGE G PG  G  G  G +G PG TG  G  G  G  GP G  G +G  G+                G PG  GS G  G  GARGP+G     GPRG +G+ GS G  G +G PGT   PG  G AG  GI       G PG  GP G PG  G  G  GP G  G PG     G  GP GE GPPG                 G  GP G  G  G RG PG+ GP G  G +G+ G  G P   G+AG  GA G +GP G +G  G TG+ G  GE G  G RG+ G PG  G  G+ G                       G  G  GP G++G  G  G  G+ G PG  GL G  G TG
Sbjct:  191 AGKPGKSGERGPSGPQGARGFPGTPGLPG------------------------IKGHRGYPGLDGAKGETGAVGAKGEAGAPGESGAPGPMGPRGLPGERGRPGSTGAAGARGNDGLPGPAGPPGPVGPAGAP---------------GFPGSPGSKGEAGPTGARGPEGAQ---GPRGESGTPGSPGPSGASGNPGTDGIPGAKGSAGAPGI------AGAPGFPGPRGPPGPQGATGPLGPKGTSGDPGIAGFKGEAGPKGEIGPPG---------------LQGAPGPQGEEGKRGPRGEPGAAGPLGPPGERGAPGNRGFPGQDGLAGQKGAPGERGPPGASGAKGATGDPGRPGESGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMGFPGPKGATGEPGKSGEKGLLGAPGLRGLPGKDGETG 573          

HSP 7 Score: 61.6178 bits (148), Expect = 1.782e-8
Identity = 178/465 (38.28%), Postives = 203/465 (43.66%), Query Frame = 1
Query: 5653 GINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGIL---------------------GPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPG---------------------KSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGEN 6921
            G+ G  G  G+PG KG  G  G+KG  G  GKDG                       GP G  G  G  GAPG RG  G PGP G AG PG  G  G                           ++G  G  G  G+ G PG  G  GAPG  G  G +G  G  G +G PG TG PG +GR GP GP GN G  G  G  G  GP G  G PG  G  G  G  G  G PG +G     G  GP G +G  G QG  G  G+ G PG+ G+ G  G+PG +G PG+ G  G  G  G PG  G PG  G  G PG+   PG  GP G  G  G                       G  G  G  G  G+ G QGP GP G +G RG+PG  GP G KG  G  G  G+ G  G  G  G  GP G+ GD G TG  GP G+      RG  G  G  G+DG N
Sbjct:  684 GMPGERGAAGIPGPKGDRGDLGEKGPEGAAGKDGARGLTGPIGPPGPGGPNGEKGESGPAGPSGAPGTRGAPGDRGETGPPGPAGFAGPPGADGQPG---------------------------TKGEQGEPGQKGEAGAPGPQGPSGAPGPAGPTGVSGPKGARGAQGPPGATGFPGAAGRVGPPGPNGNPGPAGPAGPPGKDGPKGVRGDPGPAGRQGDAGLRGPAGAPGEKG---DAGEDGPNGPSGPSGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGGPGDRGPPGPVGPPGLTGPAGEPGREGNPGSDGPPGRDGSAGIKGDRGNTGPVGASGAPGAPGAPGPVGPTGKQGDRGEPGPQGPAGPSGPAGARGMPGPQGPRGDKGEAGEGGERGQKGHRGFTGLQGLPGPPGQAGDQGATGPAGPAGQ------RGPPGPVGPSGRDGAN 1112          

HSP 8 Score: 58.151 bits (139), Expect = 1.944e-7
Identity = 86/176 (48.86%), Postives = 100/176 (56.82%), Query Frame = -3
Query: 3067 GSKGNVGPLGPKGEPGFQGNRGGRGSPGATGASGKRGSIGPQGENGFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDTGLQGSQGMPGLEGAKGKRGERGSIGMPGELGKRGVRGSPGIDGSIGYAGGRGLSGMRXXXXXXXXXXXXGLQGDSGPPGAIGNKGSQGD 3594
            GSKG  GP G +G  G QG RG  G+PG+ G SG  G+ G  G  G KG  G  G  G PG  G RGPPG +G  G  GP G  GD G+ G +G  G +G  G  G +G+ G  GE GKRG RG PG  G +G  G RG  G RG PG +G  G  G  G+ GPPGA G KG+ GD
Sbjct:  306 GSKGEAGPTGARGPEGAQGPRGESGTPGSPGPSGASGNPGTDGIPGAKGSAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGTSGDPGIAGFKGEAGPKGEIGPPGLQGAPGPQGEEGKRGPRGEPGAAGPLGPPGERGAPGNRGFPGQDGLAGQKGAPGERGPPGASGAKGATGD 481          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Medaka
Match: col1a2 (collagen type I alpha 2 chain [Source:NCBI gene;Acc:105355091])

HSP 1 Score: 157.918 bits (398), Expect = 7.060e-38
Identity = 88/242 (36.36%), Postives = 124/242 (51.24%), Query Frame = 1
Query: 8521 TVRRDLLNDDALAVKYLGSDV--VKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASDVTEYRSWFGE-ITGTFKFDYQIE-------ASQLMFLKLFSTNARQRITINCSRLSVV-----GNSEHPVILYSDHDEEVLRNGD-LFKYSVIRDGCKNSAEIIDSTELEMDT-EAIRLPIRDIA-LNTGSSKEQQQFGLDIGQVCF 9192
            T+R      DA  +K L + +  +  P G++  PARTC+ +   +P    GFY+IDPN G  +DA +V C    +E+CI S   S   K+W  S   +   WFGE I G  +F Y  E       A+QL F++L S  A Q IT +C           G+ +  V+L   +D E+  +G+  F +SV+ DGC         T +E  T +  RLPI DIA L+ G +   Q+FGLDIG VCF
Sbjct:  988 TLRAKDYEVDAT-IKSLNTQIENLLTPEGSRKNPARTCRDIKLGHPEWSSGFYWIDPNQGCINDAIKVFCDFTTRETCIYSHPESIARKNWYRSTENKKHVWFGETINGGTEFAYNDETLSPQSMATQLAFMRLLSNQASQNITYHCKNSIAYMDGESGSLKKAVLLQGSNDVELRADGNSRFIFSVLEDGCTRHTGEWSKTVIEYRTNKPSRLPILDIAPLDIGEA--DQEFGLDIGPVCF 1226          

HSP 2 Score: 99.7525 bits (247), Expect = 3.734e-20
Identity = 73/263 (27.76%), Postives = 124/263 (47.15%), Query Frame = -3
Query:  229 DLFQNDQPKTEKISSIDPNDEDEDIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCI--EPEVVN----YKKTSYTKTISSWF-------SVLASLNKQISYKIPKEQLVFXXXXXXXXXXXXXXSC-DQIALVSDDSITQDIRYNNSVQLFGDDNQILTVNNEDDLFQYKVVEDTCKDKSNNGRAVIKVEXXXXXXXXXXXLNFKSIENSRPAM-IGIEIGPVCF 972
            D ++ DQP            +D ++   +  L++ ++NL  P GS+  PAR+C DI+  +   S+G ++IDPN G   DAI V C+F   ETCI   PE +     Y+ T   K +  WF       +  A  ++ +S +    QL F++L S  +SQ +T  C + IA +  +S +       +V L G ++  L  +  +  F + V+ED C   +      + +E    +   +  L+   ++        G++IGPVCF
Sbjct:  980 DEYRADQPTLRA--------KDYEVDATIKSLNTQIENLLTPEGSRKNPARTCRDIKLGHPEWSSGFYWIDPNQGCINDAIKVFCDFTTRETCIYSHPESIARKNWYRSTENKKHV--WFGETINGGTEFAYNDETLSPQSMATQLAFMRLLSNQASQNITYHCKNSIAYMDGESGS----LKKAVLLQGSNDVELRADG-NSRFIFSVLEDGCTRHTGEWSKTV-IEYRTNKPSRLPILDIAPLDIGEADQEFGLDIGPVCF 1226          

HSP 3 Score: 74.3294 bits (181), Expect = 2.272e-12
Identity = 190/528 (35.98%), Postives = 227/528 (42.99%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGR----MGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVG---------------------------------NAGHPGVQGIS---------GRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGE---NGDLGNTGEQGPVGEVGNAGIRGVN---------------------------GAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGM 6999
            G PG+ G  G TG+ G KG  G  G K +  +     G+ G+ G RG  GP GP GA G  G VG  GP G                                 N G PG  G           G+     + G  GP G PG  G  G  G QG  G  G  G  G PG  G +G  G  G+PG AG  G  G +G+ GK                               GP G  G+ G  GN G  G+ GS+G PG+ G  G +G PG RG TGS G +G       PG  G+ G+ G  G+ G +G  GRPGP GP G  G PG  G  GP G  G PGK  + G  GP G RGPPG  G++G  G VG       +G  GP G +G +GLPG  GP+G  G  G +      GI GD G SGP G +GE   NG  G TG QGP+G  G AG  G +                           GA G PG  GE G+       G+ GP G+SGR G +GM
Sbjct:  122 GLPGMKGHRGYTGLDGRKGEPGAAGAKVREHQTSLLQGQRGLAGERGRPGPAGPAGARGADGNVGPAGPAGPMGAAGPPGFPGGPGPKGEVGPIGATGPSGPQGNRGEPGSNGAVGPVGPPVSIGKCSFSAKFGTPGPGGAPGFAGARGGPGPQGPQGAAGPRGLSGDPGPQGTKGDTGPKGEPGNAGPQGAPGPQGEEGKR------------------------------GPTGEIGATGAAGNRGARGAPGSRGLPGSEGRTGPIGMPGARGSTGSAGPRGP------PGDAGRAGEPGPAGLRGPSGQDGRPGPPGPSGPRGQPGNSGFTGPKGPSGEPGKPGERGSTGPTGLRGPPGPDGNNGAAGPVGAGAPG-EKGEQGPAGAAGFQGLPGPAGPAGEAGKPGER------GIPGDQGVSGPAGAKGERGTNGSPGATGPQGPIGPRGPAGAPGADGGKGEPGAAGAAGAQGHQGAGGMPGERGAAGTPGPKGEKGE------PGHKGPDGNSGRDGARGM 600          

HSP 4 Score: 72.7886 bits (177), Expect = 6.740e-12
Identity = 189/516 (36.63%), Postives = 229/516 (44.38%), Query Frame = 1
Query: 5653 GINGPTGPTG---------VPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPG---------------------------RRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGS-KGPYGKPGIAGD---------------------NGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAV--------DGAKGNIGPIGSSGRRGPQGMT 7002
            G+ GP GP G         +PG +G  G  G KG+RG  G  G  GP+G +GP+GP GAPG                            RG  G+PGP G  G PG +G  G  G  G  GM GP G PG  G  G+KG +G +G  G  G  G PG+DG+ GA GE G  G  G  GPSG  G  G++                           G  GP GP+G+PG RG+ G +G  G  G  G  G  G  G  GP G  G  G  G  G+ G PG  G  G+ G VG PG +G  G PG  GP G PG PG  G  G  GF G  G     G  G  G  G PG++G              G  GP GPPGN G   +PG +GP G  G   S  G  G+PG AG                       G +GP GPRGE G  G+ GE+G  G  G+ G++G+ G P + G  G++G            DG  G  G IG+ G RGP G +
Sbjct:  479 GLPGPAGPAGEAGKPGERGIPGDQGVSGPAGAKGERGTNGSPGATGPQGPIGPRGPAGAPGADGGKGEPGAAGAAGAQGHQGAGGMPGERGAAGTPGPKGEKGEPGHKGPDGNSGRDGARGMPGPAGPPGPNGANGDKGERGEVGPAGPPGFAGPPGADGQPGARGERGPSGGKGETGPSGPAGPAGQS---------------------------GPSGPSGPAGAPGARGDTGPVGLTGFPGAAGRVGAPGQAGIVGPPGLAGPAGKDGPRGLRGDPGPAGPSGEQGMVGPPGVSGEKGSPGEPGPAGAPGPPGTTGPLGLQGFVGLSGARGDRGTPGAAGAVGEPGRAGP------------PGAAGPRGPPGNIG---MPGMSGPQGEAGRDVSLNGDRGEPGPAGSMGLGGAPGPAGPTGAPGRPGGRGEAGPAGPRGEKGVAGDKGERGMKGLRGHPGLQGMPG-PSVSGPAGDSGPGPAGPHGPPGKDGRAGAHGTIGAPGARGPPGFS 951          

HSP 5 Score: 70.4774 bits (171), Expect = 3.606e-11
Identity = 196/544 (36.03%), Postives = 229/544 (42.10%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKG------PLGVKGDKGQRGRMGKDGILGPR---------------------GNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRG------LPGSNGPSGTKGNKGSKGPYGKPGIAG------------DNGASGPQGPRGENGDLGNTGEQGPV---------------------GEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGP---IGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMG 7068
            G PG  G TGP G+PG +G      P G  GD G+ G  G  G+ GP                      G  GP+GP+G PG+ G  GS GP G  G PG  G +                 P   G  GEKG QG  G  G  G  G  G  G+ G PGE G PG  G+ GP+G KG+ G  G+PG                    G +G IGP GP+G+PG  G  G  G+ G+ G  G +G  G+ G  G  G  G KG +G  G  G  G  G+DG  G  G  G  GP G  G  G  G  G  G  G  GP G  G PG   + GP G  GE GP G +G  G         QSG  GP GP G  G RG      L G  G +G  G  G  G  G PG+AG            D G +GP G +G  G  G +GE+G                       G VG +G RG  G PG  G  GE G+    GA G  GP   IG  G  GPQG  G       + L GD G  GP G
Sbjct:  348 GLPGSEGRTGPIGMPGARGSTGSAGPRGPPGDAGRAGEPGPAGLRGPSGQDGRPGPPGPSGPRGQPGNSGFTGPKGPSGEPGKPGERGSTGPTGLRGPPGPDGNN-------------GAAGPVGAGAPGEKGEQGPAGAAGFQGLPGPAGPAGEAGKPGERGIPGDQGVSGPAGAKGERGTNGSPGA------------------TGPQGPIGPRGPAGAPGADGGKGEPGAAGAAGAQGHQGAGGMPGERGAAGTPGPKGEKGEPGHKGPDGNSGRDGARGMPGPAGPPGPNGANGDKGERGEVGPAGPPGFAGPPGADGQPGARGERGPSGGKGETGPSGPAGPAG---------QSGPSGPSGPAGAPGARGDTGPVGLTGFPGAAGRVGAPGQAGIVGPPGLAGPAGKDGPRGLRGDPGPAGPSGEQGMVGPPGVSGEKGSPGEPGPAGAPGPPGTTGPLGLQGFVGLSGARGDRGTPGAAGAVGEPGRAGPPGAAGPRGPPGNIGMPGMSGPQGEAGRD-----VSLNGDRGEPGPAG 846          

HSP 6 Score: 69.3218 bits (168), Expect = 6.561e-11
Identity = 180/504 (35.71%), Postives = 215/504 (42.66%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPR---------GNLGPQGPTGAPGRRGTVGSPGP------VGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIA------------GDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGR 7071
            TG  G  G  GP G PG +G  G +G  G+ G  G  G  G R         G+ G  GP G PG RG+ GS GP       G AG PG  G+ G                     P G+ G  G  G  G  GQ G  G  G +G  GE G PG+ G  GP+G++G PG  GN G +G  G               + G+ G  GP+G+ G +G PG  G  G  G PG RG  G  G  GP G  G +G+ G+ G  G  G  G  G AG  G              G  G PG  G  G  G  G  G PG+    G  GP GE+G PG                   +GP G  G  G RG+PG  GP G  G  G KG  G+ G A            G  GA G +GP G  G+ G +G  GP G+ G +G  G  GAPG  G  G  G     GA G +G  G +G  GP G+ G  G  G  GL+GD G  GP G 
Sbjct:  299 TGPKGEPGNAGPQGAPGPQGEEGKRGPTGEIGATGAAGNRGARGAPGSRGLPGSEGRTGPIGMPGARGSTGSAGPRGPPGDAGRAGEPGPAGLRG---------------------PSGQDGRPGPPGPSGPRGQPGNSGFTGPKGPSGEPGKPGERGSTGPTGLRGPPGPDGNNGAAGPVGAG-------------APGEKGEQGPAGAAGFQGLPGPAGPAGEAGKPGERGIPGDQGVSGPAGAKGERGTNGSPGATGPQGPIGPRGPAGAPGA------------DGGKGEPGAAGAAGAQGHQGAGGMPGERGAAGTPGPKGEKGEPGH------------------KGPDGNSGRDGARGMPGPAGPPGPNGANGDKGERGEVGPAGPPGFAGPPGADGQPGARGERGPSGGKGETGPSGPAGPAGQSGPSGPSGPAGAPGARGDTGPVGLTGFPGAAGRVGAPGQAGIVGPPGLAGPAGKDGPRGLRGDPGPAGPSGE 738          

HSP 7 Score: 59.6918 bits (143), Expect = 6.461e-8
Identity = 109/300 (36.33%), Postives = 132/300 (44.00%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKG---PLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGS---------------------------PGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPR-------------------GRTGSKGSQGTIGIAGVPGTPG 6393
             G+ G +GP+GP G PG +G   P+G+ G  G  GR+G  G  G  G  G  GP G  G RG  G PGP G +G  G+ G  G  G +G PG  GP G PG  G  G  G QG +G+ G+ G  G PG+ G  G PG  G PG AG  GP G  G PG +G  G +GR              ++   GD G  GP+GS                            G RG  GV G  G +G  G RG  G+ G PGP                    G+ G  G+ GTIG  G  G PG
Sbjct:  664 AGQSGPSGPSGPAGAPGARGDTGPVGLTGFPGAAGRVGAPGQAGIVGPPGLAGPAGKDGPRGLRGDPGPAGPSGEQGMVGPPGVSGEKGSPGEPGPAGAPGPPGTTGPLGLQGFVGLSGARGDRGTPGAAGAVGEPGRAGPPGAAGPRGPPGNIGMPGMSGPQGEAGR--------------DVSLNGDRGEPGPAGSMGLGGAPGPAGPTGAPGRPGGRGEAGPAGPRGEKGVAGDKGERGMKGLRGHPGLQGMPGPSVSGPAGDSGPGPAGPHGPPGKDGRAGAHGTIGAPGARGPPG 949          

HSP 8 Score: 58.151 bits (139), Expect = 1.646e-7
Identity = 177/500 (35.40%), Postives = 215/500 (43.00%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGP---------SGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGS---KGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKD-AVDGAKGNIGPI---------------GSSGRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
            GE G  G  G  G+PG  GP G  G  G+RG  G  G+ GP G  G +G  G+PG  G  G  GP G AG PG  G                 G PG  G  G +G QG  G+ G  G  G PG  G++G PG  G  G +G DG  G+                GP GP G  G  G+ G +G++GP GP          G PG RG  G  G  G  G  G  GP G  G  GP G  G+   +G  G +G+ G PG  G+ G  GQ GI G                                  PG     G  GP G RG PG +G             SG QG +GPPG SG++G PG  GP+G  G  G+ GP G  G  G +GA G +G  G  G +G  G  GP G  G  G  G  G PG+ G  GE G+D +++G +G  GP                G+ GR G +G  G  GP G  G+ GD G  G
Sbjct:  467 GEQGPAGAAGFQGLPGPAGPAGEAGKPGERGIPGDQGVSGPAGAKGERGTNGSPGATGPQGPIGPRGPAGAPGADGGK---------------GEPGAAGAAGAQGHQGAGGMPGERGAAGTPGPKGEKGEPGHKGPDGNSGRDGARGMP---------------GPAGPPGPNGANGDKGERGEVGPAGPPGFAGPPGADGQPGARGERGPSGGKGETGPSGPAGPAGQSGPSGPSGPAGAPGARGDTGPVGLTGFPGAAGRVGAPGQAGIVG---------------------------------PPGLAGPAGKDGPRGLRGDPGPAGP------------SGEQGMVGPPGVSGEKGSPGEPGPAGAPGPPGTTGPLGLQGFVGLSGARGDRGTPGAAGAVGEPGRAGPPGAAGPRGPPGNIGMPGMSGPQGEAGRDVSLNGDRGEPGPAGSMGLGGAPGPAGPTGAPGRPGGRGEAGPAGPRGEKGVAGDKGERG 891          
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Medaka
Match: col2a1a (collagen type II A [Source:NCBI gene;Acc:100682394])

HSP 1 Score: 156.762 bits (395), Expect = 1.941e-37
Identity = 86/254 (33.86%), Postives = 127/254 (50.00%), Query Frame = 1
Query: 8512 PVRTVRRD------LLNDDA---LAVKYLGSDV--VKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASDVTEYRSWFGE-ITGTFKFDY-------QIEASQLMFLKLFSTNARQRITINCSRL-----SVVGNSEHPVILYSDHDEEVLRNGD-LFKYSVIRDGCKNSAEIIDSTELEMDTEAI-RLPIRDIA-LNTGSSKEQQQFGLDIGQVCF 9192
            P+R +R D      L   DA     +K L + +  ++ P G+K  PARTC+ L   +P+ + G Y+IDPN G   DA +V C  +  ESC+     S   K+W +S       WFGE + G F F+Y          A Q+ FL+L ST A Q +T +C        +  GN +  ++L   +D E+   G+  F YSV+ D C         T +E  ++   RLPI DIA ++ G +   Q+FG+D+G VCF
Sbjct: 1239 PLRYMRADQAAAGNLRQHDAEVDATIKSLNNQIENIRSPEGSKKNPARTCRDLKLCHPDWKSGDYWIDPNQGCTVDAIKVFCNMETGESCVYPNPSSIPRKNWWSSKSRNKHVWFGETMNGGFHFNYGDDSLAPNTAAIQMNFLRLLSTEASQNLTYHCKNSVAYMDASTGNLKKALLLQGSNDVEIRAEGNSRFTYSVMEDSCTEHTGKWGKTVMEYRSQKTSRLPIVDIAPMDIGGA--DQEFGVDVGPVCF 1490          

HSP 2 Score: 99.7525 bits (247), Expect = 4.103e-20
Identity = 190/513 (37.04%), Postives = 235/513 (45.81%), Query Frame = 1
Query: 5656 INGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILG---PRGNLGPQGPTGAPGRRGTVGSPGPVG---NAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPG---------LRGNPGVIG---SLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVG------IXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGA---------------------SGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
              GP GP G  G  G  G KG+ G +G +G  G+ G   P+G  G +GP G PG  G +G PG  G   N G PG  G++G+                                 KG+ G+ G PG+ G +GA G+ G PG++G+ G  G+ G PG                        + G +G +GP G  G  G          RG PGV+G     G+ G PG  G +G+LG+PG RG  G  G  G+ G  G  G  G+ G+ GQ G      +PG  GPPG  G  G  G+PG  G  G  GP G  G PG+    GPQG  G RG PG  G DG  G +GP G  G QGP G  G  G+RG  G  GP G +G+ G KGP G    AG +GA                     SGP GP G  G  G  G++G  G  G AG  G  GA G PG  GE G+    G  G  GP G SG  GP G TG+ GP G+ G +G  G+TG
Sbjct:  449 ATGPLGPKGTSGDPGIAGFKGEAGPKGEIGPPGLQGAPGPQGEEGKRGPRGEPGAAGPLGPPGERGAPGNRGFPGQDGLAGQ---------------------------------KGAPGERGPPGASGAKGATGDPGRPGESGLPGARGLTGRPG------------------------DAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMGFPGPKGATGEPGKSGEKGLLGAPGLRGLPGKDGETGSAGPPGPAGPAGERGEQGQPGPSGFQGLPGPPGPPGEGGKPGDQGVPGEAGAAGATGPRGERGFPGERGPAGPQGLQGPRGLPGTPGTDGPKGAIGPAGSRGAQGPQGLQGMPGERGAAGIPGPKGDRGDLGEKGPEG---AAGKDGARGLTGPIGPPGPGGPNGEKGESGPAGPSGAPGTRGAPGDRGETGPPGPAGFAGPPGADGQPGTKGEQGEPGQKGEAGAPGPQGPSGAPGPAGPTGVSGPKGARGAQGPPGATG 901          

HSP 3 Score: 93.5893 bits (231), Expect = 2.908e-18
Identity = 60/274 (21.90%), Postives = 124/274 (45.26%), Query Frame = -3
Query:  229 KTEKISSIDPNDEDEDIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCIEPEVVNYKKTSYTKTISS----WFSVLASLNKQISYKIPKEQLVFXXXXXXXXXXXXXXSCDQIALVSDDSITQDIRYN--NSVQLF----GDDNQILTVNNEDDL---------FQYKVVEDTCKDKSNN-GRAVIKVEXXXXXXXXXXXLNFKSIENSRPAMI--------------GIEIGPVCF 948
            + ++ ++ +    D ++   +  L++ ++N+  P GSK  PAR+C D++  + +  +G ++IDPN G   DAI V CN +  E+C+ P   +  + ++  + S     WF    ++N    +    + L            T  +  + + L+S ++ +Q++ Y+  NSV       G+  + L +   +D+         F Y V+ED+C + +   G+ V++               ++S + SR  ++              G+++GPVCF
Sbjct: 1244 RADQAAAGNLRQHDAEVDATIKSLNNQIENIRSPEGSKKNPARTCRDLKLCHPDWKSGDYWIDPNQGCTVDAIKVFCNMETGESCVYPNPSSIPRKNWWSSKSRNKHVWFG--ETMNGGFHFNYGDDSLA---------PNTAAIQMNFLRLLSTEA-SQNLTYHCKNSVAYMDASTGNLKKALLLQGSNDVEIRAEGNSRFTYSVMEDSCTEHTGKWGKTVME---------------YRSQKTSRLPIVDIAPMDIGGADQEFGVDVGPVCF 1490          

HSP 4 Score: 92.0485 bits (227), Expect = 9.613e-18
Identity = 210/570 (36.84%), Postives = 242/570 (42.46%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPS------------GVKGDPGKTXXXXXXXXXXXXXXXXXXXXXX---------------ELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNG------------PSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGK---------------DGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            GEPG  GP GP G  G  G  G  G  G  G+ G  G  GP G  G +G TG PGR G  G PG  G  G PG  G  G+ G  G PG  G PG PG +G  G+ G  G  G KG+ G+ G  G  G  GAPG  G PGK G  G +            G +G PG +G  G  G  GP G  G  G  G               E G  G+ GP GP G  G RG PG          PG  GP+G +G  G RG  G +G QG  G  G  G PG  G  G +G                                          + GP+G  G+ G  G +G  G PG  GP G+ G  GP GP G  G RG PG  G            P G  G  G+KG  G+PG  G+ GA GPQGP G  G  G TG  GP G  G  G  G  G PG  G+                G  GKD   G +G+ GP G       QG  G++GP G+ G KGD G  GP G  G  G  G  G  G  G  G +G++G PG PG  G  G Q
Sbjct:  499 GEPGAAGPLGPPGERGAPGNRGFPGQDGLAGQKGAPGERGPPGASGAKGATGDPGRPGESGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMGFPGPKGATGEPGKSGEKGLLGAPGLRGLPGKDGETGSAGPPGPAGPAGERGEQGQPGPSGFQGLPGPPGPPGEGGKPGDQGVPGEAGAAGATGPRGERGFPGERGPAGPQGLQGPRGLPGT---------PGTDGPKGAIGPAGSRGAQGPQGLQGMPGERGAAGIPGPKGDRGDLG------------------------------------------EKGPEGAAGKDGARGLTGPIGPPGPGGPNGEKGESGPAGPSGAPGTRGAPGDRGETGPPGPAGFAGPPGADGQPGTKGEQGEPGQKGEAGAPGPQGPSGAPGPAGPTGVSGPKGARGAQGPPGATGFPGAAGRVGPPGPNGNPGPAGPAGPPGKDGPKGVRGDPGPAGR------QGDAGLRGPAGAPGEKGDAGEDGPNGPSGPSGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQ 1011          

HSP 5 Score: 86.2705 bits (212), Expect = 5.800e-16
Identity = 208/531 (39.17%), Postives = 250/531 (47.08%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKG---PYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGI---PGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGN---------PGTPGVIGPQ 7191
            G+ G  GP+GP G  G  G  G+ G KG RG  G DG  G  G +G +G  GAPG     G+PGP+G  G PG +G  G  G  G  G  G PG  G  GP G  G+ G  G  GS G+ G  G+ G  GA G  G+ G  G  GPSG  G+PG  G PG  G  G  G  G  G  G  G  G  G  GP G  G  G+PG+ G  G  G  G  GP G+ G+PGP+G  G +G +G  G AG  G PG+ G  G  G                                     PG++   G +G  GERGPPG S               G +G  G PG  G+ GLPG+ G +G  G+ G +G   P G PG  G  G  GPQG RG+ G +G  G +G  GE G +G +G+ GAPG+   PGKDGE       G+ G  GP G +G RG QG  G  G  G  G  G  G  G  G  GVPG  G  G  GP G  GF G++G  G          PGTPG  GP+
Sbjct:  265 GKSGERGPSGPQGARGFPGTPGLPGIKGHRGYPGLDGAKGETGAVGAKGEAGAPGE---SGAPGPMGPRGLPGERGRPGSTGAAGARGNDGLPGPAGPPGPVGPAGAPGFPGSPGSKGEAGPTGARGPEGAQGPRGESGTPGSPGPSGASGNPGTDGIPGAKGSAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGTSGDPGIAGFKGEAGPKGEIGPPGLQGAPGPQGEEGKRGPRGEPGAAGPLGPPGERGAPGNRGF------------------------------------PGQDGLAGQKGAPGERGPPGAS---------------GAKGATGDPGRPGESGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMGFPGPKGATGEPGKSGEKGLLGAPGLRGLPGKDGET------GSAGPPGPAGPAGERGEQGQPGPSGFQGLPGPPGPPGEGGKPGDQGVPGEAGAAGATGPRGERGFPGERGPAGPQGLQGPRGLPGTPGTDGPK 735          

HSP 6 Score: 77.7962 bits (190), Expect = 1.820e-13
Identity = 194/520 (37.31%), Postives = 228/520 (43.85%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRM------------------------GKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGT------------KGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGL---------KGDIGSTGPMG 7068
            GE G  GP GP G+PG +G  G  G  G RG                          G  G  GP G  GP+G  G  G  GT GSPGP G +G+PG  GI G  G+ G PG+ G PG PG RGP G +G+ G LG KG+ G  G  G  G+ G  GE G PG  G  GP G +G  G                       GE G+ G +GP G  G+PG RG PG  G  G +G PG RGP G  G+ G  G  G  G  G  G  G+ G PG  G  G+VG               P G PG  G+ G PGP G  G PG    PGP+G  GE   PGK               SG +G +G P   G RGLPG +G +G+            +G +G  GP G  G+ G  G  G  G  G+ G  G  G  G  G  G  G  G  G  G  G  G  G     G  G  G IG +G RG QG  G+QG PG  G          +GD+G  GP G
Sbjct:  319 GESGAPGPMGPRGLPGERGRPGSTGAAGARGNDGLPGPAGPPGPVGPAGAPGFPGSPGSKGEAGPTGARGPEGAQGPRGESGTPGSPGPSGASGNPGTDGIPGAKGSAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGTSGDPGIAGFKGEAGPKGEIGPPGLQGAPGPQGEEGKRGPR---------------------GEPGAAGPLGPPGERGAPGNRGFPGQDGLAGQKGAPGERGPPGASGAKGATGDPGRPGESGLPGARGLTGRPGDAGPQGKVG---------------PSGAPGEDGRPGPPGPQGARGQPGVMGFPGPKGATGE---PGK---------------SGEKGLLGAP---GLRGLPGKDGETGSAGPPGPAGPAGERGEQGQPGPSGFQGLPGPPGPPGEGGKPGDQGVPGEAGAAGATGPRGERGFPGERGPAGPQGLQGPRGLPGTPGTDGPKGAIGPAGSRGAQGPQGLQGMPGERGAAGIPGPKGDRGDLGEKGPEG 781          

HSP 7 Score: 72.4034 bits (176), Expect = 9.502e-12
Identity = 167/446 (37.44%), Postives = 194/446 (43.50%), Query Frame = 1
Query: 5794 TGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGT---PGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKP---GIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVD------------------GAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
             G PG+ G  G  GP G  G PG  G+ G                         KG +G  G+ G+ G+ G  G+ G+ GAPGE G PG  G  G  G +G PG TG  G  G  G  GP G  G +G  G+                G PG  GS G  G  GARGP+G     GPRG +G+ GS G  G +G PGT   PG  G AG  GI       G PG  GP G PG  G  G  GP G  G PG     G  GP GE GPPG                 G  GP G  G  G RG PG+ GP G  G +G+ G  G P   G+AG  GA G +GP G +G  G TG+ G  GE G  G RG+ G PG  G  G+ G                       G  G  GP G++G  G  G  G+ G PG  GL G  G TG
Sbjct:  261 AGKPGKSGERGPSGPQGARGFPGTPGLPG------------------------IKGHRGYPGLDGAKGETGAVGAKGEAGAPGESGAPGPMGPRGLPGERGRPGSTGAAGARGNDGLPGPAGPPGPVGPAGAP---------------GFPGSPGSKGEAGPTGARGPEGAQ---GPRGESGTPGSPGPSGASGNPGTDGIPGAKGSAGAPGI------AGAPGFPGPRGPPGPQGATGPLGPKGTSGDPGIAGFKGEAGPKGEIGPPG---------------LQGAPGPQGEEGKRGPRGEPGAAGPLGPPGERGAPGNRGFPGQDGLAGQKGAPGERGPPGASGAKGATGDPGRPGESGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMGFPGPKGATGEPGKSGEKGLLGAPGLRGLPGKDGETG 643          

HSP 8 Score: 64.6994 bits (156), Expect = 2.179e-9
Identity = 185/506 (36.56%), Postives = 216/506 (42.69%), Query Frame = 1
Query: 5647 EPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQG---------FPGARG------------------------PQGILGSPGPRGR---------------------------TGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPG---------------------KSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGEN 6921
            E G  G  GP G  G++GP G+ G  G  G  G  G  G RG  GPQG  G PG RG  G PGP G+ G  G +G  G  G  G  G+ GP G PG  GP GEKG  G  G  G+ G  G PG  G+ G PG  G  G  G DG  G KG+ G+ G                     + G  G  GP GPSG+PG  G  GV G  G++G         FPGA G                        P+G+ G PGP GR                           +G  G QG  G  G+ G PG+ G+ G  G+PG +G PG+ G  G  G  G PG  G PG  G  G PG+   PG  GP G  G  G                       G  G  G  G  G+ G QGP GP G +G RG+PG  GP G KG  G  G  G+ G  G  G  G  GP G+ GD G TG  GP G+      RG  G  G  G+DG N
Sbjct:  704 ERGFPGERGPAGPQGLQGPRGLPGTPGTDGPKGAIGPAGSRGAQGPQGLQGMPGERGAAGIPGPKGDRGDLGEKGPEGAAGKDGARGLTGPIGPPGPGGPNGEKGESGPAGPSGAPGTRGAPGDRGETGPPGPAGFAGPPGADGQPGTKGEQGEPG---------------------QKGEAGAPGPQGPSGAPGPAGPTGVSGPKGARGAQGPPGATGFPGAAGRVGPPGPNGNPGPAGPAGPPGKDGPKGVRGDPGPAGRQGDAGLRGPAGAPGEKGDAGEDGPNGPSGPSGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGGPGDRGPPGPVGPPGLTGPAGEPGREGNPGSDGPPGRDGSAGIKGDRGNTGPVGASGAPGAPGAPGPVGPTGKQGDRGEPGPQGPAGPSGPAGARGMPGPQGPRGDKGEAGEGGERGQKGHRGFTGLQGLPGPPGQAGDQGATGPAGPAGQ------RGPPGPVGPSGRDGAN 1182          

HSP 9 Score: 59.3066 bits (142), Expect = 8.679e-8
Identity = 86/176 (48.86%), Postives = 100/176 (56.82%), Query Frame = -3
Query: 3067 GSKGNVGPLGPKGEPGFQGNRGGRGSPGATGASGKRGSIGPQGENGFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDTGLQGSQGMPGLEGAKGKRGERGSIGMPGELGKRGVRGSPGIDGSIGYAGGRGLSGMRXXXXXXXXXXXXGLQGDSGPPGAIGNKGSQGD 3594
            GSKG  GP G +G  G QG RG  G+PG+ G SG  G+ G  G  G KG  G  G  G PG  G RGPPG +G  G  GP G  GD G+ G +G  G +G  G  G +G+ G  GE GKRG RG PG  G +G  G RG  G RG PG +G  G  G  G+ GPPGA G KG+ GD
Sbjct:  376 GSKGEAGPTGARGPEGAQGPRGESGTPGSPGPSGASGNPGTDGIPGAKGSAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGTSGDPGIAGFKGEAGPKGEIGPPGLQGAPGPQGEEGKRGPRGEPGAAGPLGPPGERGAPGNRGFPGQDGLAGQKGAPGERGPPGASGAKGATGD 551          
BLAST of Collagen alpha-1(XXVII) chain B vs. Planmine SMEST
Match: SMESG000026651.1 (SMESG000026651.1)

HSP 1 Score: 1379.77 bits (3570), Expect = 0.000e+0
Identity = 1183/1185 (99.83%), Postives = 1184/1185 (99.92%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQXXXXXXXXXXXXXXVSFXXXXXXXXXXXXXXXXXXXXXXXXXXXVAXXXXXXXXXXXXXXXXXXXSIGLKGERGPNGIDGSIGPPGRNGAPGAVXXXXXXXXXXXXXXXXSVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRGSIGLPGPSGVPGIRGQQGRDGPRGEIGLNGDPGLPGDIGMPGASGSDGKAGEPGIRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNQGPTGGAGPEGSPGHLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKRGPDGERGNSGTEXXXXXXXXXXXXXXXXXXXAAGRPGSPGKPGTIGHPGWMGTVGNPGARGKSXXXXXXXXXXXXXXXXXXXXXXXQGSVGPTGTKGFPGENGSPGPVGMPGRDGPAXXXXXXXXXXXXXXXXXXAVFFPVRTVRRDLLNDDALAVKYLGSDVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASDVTEYRSWFGEITGTFKFDYQIEASQLMFLKLFSTNARQRITINCSRLSVVGNSEHPVILYSDHDEEVLRNGDLFKYSVIRDGCKNSAEIIDSTELEMDTEAIRLPIRDIALNTGSSKEQQQFGLDIGQVCFS 9195
            TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRPGNQGEPGMQGPPGLPGLRGPEGEKGSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTGNPGRSGRRGPRGPRGNRGIIGELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIPGKNGPPGRPGPVGPIGLPGHPGKDGKPGPAGFPGTPGKNMQPGPQGPLGERGPPGKSGDDGVPGNVGPPGQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRIGVPGIPGKPGIVGPPGPEGFKGDKGLPGNPGTPGVIGPQGLRGKRGKAGGLGKVSFTGRSGGQSGPRGKPGPSGKPGTSGPKGVAGPPGPMGEPGPTGPTGPIGSIGLKGERGPNGIDGSIGPPGRNGAPGAVGPQGLIGLPGTPGTTGSVGEIGPPGQIGPNGNSGKPGDDGKVGP+GPRGSIGLPGPSGVPGIRGQQGRDGPRGEIGLNGDPGLPGDIGMPGASGSDGKAGEPGIRGDPGTSGPMGPPGPAGTVGPQGNPGFPGKKGPRGPPGKMGPVGPVGNQGPTGGAGPEGSPGHLGVQGPEGTEGPPGPQGPTGPTGDRGGLGMDGSPGPTGKRGPDGERGNSGTEGKPGKPGKPGLNGKDGKDGAAGRPGSPGKPGTIGHPGWMGTVGNPGARGKSGVRGDPGDRGPNGNNGPPGEPGVQGSVGPTGTKGFPGENGSPGPVGMPGRDGPAGLPGPVGNTGPPGPPGPPAVFFPVRTVRRDLLNDDALAVKYLGSDVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIE KSPSYKLKHWDASDVTEYRSWFGEITGTFKFDYQIEASQLMFLKLFSTNARQRITINCSRLSVVGNSEHPVILYSDHDEEVLRNGDLFKYSVIRDGCKNSAEIIDSTELEMDTEAIRLPIRDIALNTGSSKEQQQFGLDIGQVCFS
Sbjct:  134 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRPGNQGEPGMQGPPGLPGLRGPEGEKGSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTGNPGRSGRRGPRGPRGNRGIIGELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIPGKNGPPGRPGPVGPIGLPGHPGKDGKPGPAGFPGTPGKNMQPGPQGPLGERGPPGKSGDDGVPGNVGPPGQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRIGVPGIPGKPGIVGPPGPEGFKGDKGLPGNPGTPGVIGPQGLRGKRGKAGGLGKVSFTGRSGGQSGPRGKPGPSGKPGTSGPKGVAGPPGPMGEPGPTGPTGPIGSIGLKGERGPNGIDGSIGPPGRNGAPGAVGPQGLIGLPGTPGTTGSVGEIGPPGQIGPNGNSGKPGDDGKVGPIGPRGSIGLPGPSGVPGIRGQQGRDGPRGEIGLNGDPGLPGDIGMPGASGSDGKAGEPGIRGDPGTSGPMGPPGPAGTVGPQGNPGFPGKKGPRGPPGKMGPVGPVGNQGPTGGAGPEGSPGHLGVQGPEGTEGPPGPQGPTGPTGDRGGLGMDGSPGPTGKRGPDGERGNSGTEGKPGKPGKPGLNGKDGKDGAAGRPGSPGKPGTIGHPGWMGTVGNPGARGKSGVRGDPGDRGPNGNNGPPGEPGVQGSVGPTGTKGFPGENGSPGPVGMPGRDGPAGLPGPVGNTGPPGPPGPPAVFFPVRTVRRDLLNDDALAVKYLGSDVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIEPKSPSYKLKHWDASDVTEYRSWFGEITGTFKFDYQIEASQLMFLKLFSTNARQRITINCSRLSVVGNSEHPVILYSDHDEEVLRNGDLFKYSVIRDGCKNSAEIIDSTELEMDTEAIRLPIRDIALNTGSSKEQQQFGLDIGQVCFS 1318          

HSP 2 Score: 108.612 bits (270), Expect = 6.222e-23
Identity = 75/237 (31.65%), Postives = 116/237 (48.95%), Query Frame = -3
Query:  226 DEDEDIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCIEPEVVNYKKTSYTKT----ISSWFSVLASLNKQISYKIPKEQLVFXXXXXXXXXXXXXXSCDQIALVSDDSITQDIRYNNSVQLFGDDNQILTVNNEDDLFQYKVVEDTCKDKS---NNGRAVIKVEXXXXXXXXXXXLNFKSIENSRPAMIGIEIGPVCFS 915
            D   D   A+  L S  D + KP G+K  PAR+C  +     N  +G +YIDPNGG   DA  V C   R E+CIEP+  +YK   +  +      SWF  +    K   Y+I   QL+FL+L S ++ Q +T++C ++++V +          + V L+ D ++ +  N   DLF+Y V+ D CK+ +   ++    +  E  R     I      S E  +    G++IG VCFS
Sbjct: 1098 DLLNDDALAVKYLGS--DVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIEPKSPSYKLKHWDASDVTEYRSWFGEITGTFK-FDYQIEASQLMFLKLFSTNARQRITINCSRLSVVGNS--------EHPVILYSDHDEEVLRNG--DLFKYSVIRDGCKNSAEIIDSTELEMDTEAIRLPIRDIALNTGSSKEQQQ---FGLDIGQVCFS 1318          

HSP 3 Score: 77.7962 bits (190), Expect = 1.305e-13
Identity = 74/180 (41.11%), Postives = 89/180 (49.44%), Query Frame = 1
Query: 6532 PGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGR 7071
            PGKN  PGPQGP GE                      G+ GP GP       G+PG  GP G KG+KG +G  GK GI G  G  GPQGP G  G  G  G  GPVG  G+ G++G++G PG  G+ G  G   + G +G  G  GS G  G +G  G  G PGS G +G  G  G  G+
Sbjct:  122 PGKNGDPGPQGPTGE---------------------PGINGPTGP------TGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRPGNQGEPGMQGPPGLPGLRGPEGEKGSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGK 274          

HSP 4 Score: 70.0922 bits (170), Expect = 3.277e-11
Identity = 67/67 (100.00%), Postives = 67/67 (100.00%), Query Frame = 1
Query: 5242 MIEKFMINXXXXXXXXXXXXXADSLNRIRRQSDDXXXXXXXXXXXXXXXXLPPGVKGPAPFAGSQYI 5442
            MIEKFMINLSLVFVLLIVLISADSLNRIRRQSDDEFTFGGAGEETTEGPTLPPGVKGPAPFAGSQYI
Sbjct:    1 MIEKFMINLSLVFVLLIVLISADSLNRIRRQSDDEFTFGGAGEETTEGPTLPPGVKGPAPFAGSQYI 67          

HSP 5 Score: 58.5362 bits (140), Expect = 9.930e-8
Identity = 112/326 (34.36%), Postives = 137/326 (42.02%), Query Frame = 1
Query: 6226 PGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVD---GAKGNIGPIGSSGRRGPQGMTGI------QGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPG 7176
            PG  G+PG  G  G  G  G  GP G+ G  GP G  G KG +G +G  G+ G  G  G  G  G                                     PG+    G  GP+G  G PG  G             SG  G  G PG  G  GLPG  GP G KG++G  G  G  G  G  G+ G +G  GE+GD G  G  GP G  G+ G  G  G  G  G  G  G   +    G+KG+IGP+G SG  G +G  G+      QG PG+ G +G +GS GP GR                G +G +G  G+ G PGTPG
Sbjct:  122 PGKNGDPGPQGPTGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTG------------------------------------APGRRGTVGSPGPVGNAGHPGVQGI------------SGRPGNQGEPGMQGPPGLPGLRGPEGEKGSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTGNPGRSGRRGPRGPRGNRGIIGELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGR---------------TGSKGSQGTIGIAGVPGTPG 384          

HSP 6 Score: 57.3806 bits (137), Expect = 2.424e-7
Identity = 124/353 (35.13%), Postives = 155/353 (43.91%), Query Frame = 1
Query: 6091 KGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLR------GNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGP---LGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGEN---------------------GDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
             G PG+TG  G  G  GP GP G+ G  G+ G  GD GP GP+G PG+       G PG+ G LG +G  G RG  G  G  GPRG  G +G  G  G  G  G+PG  G AG  G+                               G  G PG   +PG QGP    G RGP G               + G QG +G  G+ GQ G PGS+      G +G+ G +G PG AG +G SG +G  G+                      G+LG+ G+ GP+G  G+ G+RG  G  G  G  G  G     G  G+ GP G +G +G QG  GI G PG+ G  G  G  G
Sbjct:   92 TGTPGRTGTSGSDGPPGPPGPPGDNGQDGKPGKNGDPGPQGPTGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGV------------------------------QGISGRPGNQGEPGMQGPPGLPGLRGPEG---------------EKGSQGGLGIKGSIGQDGYPGSD------GKRGAPGEHGDPGKAGIDGPSGVKGDPGKTGNPGRSGRRGPRGPRGNRGIIGELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVG 393          

HSP 7 Score: 52.7582 bits (125), Expect = 6.515e-6
Identity = 177/491 (36.05%), Postives = 213/491 (43.38%), Query Frame = 1
Query: 5848 AGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGI---DGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGAR------------GPQGILGSPGPRGRTGSKGSQGTIGIAGV---PGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGP---QGPLGERGPPGKSXXXXXXXXXX------------XXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGA------------PGIPGKDGENGKDAVDGAKGNI---GPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPG 7176
             G PG  G  GR G  G  G  GPPG PG  G              G  G++G PG  G  G PG +G  G  G+    GP GVKGD G+ G  G+ G                LG +G++GP GP+G+PG RG  G  G +G+ G PG +            G QG  G PG RG  G KGSQG +GI G     G PG DGK G                                        PG++  PG     GP G +G PGK+G+ G  G  G              G  G  GP+GP G+ G RG PG  G  G++G  G++GP G  G  G  G +G +G +G  G  G  G  G  G+ G  GI G NG             PG PGKDG+ G     G  G     GP G  G RGP G +G  G PG++G  G  G  GP+G  G  G  G PG  GP G +G KG KG  G PG  G
Sbjct:   86 KGPPGPTGTPGRTGTSGSDGPPGPPGPPGDNGQ------------DGKPGKNGDPGPQGPTGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGI---------------LGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRPGNQGEPGMQGPPGLPGLRGPEGEKGSQGGLGIKGSIGQDGYPGSDGKRG---------------------------------------APGEHGDPGKAGIDGPSGVKGDPGKTGNPGRSGRRGPRGPRGNRGIIGELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIPGKNGPPGRPGPVGPIGLPGHPGKDGKPGPAGFPGTPGKNMQPGPQGPLGERGPPGKSGDDGVPGNVGPPGQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAG 510          
BLAST of Collagen alpha-1(XXVII) chain B vs. Planmine SMEST
Match: SMESG000026651.1 (SMESG000026651.1)

HSP 1 Score: 1378.62 bits (3567), Expect = 0.000e+0
Identity = 1183/1185 (99.83%), Postives = 1184/1185 (99.92%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQXXXXXXXXXXXXXXVSFXXXXXXXXXXXXXXXXXXXXXXXXXXXVAXXXXXXXXXXXXXXXXXXXSIGLKGERGPNGIDGSIGPPGRNGAPGAVXXXXXXXXXXXXXXXXSVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRGSIGLPGPSGVPGIRGQQGRDGPRGEIGLNGDPGLPGDIGMPGASGSDGKAGEPGIRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNQGPTGGAGPEGSPGHLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKRGPDGERGNSGTEXXXXXXXXXXXXXXXXXXXAAGRPGSPGKPGTIGHPGWMGTVGNPGARGKSXXXXXXXXXXXXXXXXXXXXXXXQGSVGPTGTKGFPGENGSPGPVGMPGRDGPAXXXXXXXXXXXXXXXXXXAVFFPVRTVRRDLLNDDALAVKYLGSDVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASDVTEYRSWFGEITGTFKFDYQIEASQLMFLKLFSTNARQRITINCSRLSVVGNSEHPVILYSDHDEEVLRNGDLFKYSVIRDGCKNSAEIIDSTELEMDTEAIRLPIRDIALNTGSSKEQQQFGLDIGQVCFS 9195
            TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRPGNQGEPGMQGPPGLPGLRGPEGEKGSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTGNPGRSGRRGPRGPRGNRGIIGELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIPGKNGPPGRPGPVGPIGLPGHPGKDGKPGPAGFPGTPGKNMQPGPQGPLGERGPPGKSGDDGVPGNVGPPGQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRIGVPGIPGKPGIVGPPGPEGFKGDKGLPGNPGTPGVIGPQGLRGKRGKAGGLGKVSFTGRSGGQSGPRGKPGPSGKPGTSGPKGVAGPPGPMGEPGPTGPTGPIGSIGLKGERGPNGIDGSIGPPGRNGAPGAVGPQGLIGLPGTPGTTGSVGEIGPPGQIGPNGNSGKPGDDGKVGP+GPRGSIGLPGPSGVPGIRGQQGRDGPRGEIGLNGDPGLPGDIGMPGASGSDGKAGEPGIRGDPGTSGPMGPPGPAGTVGPQGNPGFPGKKGPRGPPGKMGPVGPVGNQGPTGGAGPEGSPGHLGVQGPEGTEGPPGPQGPTGPTGDRGGLGMDGSPGPTGKRGPDGERGNSGTEGKPGKPGKPGLNGKDGKDGAAGRPGSPGKPGTIGHPGWMGTVGNPGARGKSGVRGDPGDRGPNGNNGPPGEPGVQGSVGPTGTKGFPGENGSPGPVGMPGRDGPAGLPGPVGNTGPPGPPGPPAVFFPVRTVRRDLLNDDALAVKYLGSDVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIE KSPSYKLKHWDASDVTEYRSWFGEITGTFKFDYQIEASQLMFLKLFSTNARQRITINCSRLSVVGNSEHPVILYSDHDEEVLRNGDLFKYSVIRDGCKNSAEIIDSTELEMDTEAIRLPIRDIALNTGSSKEQQQFGLDIGQVCFS
Sbjct:  129 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRPGNQGEPGMQGPPGLPGLRGPEGEKGSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTGNPGRSGRRGPRGPRGNRGIIGELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIPGKNGPPGRPGPVGPIGLPGHPGKDGKPGPAGFPGTPGKNMQPGPQGPLGERGPPGKSGDDGVPGNVGPPGQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRIGVPGIPGKPGIVGPPGPEGFKGDKGLPGNPGTPGVIGPQGLRGKRGKAGGLGKVSFTGRSGGQSGPRGKPGPSGKPGTSGPKGVAGPPGPMGEPGPTGPTGPIGSIGLKGERGPNGIDGSIGPPGRNGAPGAVGPQGLIGLPGTPGTTGSVGEIGPPGQIGPNGNSGKPGDDGKVGPIGPRGSIGLPGPSGVPGIRGQQGRDGPRGEIGLNGDPGLPGDIGMPGASGSDGKAGEPGIRGDPGTSGPMGPPGPAGTVGPQGNPGFPGKKGPRGPPGKMGPVGPVGNQGPTGGAGPEGSPGHLGVQGPEGTEGPPGPQGPTGPTGDRGGLGMDGSPGPTGKRGPDGERGNSGTEGKPGKPGKPGLNGKDGKDGAAGRPGSPGKPGTIGHPGWMGTVGNPGARGKSGVRGDPGDRGPNGNNGPPGEPGVQGSVGPTGTKGFPGENGSPGPVGMPGRDGPAGLPGPVGNTGPPGPPGPPAVFFPVRTVRRDLLNDDALAVKYLGSDVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIEPKSPSYKLKHWDASDVTEYRSWFGEITGTFKFDYQIEASQLMFLKLFSTNARQRITINCSRLSVVGNSEHPVILYSDHDEEVLRNGDLFKYSVIRDGCKNSAEIIDSTELEMDTEAIRLPIRDIALNTGSSKEQQQFGLDIGQVCFS 1313          

HSP 2 Score: 108.612 bits (270), Expect = 6.157e-23
Identity = 75/237 (31.65%), Postives = 116/237 (48.95%), Query Frame = -3
Query:  226 DEDEDIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCIEPEVVNYKKTSYTKT----ISSWFSVLASLNKQISYKIPKEQLVFXXXXXXXXXXXXXXSCDQIALVSDDSITQDIRYNNSVQLFGDDNQILTVNNEDDLFQYKVVEDTCKDKS---NNGRAVIKVEXXXXXXXXXXXLNFKSIENSRPAMIGIEIGPVCFS 915
            D   D   A+  L S  D + KP G+K  PAR+C  +     N  +G +YIDPNGG   DA  V C   R E+CIEP+  +YK   +  +      SWF  +    K   Y+I   QL+FL+L S ++ Q +T++C ++++V +          + V L+ D ++ +  N   DLF+Y V+ D CK+ +   ++    +  E  R     I      S E  +    G++IG VCFS
Sbjct: 1093 DLLNDDALAVKYLGS--DVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIEPKSPSYKLKHWDASDVTEYRSWFGEITGTFK-FDYQIEASQLMFLKLFSTNARQRITINCSRLSVVGNS--------EHPVILYSDHDEEVLRNG--DLFKYSVIRDGCKNSAEIIDSTELEMDTEAIRLPIRDIALNTGSSKEQQQ---FGLDIGQVCFS 1313          

HSP 3 Score: 77.7962 bits (190), Expect = 1.337e-13
Identity = 74/180 (41.11%), Postives = 89/180 (49.44%), Query Frame = 1
Query: 6532 PGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGR 7071
            PGKN  PGPQGP GE                      G+ GP GP       G+PG  GP G KG+KG +G  GK GI G  G  GPQGP G  G  G  G  GPVG  G+ G++G++G PG  G+ G  G   + G +G  G  GS G  G +G  G  G PGS G +G  G  G  G+
Sbjct:  117 PGKNGDPGPQGPTGE---------------------PGINGPTGP------TGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRPGNQGEPGMQGPPGLPGLRGPEGEKGSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGK 269          

HSP 4 Score: 58.5362 bits (140), Expect = 1.126e-7
Identity = 112/326 (34.36%), Postives = 137/326 (42.02%), Query Frame = 1
Query: 6226 PGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVD---GAKGNIGPIGSSGRRGPQGMTGI------QGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPG 7176
            PG  G+PG  G  G  G  G  GP G+ G  GP G  G KG +G +G  G+ G  G  G  G  G                                     PG+    G  GP+G  G PG  G             SG  G  G PG  G  GLPG  GP G KG++G  G  G  G  G  G+ G +G  GE+GD G  G  GP G  G+ G  G  G  G  G  G  G   +    G+KG+IGP+G SG  G +G  G+      QG PG+ G +G +GS GP GR                G +G +G  G+ G PGTPG
Sbjct:  117 PGKNGDPGPQGPTGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTG------------------------------------APGRRGTVGSPGPVGNAGHPGVQGI------------SGRPGNQGEPGMQGPPGLPGLRGPEGEKGSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTGNPGRSGRRGPRGPRGNRGIIGELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGR---------------TGSKGSQGTIGIAGVPGTPG 379          

HSP 5 Score: 58.5362 bits (140), Expect = 1.154e-7
Identity = 62/62 (100.00%), Postives = 62/62 (100.00%), Query Frame = 1
Query: 5257 MINXXXXXXXXXXXXXADSLNRIRRQSDDXXXXXXXXXXXXXXXXLPPGVKGPAPFAGSQYI 5442
            MINLSLVFVLLIVLISADSLNRIRRQSDDEFTFGGAGEETTEGPTLPPGVKGPAPFAGSQYI
Sbjct:    1 MINLSLVFVLLIVLISADSLNRIRRQSDDEFTFGGAGEETTEGPTLPPGVKGPAPFAGSQYI 62          

HSP 6 Score: 57.3806 bits (137), Expect = 2.569e-7
Identity = 124/353 (35.13%), Postives = 155/353 (43.91%), Query Frame = 1
Query: 6091 KGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLR------GNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGP---LGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGEN---------------------GDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
             G PG+TG  G  G  GP GP G+ G  G+ G  GD GP GP+G PG+       G PG+ G LG +G  G RG  G  G  GPRG  G +G  G  G  G  G+PG  G AG  G+                               G  G PG   +PG QGP    G RGP G               + G QG +G  G+ GQ G PGS+      G +G+ G +G PG AG +G SG +G  G+                      G+LG+ G+ GP+G  G+ G+RG  G  G  G  G  G     G  G+ GP G +G +G QG  GI G PG+ G  G  G  G
Sbjct:   87 TGTPGRTGTSGSDGPPGPPGPPGDNGQDGKPGKNGDPGPQGPTGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGV------------------------------QGISGRPGNQGEPGMQGPPGLPGLRGPEG---------------EKGSQGGLGIKGSIGQDGYPGSD------GKRGAPGEHGDPGKAGIDGPSGVKGDPGKTGNPGRSGRRGPRGPRGNRGIIGELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVG 388          

HSP 7 Score: 52.7582 bits (125), Expect = 6.790e-6
Identity = 178/491 (36.25%), Postives = 214/491 (43.58%), Query Frame = 1
Query: 5848 AGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGI---DGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGAR------------GPQGILGSPGPRGRTGSKGSQGTIGIAGV---PGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGP---QGPLGERGPPGKSXXXXXXXXXXXXX------------QSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGA------------PGIPGKDGENGKDAVDGAKGNI---GPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPG 7176
             G PG  G  GR G  G  G  GPPG PG  G              G  G++G PG  G  G PG +G  G  G+    GP GVKGD G+ G  G+ G                LG +G++GP GP+G+PG RG  G  G +G+ G PG +            G QG  G PG RG  G KGSQG +GI G     G PG DGK G                                        PG++  PG     GP G +G PGK+G+ G  G  GP G              G  GP+GP G+ G RG PG  G  G++G  G++GP G  G  G  G +G +G +G  G  G  G  G  G+ G  GI G NG             PG PGKDG+ G     G  G     GP G  G RGP G +G  G PG++G  G  G  GP+G  G  G  G PG  GP G +G KG KG  G PG  G
Sbjct:   81 KGPPGPTGTPGRTGTSGSDGPPGPPGPPGDNGQ------------DGKPGKNGDPGPQGPTGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGI---------------LGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRPGNQGEPGMQGPPGLPGLRGPEGEKGSQGGLGIKGSIGQDGYPGSDGKRG---------------------------------------APGEHGDPGKAGIDGPSGVKGDPGKTGNPGRSGRRGPRGPRGNRGIIGELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIPGKNGPPGRPGPVGPIGLPGHPGKDGKPGPAGFPGTPGKNMQPGPQGPLGERGPPGKSGDDGVPGNVGPPGQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAG 505          
BLAST of Collagen alpha-1(XXVII) chain B vs. Planmine SMEST
Match: SMESG000026649.1 (SMESG000026649.1)

HSP 1 Score: 1153.66 bits (2983), Expect = 0.000e+0
Identity = 1156/1159 (99.74%), Postives = 1157/1159 (99.83%), Query Frame = -3
Query:  121 VGSKGNVGPLGPKGEPGFQGNRGGRGSPGATGASGKRGSIGPQGENGFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDTGLQGSQGMPGLEGAKGKRGERGSIGMPGELGKRGVRGSPGIDGSIGYAGGRGLSGMRXXXXXXXXXXXXGLQGDSGPPGAIGNKGSQGDFXXXXXXXXXXXXXXXXXXXXXXPAGDQGSKGPNGAIXXXXXXXXXXXXXXXXXXXXXXXXXPTGAPGKTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSIGPEGRVGSEGPMGSQGKEXXXXXXXXXXDIGQKGPIGERGPPGDMGKVGSPGKKGQKGATGPVGFDGPKGLXXXXXXXXXXXXXXXXXXXXXXXITGPRGQKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGNKGLPGDTGPMGDKGAIGDTGDQGLTGDIGVPGQSGPQGEIGLKXXXXXXXXXXXXXXXXXXXXXGVPGLVGSKGKQGHPGRAGDRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEPGDAGTQGPPGAEGKNGDNGPAGEKGERGDXXXXXXXXXXXXXXXXXXXXXXGKLGPQGPIGDIGNPGTIGFPGNQGPPGRQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEIGKSGIRXXXXXXXXXXXXXXXXXXXXXGEPGRMGKDGPPGPQGKLGEAGFRGRXXXXXXXXXXXXXXXXXXXGDAGEPGDPGVSGNSGLIXXXXXXXXXXXXXXXGSQGPAGPTGNVGPKGERXXXXXXXXXXXXXXXXXXXXXXXXGENGQKGPQGSEXXXXXXXXXGEISTEYQSIFKRPRTTEDDESINLQNDDLFQNDQPKTEKISSIDPNDEDEDIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCIEPEVVNYKKTSYTKTISSWFSVLASLNKQISYKIPKEQLVFXXXXXXXXXXXXXXSCDQIALVSDDSITQDIRYNNSVQLFGDDNQILTVNNEDDLFQYKVVEDTCKDKSNNGRAVIKVEXXXXXXXXXXXLNFKSIENSRPAMIGIEIGPVCFSGLSEESKSQVKVQRQKREAPSDLSLKSLFSVLSQW 3597
            VG KGNVGPLGPKGEPGFQGNRGGRGSPGATGASGKRGSIGPQGENGFKGEPGNIGPPGRPGQGGMRGPPGVEGEPGTNGPNGPEGDTGLQGSQGMPGLEGAKGKRGERGSIGMPGELGKRGVRGSPGIDGSIGYAGGRGLSGMRGAPGPEGPPGPAGLQGDSGPPGAIGNKGSQGDFGPAGVRGNPGPRGPRGKRGQEGPAGDQGSKGPNGAIGNPGNMGPVGLVGPMGPQGPQGLRGPTGAPGKTGEPGQIGPRGQRGDRGPRGNPGSPGAPGIPGQKGQRGQPGKRGSIGPEGRVGSEGPMGSQGKEGDPGPPGPSGDIGQKGPIGERGPPGDMGKVGSPGKKGQKGATGPVGFDGPKGLIGQKGNIGIVGGPGPMGPIGNQGITGPRGQKGERGDDGPRGVPGPRGRLGPRGEDGPLGPPGDPGIPGNKGLPGDTGPMGDKGAIGDTGDQGLTGDIGVPGQSGPQGEIGLKGMKGEIGMRGGRGDPGDPGIKGVPGLVGSKGKQGHPGRAGDRGQPGEQGNQGPPGLLGEPGIIGSPGQQGRRGPPGPQGLSGSKGEPGDAGTQGPPGAEGKNGDNGPAGEKGERGDRGVIGIQGPPGPIGIPGPRGSSGKLGPQGPIGDIGNPGTIGFPGNQGPPGRQGIKGPPGTDG PGKEGMPGEEGPPGKDGEPGSSGEIGKSGIRGQPGEVGPPGVTGLVGPPGLRGEPGRMGKDGPPGPQGKLGEAGFRGRQGDSGDKGPKGPQGPLGPVGDAGEPGDPGVSGNSGLIGPPGDAGPAGNDGPKGSQGPAGPTGNVGPKGERGPKGVIGPEGIPGPAGPIGMPGPQGENGQKGPQGSEGPRGPPGKPGEISTEYQSIFKRPRTTEDDESINLQNDDLFQNDQPKTEKISSIDPNDEDEDIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAI+VHCNFDRLETCIEPEVVNYKKTSYTKTISSWFSVLASLNKQISYKIPKEQLVFLQLSSESSSQTLTLSCDQIALVSDDSITQDIRYNNSVQLFGDDNQILTVNNEDDLFQYKVVEDTCKDKSNNGRAVIKVELDRPRRLPIRDLNFKSIENSRPAMIGIEIGPVCFSGLSEESKSQVKVQRQKREAPSDLSLKSLFSVLSQW
Sbjct:  373 VGPKGNVGPLGPKGEPGFQGNRGGRGSPGATGASGKRGSIGPQGENGFKGEPGNIGPPGRPGQGGMRGPPGVEGEPGTNGPNGPEGDTGLQGSQGMPGLEGAKGKRGERGSIGMPGELGKRGVRGSPGIDGSIGYAGGRGLSGMRGAPGPEGPPGPAGLQGDSGPPGAIGNKGSQGDFGPAGVRGNPGPRGPRGKRGQEGPAGDQGSKGPNGAIGNPGNMGPVGLVGPMGPQGPQGLRGPTGAPGKTGEPGQIGPRGQRGDRGPRGNPGSPGAPGIPGQKGQRGQPGKRGSIGPEGRVGSEGPMGSQGKEGDPGPPGPSGDIGQKGPIGERGPPGDMGKVGSPGKKGQKGATGPVGFDGPKGLIGQKGNIGIVGGPGPMGPIGNQGITGPRGQKGERGDDGPRGVPGPRGRLGPRGEDGPLGPPGDPGIPGNKGLPGDTGPMGDKGAIGDTGDQGLTGDIGVPGQSGPQGEIGLKGMKGEIGMRGGRGDPGDPGIKGVPGLVGSKGKQGHPGRAGDRGQPGEQGNQGPPGLLGEPGIIGSPGQQGRRGPPGPQGLSGSKGEPGDAGTQGPPGAEGKNGDNGPAGEKGERGDRGVIGIQGPPGPIGIPGPRGSSGKLGPQGPIGDIGNPGTIGFPGNQGPPGRQGIKGPPGTDGPPGKEGMPGEEGPPGKDGEPGSSGEIGKSGIRGQPGEVGPPGVTGLVGPPGLRGEPGRMGKDGPPGPQGKLGEAGFRGRQGDSGDKGPKGPQGPLGPVGDAGEPGDPGVSGNSGLIGPPGDAGPAGNDGPKGSQGPAGPTGNVGPKGERGPKGVIGPEGIPGPAGPIGMPGPQGENGQKGPQGSEGPRGPPGKPGEISTEYQSIFKRPRTTEDDESINLQNDDLFQNDQPKTEKISSIDPNDEDEDIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIYVHCNFDRLETCIEPEVVNYKKTSYTKTISSWFSVLASLNKQISYKIPKEQLVFLQLSSESSSQTLTLSCDQIALVSDDSITQDIRYNNSVQLFGDDNQILTVNNEDDLFQYKVVEDTCKDKSNNGRAVIKVELDRPRRLPIRDLNFKSIENSRPAMIGIEIGPVCFSGLSEESKSQVKVQRQKREAPSDLSLKSLFSVLSQW 1531          

HSP 2 Score: 375.17 bits (962), Expect = 2.047e-105
Identity = 278/279 (99.64%), Postives = 279/279 (100.00%), Query Frame = -3
Query: 3877 MISNSFNRRGFIISITVLAIAITSIDAQGCITSEGDKVEPNQEVKLRNRPCMTCKCDPNTLQISCMLDGCPPKSCGEDEVQLTEPGSCCPTCIKKQRKLRDYPAAVXXXXXXXXXXXXXXXEAPKIIAPQNVRSSKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPQDVKKIAARSRSVKGPGGRSVSTYQEVQLTMGRSGEPGQPGLTGQIGIKGPVGSVGAPGNQXXXXXXXXXXXXGILGEXXXXXXXXXXGFKGALGRQGPLGPDGE 4713
            MISNSFNRRGFIISIT+LAIAITSIDAQGCITSEGDKVEPNQEVKLRNRPCMTCKCDPNTLQISCMLDGCPPKSCGEDEVQLTEPGSCCPTCIKKQRKLRDYPAAVTREYTKEMTTVTTTTEAPKIIAPQNVRSSKKGLPGPPGPPGPPGPPGDPGIDGLNGDPGDPGRPGKPPQDVKKIAARSRSVKGPGGRSVSTYQEVQLTMGRSGEPGQPGLTGQIGIKGPVGSVGAPGNQGPPGLPGSRGPPGILGEDGRPGPPGPDGFKGALGRQGPLGPDGE
Sbjct:    1 MISNSFNRRGFIISITILAIAITSIDAQGCITSEGDKVEPNQEVKLRNRPCMTCKCDPNTLQISCMLDGCPPKSCGEDEVQLTEPGSCCPTCIKKQRKLRDYPAAVTREYTKEMTTVTTTTEAPKIIAPQNVRSSKKGLPGPPGPPGPPGPPGDPGIDGLNGDPGDPGRPGKPPQDVKKIAARSRSVKGPGGRSVSTYQEVQLTMGRSGEPGQPGLTGQIGIKGPVGSVGAPGNQGPPGLPGSRGPPGILGEDGRPGPPGPDGFKGALGRQGPLGPDGE 279          

HSP 3 Score: 135.191 bits (339), Expect = 5.220e-31
Identity = 123/381 (32.28%), Postives = 174/381 (45.67%), Query Frame = 1
Query: 8191 AGRPGSPGKPGTIGHPGWMGTVGNPGARGKSXXXXXXXXXXXXXXXXXXXXXXXQGSVGPTGTKGFPGENGSPGPVGMPGRDGP--AXXXXXXXXXXXXXXXXXXAVFFPVRTVRRD----LLNDDAL------------------------AVKYLGS--DVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASDVTEYRSWFGEITGTFK-FDYQIEASQLMFLKLFSTNARQRITINCSRLSVVGNS--------EHPVILYSDHDEEVLRNG--DLFKYSVIRDGCK---NSAEIIDSTELEMDTEAIRLPIRDIALNTGSSKEQQQFGLDIGQVCFS 9195
             G  G PG PG  G+ G +G  G+ G  G  G +G  G  GP GN GP GE G +G +GP G  G  G  G PGP G  G+ GP  +  P               ++F   RT   D    L NDD                          A+  L S  D + KP G+K  PAR+C  +     N  +G +YIDPNGG   DA  V C   R E+CIE +  +YK   +  +      SWF  +    K   Y+I   QL+FL+L S ++ Q +T++C ++++V +          + V L+ D ++ +  N   DLF+Y V+ D CK   N+   +   EL+      RLPIRD+   +  +      G++IG VCFS
Sbjct: 1123 VGDAGEPGDPGVSGNSGLIGPPGDAGPAGNDGPKGSQGPAGPTGNVGPKGERGPKGVIGPEGIPGPAGPIGMPGPQGENGQKGPQGSEGPRGPPGKPGEISTEYQSIFKRPRTTEDDESINLQNDDLFQNDQPKTEKISSIDPNDEDEDIFEALLRLSSIVDNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIYVHCNFDRLETCIEPEVVNYKKTSYTKT----ISSWFSVLASLNKQISYKIPKEQLVFLQLSSESSSQTLTLSCDQIALVSDDSITQDIRYNNSVQLFGDDNQILTVNNEDDLFQYKVVEDTCKDKSNNGRAVIKVELDRPR---RLPIRDLNFKSIENSRPAMIGIEIGPVCFS 1496          

HSP 4 Score: 125.561 bits (314), Expect = 4.943e-28
Identity = 204/506 (40.32%), Postives = 252/506 (49.80%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGK---------DGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTI---------------GIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGK---PGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGI---PGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMG 7068
            TG+ GI GP G  G PG +GP G+ G +G  G +G+         DG  G  G  GP GP G PG +G +G+PG  G  G  G++G+SG     G  G  G PG  G  G  G +G  G  G  GSIG+ G PG+DG  G P   GDPG  G+ GP G +G                            +G KG++GP+GP G PG +GN       G +G PGA G  G  GS GP+G  G KG  G I               G+ G PGT G +G  G  G+ G  G PG  G  G  G  G  G  G+ G  G  G+PG +      G +G  G  G SG  G PG  GPPG +GLQG  GPPG  G +G  G  GP+G +GN G +GP GK    G AGD G+ GP G  G  G++G  G  GP+G  G  G+RG  GAPG    PG+ G  G+    G +GN G  G+ G  G +G  G  G  GSIG +G +GS GPMG
Sbjct:  217 TGQIGIKGPVGSVGAPGNQGPPGLPGSRGPPGILGEDGRPGPPGPDGFKGALGRQGPLGPDGEPGYKGPIGAPGIPGKPGDIGLKGVSGN---PGPKGPIGKPGAKGPIGLRGLRGESGPRGPPGSIGKTGIPGNDGNGGTP---GDPGPQGLPGPQGFQGI---------------------------VGPKGNVGPLGPKGEPGFQGN------RGGRGSPGATGASGKRGSIGPQGENGFKGEPGNIGPPGRPGQGGMRGPPGVEGEPGTNGPNGPEGDTGLQGSQGMPGLEGAKGKRGERGSIGMPGELGKRGVRGSPGID------GSIGYAGGRGLSGMRGAPGPEGPPGPAGLQGDSGPPGAIGNKGSQGDFGPAGVRGNPGPRGPRGKRGQEGPAGDQGSKGPNGAIGNPGNMGPVGLVGPMGPQGPQGLRGPTGAPGKTGEPGQIGPRGQRGDRGPRGNPGSPGAPGIPGQKGQRGQPGKRGSIGPEGRVGSEGPMG 677          

HSP 5 Score: 102.449 bits (254), Expect = 5.736e-21
Identity = 173/460 (37.61%), Postives = 211/460 (45.87%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMG---------KDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVK---GDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARG------------PQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAK 6948
             G+ G  G TG  GVPG  GP G  G KG +G +G           GI G  G +G +G  G PGR G  G PG  GN G PG+ G                                   GI GS GQ G  G  G +G  G  G+PG AG  GP G +   GD G  G  G  G RG  G +G  G IG  G +G  G +GP G  G  GNPG IG  G+QG PG +G             +G+ G  GP G+ G  GS G IG +G+ G PG+ G  G  G+ G  G  G PG +                        GK+  PGPQG LGE G  G+ GD G  G        G QGP+GP G++G+ G P      G  GN G  GP G  G AG++G  G QGP G  G++G  GE+GP G +G  GI G  G  G+PG  GENG+    G++
Sbjct:  820 IGDTGDQGLTGDIGVPGQSGPQGEIGLKGMKGEIGMRGGRGDPGDPGIKGVPGLVGSKGKQGHPGRAGDRGQPGEQGNQGPPGLLGEP---------------------------------GIIGSPGQQGRRGPPGPQGLSGSKGEPGDAGTQGPPGAEGKNGDNGPAGEKGERGDRGVIGIQGPPGPIGIPGPRGSSGKLGPQGPIGDIGNPGTIGFPGNQGPPGRQGIKGPPGTDGPPGKEGMPGEEGPPGKDGEPGSSGEIGKSGIRGQPGEVGPPGVTGLVGPPGLRGEPGRM------------------------GKDGPPGPQGKLGEAGFRGRQGDSGDKGP------KGPQGPLGPVGDAGEPGDP------GVSGNSGLIGPPGDAGPAGNDGPKGSQGPAGPTGNVGPKGERGPKGVIGPEGIPGPAGPIGMPGPQGENGQKGPQGSE 1210          

HSP 6 Score: 96.6709 bits (239), Expect = 2.976e-19
Identity = 204/568 (35.92%), Postives = 249/568 (43.84%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGS---------------------NGPSGTKGNKGSKGPYGKPGIAG---------------------DNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGE---------------NGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPG 7176
            GEPG NGP GP G  G++G  G+ G +G +G+ G+ G +G  G LG         +RG  GSPG  G+ G+ G +G+SG  G  G  G  GP GL G  GP G  G++G  G  G  G  G PG  G RG  G+ G  G  G  GP+G  G+PG                         +G  G +GPMGP G  GLRG     G+ G  G PG  GP+G  G  GPRG  GS G+ G  G  G  G PGK G  G  G  G  GP G  G  G  G PG  G                         +G++GP G+ G  G  G VG PG+ G +G  GP G  G +GL G                       GP G KG +G  GP G PG  G                     + G  G  GP G+ G +G+TG+QG  G++G  G  G  G  G+ G  GE                G   + G+KG  G  G +G RG  G  G QGPPG +G  G IGS G  GR             GPPGP+G  G KG PG+ GT G
Sbjct:  446 GEPGTNGPNGPEGDTGLQGSQGMPGLEGAKGKRGERGSIGMPGELG---------KRGVRGSPGIDGSIGYAGGRGLSGMRGAPGPEGPPGPAGLQGDSGPPGAIGNKGSQGDFGPAGVRGNPGPRGPRGKRGQEGPAGDQGSKGPNGAIGNPGN------------------------MGPVGLVGPMGPQGPQGLRG---PTGAPGKTGEPGQIGPRGQRGDRGPRGNPGSPGAPGIPGQKGQRGQPGKRGSIGPEGRVGSEGPMGSQGKEGDPGPPGPSGD------------------------IGQKGPIGERGPPGDMGKVGSPGKKGQKGATGPVGFDGPKGLIGQKGNIGIVGGPGPMGPIGNQGITGPRGQKGERGDDGPRGVPGPRGRLGPRGEDGPLGPPGDPGIPGNKGLPGDTGPMGDKGAIGDTGDQGLTGDIGVPGQSGPQGEIGLKGMKGEIGMRGGRGDPGDPGIKGVPGLVGSKGKQGHPGRAGDRGQPGEQGNQGPPGLLGEPGIIGSPGQQGR------------RGPPGPQGLSGSKGEPGDAGTQG 941          

HSP 7 Score: 96.6709 bits (239), Expect = 3.130e-19
Identity = 203/540 (37.59%), Postives = 248/540 (45.93%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGK---AGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLG---------------------NTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGP 7188
             G PG  GP G  G  G +GP G++G  G  G+ G+ G +GPRG  G +GP G PG  G  G PG  G  G PG +G  G    +G  G +GP G  G  G  G  G  G +G KG IG+ G PG  GK G+PG+ G  G     G DGP G+ G  G  G  G  G  GP G +G  G  G+ G +GD GP G  G  G  G  G  G LG  G PG  G +G+ G  GP G  G+ G  G  G+ G  G PG+ G  G++G+ G  G  G  G  G  G PG  G  G  G  G  G PG+    G  G  G +GPPG                 G  G IG PG  G+RG PG  G SG+KG  G  G  G PG  G NG +GP G +GE GD G                       G QGP+G++GN G  G  G  G PG+ G  G    DG  G             +GM G +GPPG     G+ GS+G +G+                   G +G  G  G PG  G++GP
Sbjct:  586 IGNPGNMGPVGLVGPMGPQGPQGLRGPTGAPGKTGEPGQIGPRGQRGDRGPRGNPGSPGAPGIPGQKGQRGQPGKRGSIG---PEGRVGSEGPMGSQGKEGDPGPPGPSGDIGQKGPIGERGPPGDMGKVGSPGKKGQKGATGPVGFDGPKGLIGQKGNIGIVGGPGPMGPIGNQGITGPRGQKGERGDDGPRGVPGPRGRLGPRGEDGPLGPPGDPGIPGNKGLPGDTGPMGDKGAIGDTGDQGLTGDIGVPGQSGPQGEIGLKGMKGEIGMRGGRGDPGDPGIKGVPGLVGSKGKQGHPGRAGDRGQPGEQGNQGPPG---------------LLGEPGIIGSPGQQGRRGPPGPQGLSGSKGEPGDAGTQGPPGAEGKNGDNGPAGEKGERGDRGVIGIQGPPGPIGIPGPRGSSGKLGPQGPIGDIGNPGTIGFPGNQGPPGRQGIKGPPGTDGPPGK------------EGMPGEEGPPGK---DGEPGSSGEIGK------------------SGIRGQPGEVGPPGVTGLVGP 1074          

HSP 8 Score: 95.9005 bits (237), Expect = 4.310e-19
Identity = 200/518 (38.61%), Postives = 243/518 (46.91%), Query Frame = 1
Query: 5653 GINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGP------------------QGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQ------------RGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGE---------NGDLGNTGEQGPVGEVGNA------GIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGR 7071
            G  GP G  G PG  G +G  G KGQ+G  G  G  GP+G +G                   QG TG  G++G  G  GP G  G  G  G  G              G  G  G  G  G++G  G  G +G  G  G  G +G  G+ G PG++G  G  G+KG  G+ G  G  G  G  G +G  G++G  G +G  G  G  G PG +GN G  G LG  G  G+ G QG  G PGP+G +GSKG  G  G  G PG  GK+G  G  G  G+ G  G  G  GP G  G PG  G  G  G  G  G    PG  G  G +GPPG+ G  G PG  GPPG+ G+ G  GPPG  G+            RG PG  GP G  G  G  G  G+PG  G +G  GPQG  GE         +GD G  G QGP+G VG+A      G+ G +G  G PG  G  G D   G++G  GP G+ G +G +G  G+ GP G  G  G IG  GP G 
Sbjct:  695 GQKGPIGERGPPGDMGKVGSPGKKGQKGATGPVGFDGPKGLIGQKGNIGIVGGPGPMGPIGNQGITGPRGQKGERGDDGPRGVPGPRGRLGPRGE------------DGPLGPPGDPGIPGNKGLPGDTGPMGDKGAIGDTGDQGLTGDIGVPGQSGPQGEIGLKGMKGEIGMRGGRGDPGDPGIKGVPGLVGSKGKQGHPGRAGDRGQPGEQGNQGPPGLLGEPGIIGSPGQQGRRGPPGPQGLSGSKGEPGDAGTQGPPGAEGKNGDNGPAGEKGERGDRGVIGIQGPPGPIGIPGPRGSSGKLGPQGPIGDIGNPGTIGFPGNQGPPGRQGIKGPPGTDGPPGKEGMPGEEGPPGKDGEPGSSGEIGKSGIRGQPGEVGPPGVTGLVGPPGLRGEPGRMGKDGPPGPQGKLGEAGFRGRQGDSGDKGPKGPQGPLGPVGDAGEPGDPGVSGNSGLIGPPGDAGPAGNDGPKGSQGPAGPTGNVGPKGERGPKGVIGPEGIPGPAGPIGMPGPQGE 1200          

HSP 9 Score: 94.3597 bits (233), Expect = 1.449e-18
Identity = 184/526 (34.98%), Postives = 223/526 (42.40%), Query Frame = 1
Query: 5653 GINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKD------------------GILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGP------------------------RGRTGSKGSQGTIGIAGVPGT---PGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAG------DNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGL---KGDIGSTGPMG 7068
            GI GP G  G  G  GP GV G +G+ G  G+D                  G  GP G+ G  G TG  G  G +G PG  G  G  G++G+ G  G +G  G  G PG+            +G  G+ GS G+ G+PG  G RG PGE G+       GP G+ G+PG                         +GS G  G  GP G  GL G+ G  G  G+QG PGA G  G  G  G                         RG +G  G QG IG  G PGT   PG  G  G+ GI G  G  G PG                                  +G  GE GPPGK G+ G  G +G  G  G  G +GPPG +G  G PG  G  G  G  G  GP GK G AG      D+G  GP+GP+G  G +G+ GE G  G  GN+G+ G  G  G  G DG  G     G  GN+GP G  G +G  G  GI GP G IG+   +G+ G  GP G
Sbjct:  758 GITGPRGQKGERGDDGPRGVPGPRGRLGPRGEDGPLGPPGDPGIPGNKGLPGDTGPMGDKGAIGDTGDQGLTGDIGVPGQSGPQGEIGLKGMKGEIGMRGGRGDPGDPGI------------KGVPGLVGSKGKQGHPGRAGDRGQPGEQGN------QGPPGLLGEPGI------------------------IGSPGQQGRRGPPGPQGLSGSKGEPGDAGTQGPPGAEGKNGDNGPAGEKGERGDRGVIGIQGPPGPIGIPGPRGSSGKLGPQGPIGDIGNPGTIGFPGNQGPPGRQGIKGPPGTDGPPGK---------------------------------EGMPGEEGPPGKDGEPGSSGEIGKSGIRGQPGEVGPPGVTGLVGPPGLRGEPGRMGKDGPPGPQGKLGEAGFRGRQGDSGDKGPKGPQGPLGPVGDAGEPGDPGVSGNSGLIGPPGDAGPAGNDGPKGSQGPAGPTGNVGPKGERGPKGVIGPEGIPGPAGPIGMPGPQGENGQKGPQG 1208          

HSP 10 Score: 92.8189 bits (229), Expect = 3.719e-18
Identity = 220/624 (35.26%), Postives = 266/624 (42.63%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKG---DKGQRGRMGKDGILGP------RGNLGPQGP------TGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGP---SGVKGDPGKTXXXXXXXXXXXXX---XXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPG------------------------------------PRGRTGSKGSQGTIGIAGVPGTPG---------KDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNI------------------------GPIGSSGRRGPQGMTGIQGPPGSIGLKGDI------------------GSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            GEPG  GP G  G+PG  G +G+KG   + G +G +GK G  GP      RG  GP+GP      TG PG  G  G+PG  G  G PG QG  G                          G +G +G  G  G+ G+ G+ G RG+PG  G  GK G  GP   +G KG+PG  G PGR G+ G RG     G  G  G  G +GD G  G  G PGL G  G  G  GS G PG  G +G+ GSPG                                    P G  G+KGSQG  G AGV G PG         ++G AG  G  G NG  G PG +GP+GL G  G  G  G  G  G PGK  +PG  GP G+RG                      +GP G PG+ G  G+PG  G  G  G +GS GP G+ G  G  G+ G +G  G  G  G+ G++GP+GE G  G  G  G+PG  G+ G  G    DG KG I                        GP G  G RG  G  G+ GP G +G +G+                   G TGPMG  G                 G  GD+GL G+ G PG  GPQ
Sbjct:  278 GEPGYKGPIGAPGIPGKPGDIGLKGVSGNPGPKGPIGKPGAKGPIGLRGLRGESGPRGPPGSIGKTGIPGNDGNGGTPGDPGPQGLPGPQGFQG------------------------IVGPKGNVGPLGPKGEPGFQGNRGGRGSPGATGASGKRGSIGPQGENGFKGEPGNIGPPGRPGQGGMRGPPGVEGEPGTNGPNGPEGDTGLQGSQGMPGLEGAKGKRGERGSIGMPGELGKRGVRGSPGIDGSIGYAGGRGLSGMRGAPGPEGPPGPAGLQGDSGPPGAIGNKGSQGDFGPAGVRGNPGPRGPRGKRGQEGPAGDQGSKGPNGAIGNPGNMGPVGLVGPMGPQGPQGLRGPTGAPGKTGEPGQIGPRGQRGD---------------------RGPRGNPGSPGAPGIPGQKGQRGQPGKRGSIGPEGRVGSEGPMGSQGKEGDPGPPGPSGDIGQKGPIGERGPPGDMGKVGSPGKKGQKGATGPVGFDGPKGLIGQKGNIGIVGGPGPMGPIGNQGITGPRGQKGERGDDGPRGVPGPRGRLGPRGEDGPLGPPGDPGIPGNKGLPGDTGPMGDKGAI---------------GDTGDQGLTGDIGVPGQSGPQ 841          

HSP 11 Score: 82.0333 bits (201), Expect = 8.361e-15
Identity = 179/526 (34.03%), Postives = 223/526 (42.40%), Query Frame = 1
Query: 5704 LGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGP---VGEVGNAGIRGVNGA---------------------PGIPGKDGENGKDAVDGAKGNIGPIGSSGRRG---PQGMTGIQGPPGSIGLKGD---IGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            +G  G+ GQ G  G+ GI GP G++G  G  G PG  G+ G PG +G  G                             GP G  G +G LG +G +G DG PG  G  GAPG  G PG  G+ G SG  G  G  G PG  G                +G +G  G  GP G PG  G  G+ G+ G+ G PG  GPQG+ G  G +G  G KG+ G +G  G PG  G  G  G  G  G +                                 GK    GPQG  G +G PG  G  G PG  G           GPPG  G+   PG+NGP+G +G+ G +G  G PG+ G  G  G +G  G  G+LG  G +G     G +G AG RG++G                      PG  G  G  G     G +GN GP G  G+RG   P G  G +GP G+IG  G+   +G  GPMG               P GP+G +G  G PG  G PG IGP+
Sbjct:  205 MGRSGEPGQPGLTGQIGIKGPVGSVGAPGNQGPPGLPGSRGPPGILGEDGR---------------------------PGPPGPDGFKGALGRQGPLGPDGEPGYKGPIGAPGIPGKPGDIGLKGVSGNPGPKGPIGKPGAKGP---------------IGLRGLRGESGPRGPPGSIGKTGIPGNDGNGGTPGDPGPQGLPGPQGFQGIVGPKGNVGPLGPKGEPGFQGNRGGRGSPGATGAS---------------------------------GKRGSIGPQGENGFKGEPGNIGPPGRPGQGGMR---------GPPGVEGE---PGTNGPNGPEGDTGLQGSQGMPGLEGAKGKRGERGSIGMPGELGKRGVRGSPGIDGSIGYAGGRGLSGMRGAPGPEGPPGPAGLQGDSGPPGAIGNKGSQGDFGPAGVRGNPGPRGPRGKRGQEGPAGDQGSKGPNGAIGNPGNMGPVGLVGPMG---------------PQGPQGLRGPTGAPGKTGEPGQIGPR 628          

HSP 12 Score: 74.3294 bits (181), Expect = 1.855e-12
Identity = 186/494 (37.65%), Postives = 224/494 (45.34%), Query Frame = 1
Query: 5794 TGAPGRRGTVGSPGPVGNAGHP--GVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGP------RGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQ------------GPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRR---------GPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGP 7188
             G PG  G  G PG  G  G P   V+ I+ R  +   PG +       ++   G  G  G  G+ G IG  G  GS    GAPG  G PG  G  GP G+ G+       GR G  GP G +G  G  G LG  G+ G  GP G+PG+ G PG IG  G  G PG +GP G  G+ GP      RG +G +G  G+IG  G+PG  G  G  G                                        PG    PGPQ            GPLG +G PG  G+ G  G+ G  G SG +G IGP G +G +G PG+ GP G  G  G +GP   PG+ G+ G +GP GP G+ G  G+ G  G  G  G  G RG  G PG  GK G  G   +DG+ G  G  G SG R         GP G+ G  GPPG+IG KG  G  GP G  G PG  G  G  G  GP G +G KG  G  G PG +GP
Sbjct:  152 PGDPGIDGLNGDPGDPGRPGKPPQDVKKIAARSRSVKGPGGRSVSTYQEVQLTMGRSGEPGQPGLTGQIGIKGPVGS---VGAPGNQGPPGLPGSRGPPGILGE------DGRPGPPGPDGFKGALGRQGPLGPDGEPGYKGPIGAPGIPGKPGDIGLKGVSGNPGPKGPIGKPGAKGPIGLRGLRGESGPRGPPGSIGKTGIPGNDGNGGTPGD---------------------------------------PGPQGLPGPQGFQGIVGPKGNVGPLGPKGEPGFQGNRGGRGSPGATGASGKRGSIGPQGENGFKGEPGNIGPPGRPGQGGMRGP---PGVEGEPGTNGPNGPEGDTGLQGSQGMPGLEGAKGKRGERGSIGMPGELGKRGVRGSPGIDGSIGYAGGRGLSGMRGAPGPEGPPGPAGLQGDSGPPGAIGNKGSQGDFGPAGVRGNPGPRGPRGKRGQEGPAGDQGSKGPNGAIGNPGNMGP 594          
BLAST of Collagen alpha-1(XXVII) chain B vs. Planmine SMEST
Match: SMESG000024244.1 (SMESG000024244.1)

HSP 1 Score: 248.44 bits (633), Expect = 7.010e-66
Identity = 153/338 (45.27%), Postives = 211/338 (62.43%), Query Frame = 1
Query: 8194 GRPGSPGKPGTIG---HPGWMGTVGNPGARGKSXXXXXXXXXXXXXXXXXXXXXXXQGSVGPTGTKGFPGENGSPGPVGMPGRDGPAXXXXXXXXXXXXXXXXXXAVFFPV-RTVRRDLLNDDALAVKYLGSDVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASDVTEYRSWFGEITGTFKFDYQIEASQLMFLKLFSTNARQRITINCSRLSVVGNSEHPVILYSDHDEEVLRNGDLFKYSVIRDGCKNSAEIIDSTELEMDTEAIRLPIRDIALNTGSSKEQQQFGLDIGQVCFS 9195
            G+PG  GK G +G   HPGWMG  G  G  G  G RG PGD G  G  G PG+ G QG  GP G  G  GE G  GP+G+ GRDGP+G  G +GN GPPGPPGPPA+  P+     R + +DDA A   LGSD +  PLGTKD+PAR+C  L   + +L+DG Y+IDPNGGK +DAF V C+ +  E+CI  K  S+    +  + + +Y S+ GE++G  +FDY I+ +QLMFLK+ ST A Q I I C+ ++VV  +E+P I+++D++ E+ ++     Y VI+D C+N +     T L +  ++ RLPIRD+ L  GS  +  +F L + +VCFS
Sbjct:  983 GKPGKDGKTGPVGEPGHPGWMGPQGLLGPPGPQGDRGKPGDPGSPGIEGSPGDVGDQGVPGPKGPTGPNGEMGLMGPMGVTGRDGPSGPHGLMGNAGPPGPPGPPAMMLPIIYDPNRPMYSDDANAANILGSDTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKVNDAFEVFCKMETGETCISPKQSSFSKISYSENPINKYISY-GELSGIQRFDYVIDNTQLMFLKMVSTRANQEIKIACNNMAVVEKTEYPAIIFTDNNRELTKDDHHLSYKVIKDECQNMSSEEAETVLLVSGDSKRLPIRDLTL--GSDSDISEFRLKLSKVCFS 1317          

HSP 2 Score: 133.65 bits (335), Expect = 1.294e-30
Identity = 263/528 (49.81%), Postives = 307/528 (58.14%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGN------------AGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGP 7188
            TG+PG+ G  GP G+ G KGP G +G KG  G  G  G  GP G LG  GP G PG RG +GS GP+G+             G PG  GI+G              G+PG+ GP G KG +G  G KG  G DG PG DGK G+ G+ G PG+ G +G  G KG  G TG  G  G  G  G  G  G+IG  G KGD GP G +G  G+ G+ G  GSLG  G PG RG  G +G+PG RG  G+KGSQG  G  G+ G+PG DG+ G  GI G NG PG  GP G  GL G PGKDG  GP G  G PG N  PGPQG +G RG  GK G +GVPG VG PG  G QG  G PG  G+ GL G+ G  G+ G  G+ G  G PG+ GD+G  GP G RG  G  G  GE+G  G  GN G RGV G PG PGKDG NGK   DG  G+ G IG +G+ GP G +G  GP G +GLKGDIG TGP+G +GV GI G PG+ GPPGP+G+KG  GL G  G  G  GP
Sbjct:  135 TGKPGLMGSQGPQGMNGPKGPNGEQGPKGDAGPPGGKGPKGPIGELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITG------------VSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNGRSGIIGSVGPPGSLGPIGNPGNRGDPGRIGTPGTRGIPGTKGSQGPNGPPGINGSPGADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPVGLSGQPGANKPPGPQGKMGPRGLTGKPGSNGVPGPVGQPGPPGSQGSSGSPGLIGENGLLGNIGKPGSNGAPGAIGSAGAPGVPGDDGPPGPAGLRGPIGKKGKVGERGGPGGQGNQGARGVRGKPGPPGKDGVNGKPGKDGKPGDPGVIGITGKSGPPGPSGKPGPAGLMGLKGDIGPTGPLGPLGVTGISGLPGMNGPPGPQGYKGTMGLSGKTGKVGSPGP 650          

HSP 3 Score: 106.686 bits (265), Expect = 2.261e-22
Identity = 181/512 (35.35%), Postives = 213/512 (41.60%), Query Frame = 1
Query: 5677 TGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQ---GPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPM---------------------GPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVP------GTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPG------------IAGDNGASGPQGPRGENG---------DLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTG 7059
             G+ G+KG +G  G  G  G  G  G+ G  G  GPQ   G  G  G+ G VGSPGP GN G PG  G +G                      +    S GG G KG  G+DG  G  G  G+PGE G PG  G  G SG  G PG  G  G  G+ G  G  G  G  G  GS G +GP                      GP G  GL GN G  G  G+ G  G  G QG+   PG  GR G +G QG +G+ G+P      GTPG+DG+ G  G+                                     G   QPGP+GP G  G  G                 GL G IG P   GQ+G PG+ GP G  GN+G  GP G  G            + G +G SG  G RGE+G           G  G +GPVG  G  G+ G  G  G PGK G+ GK   DG  G +G  G  G  GPQG+ G  GP G  G  GD GS G
Sbjct:  594 AGLMGLKGDIGPTGPLGPLGVTGISGLPGMNGPPGPQGYKGTMGLSGKTGKVGSPGPPGNRGKPGSSGSTGN--------------------VQIAGRSSGGSGTKGKPGEDGDAGKPGSPGSPGEIGPPGDIGPTGQSGALGKPGPKGPVGFPGKDGRDGRLGLDGSQGPAGSSGKVGPQGAKGKVGPQGPPGGPGSTGMSGPQGDDGLDGNVGPEGKPGNPGLDGFPGNQGV---PGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMR------------------------------------GDTGQPGPRGPAGPEGSTG---------------APGLMGDIGKP---GQKGKPGNTGPKGLTGNQGITGPMGNTGKPGAAGKTGGKGLPGPDGPSGSVGRRGESGVPGKSGGFGSKGKKGAEGPVGPAGKEGLPGKVGPLGKPGKPGKEGKPGKDGKTGPVGEPGHPGWMGPQGLLGPPGPQGDRGKPGDPGSPG 1028          

HSP 4 Score: 104.76 bits (260), Expect = 9.250e-22
Identity = 54/190 (28.42%), Postives = 100/190 (52.63%), Query Frame = -3
Query:  358 DEDEDIFEALLRLSSIV--DNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCIEPEVVNYKKTSYTKTISSWFSVLASLN--KQISYKIPKEQLVFXXXXXXXXXXXXXXSCDQIALVSDDSITQDIRYNNSVQLFGDDNQILTVNNEDDLFQYKVVEDTCKDKSN 915
            D +  ++      ++I+  D +  P G+K  PARSC  ++    +  +G ++IDPNGG   DA  V C  +  ETCI P+  ++ K SY++   + +     L+  ++  Y I   QL+FL++ S  ++Q + ++C+ +A+V         +      +F D+N+ LT   +D    YKV++D C++ S+
Sbjct: 1096 DPNRPMYSDDANAANILGSDTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKVNDAFEVFCKMETGETCISPKQSSFSKISYSENPINKYISYGELSGIQRFDYVIDNTQLMFLKMVSTRANQEIKIACNNMAVVE--------KTEYPAIIFTDNNRELT--KDDHHLSYKVIKDECQNMSS 1275          

HSP 5 Score: 103.219 bits (256), Expect = 2.440e-21
Identity = 176/470 (37.45%), Postives = 205/470 (43.62%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGV---QGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEH------------GDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTG 7005
             G  G+ GP GP G PG KGP G+ G +G+ G+ GK G +GP   +GPQGP G  GR G  G+ GP G  G PG+   QG  G  G +G  G QGP G  G  G +G KG  G LG  G IG  G  G  G +G  G H            G PG  GI G SG+ G  G T                        G+KGD G  G  G  G+ G PG+ G  GS G PGA G  G  G PG +G  G  G QG IG AG  G PG DG  G  G+ G +                                 G     G  G +G  GPPG                    GPIG PGN G  G  G+ G  G  G KGS+GP G PGI G  GA G  G  G +G  G  G +GP         RG  G  G+PGKDG  G   + G  G   P G  G+ GP+G+TG
Sbjct:   69 AGPAGLQGPDGPEGRPGPKGPNGLTGPQGKPGKDGKPGPIGP---VGPQGPNGRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQGPKGDAGPPGGKGPKGPIGELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPT------------------------GTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDS---------------------------------GPQGLNGRSGIIGSVGPPGS------------------LGPIGNPGNRGDPGRIGTPGTRGIPGTKGSQGPNGPPGINGSPGADGRDGLPGIDGANGKPGSRGP---------RGSQGLAGLPGKDGVVGPVGLSGQPGANKPPGPQGKMGPRGLTG 451          

HSP 6 Score: 95.5153 bits (236), Expect = 5.432e-19
Identity = 197/584 (33.73%), Postives = 248/584 (42.47%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPG------------------------------------RRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGY---------PGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGP---------SGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAG-------VPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQ---RGLPGSNGPSGTKGNKGSKGPYGK---PGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
             G+PG  GP G  G+ G+ G  GV G  G  G+ G +   GP+G +GP+G TG PG                                    + G+ G+PG +G+AG PGV G  G                             G  G++G IG+ G           G+ G RG  G+ G PGK G++G  G  G PG  G  G +G+ GP GP G  G  G +G KGDIGP GP         SG PG+ G PG  G  G+ G  G  G  G  G PG RG+ GS GS G + IAG         G PG+DG AG+                                       PG    PG  GP G+ GP G+SG  G         + G +GP+G PG  G+    GL GS GP+G+ G  G +G  GK    G  G  G++G  GP+G++G  GN G +G  G  G  G  G  G PG+ G+DGE G       +G +G  G  G  G  G  G  G PG  G++GD G  GP G           G  G  G  G  GD G PG  G PG  GP+
Sbjct:  399 NGKPGSRGPRGSQGLAGLPGKDGVVGPVGLSGQPGANKPPGPQGKMGPRGLTGKPGSNGVPGPVGQPGPPGSQGSSGSPGLIGENGLLGNIGKPGSNGAPGAIGSAGAPGVPGDDG---------------------------PPGPAGLRGPIGKKGKVGERGGPGGQGNQGARGVRGKPGPPGKDGVNGKPGKDGKPGDPGVIGITGKSGPPGPSGKPGPAGLMGLKGDIGPTGPLGPLGVTGISGLPGMNGPPGPQGYKGTMGLSGKTGKVGSPGPPGNRGKPGSSGSTGNVQIAGRSSGGSGTKGKPGEDGDAGK---------------------------------------PGSPGSPGEIGPPGDIGPTGQSGALG---------KPGPKGPVGFPGKDGRDGRLGLDGSQGPAGSSGKVGPQGAKGKVGPQGPPGGPGSTGMSGPQGDDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGD------QGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRG---------PAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPK 892          

HSP 7 Score: 91.6633 bits (226), Expect = 8.412e-18
Identity = 177/476 (37.18%), Postives = 209/476 (43.91%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGP------PGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPG---IAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGD 7044
            G+PG +G  G  G PG  G +G  GD G  G+ G  G  GP+G +G  G  G  GR G  GS GP G++G  G QG  G+ G QG PG  G  G+ G          QG  G+ G++G +G PG+ G  G PG  G PG +G DG    +GD GK                        LG  G  G  G +G+PG  G PGV G  G  G PG RGP G      P G TG+ G  G IG  G  G PG  G  G  G                    G  G  G  G  G  G  G    PGP GP G  G  G+SG  G  G  G  G+ G +GP+GP      PG  G  G PG  G  G  G  G  GP G+PG     G  G  GP GP+G+ G  G+                   G+PGI G  G+ G   V G KG  GP G  G  GP G+TG  GP G  GL G+
Sbjct:  680 GKPGEDGDAGKPGSPGSPGEIGPPGDIGPTGQSGALGKPGPKGPVGFPGKDGRDGRLGLDGSQGPAGSSGKVGPQGAKGKVGPQGPPGGPGSTGMSG---------PQGDDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDG---ERGDQGK------------------------LGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAG------PEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTG------------------NQGITGPMGNTGKPGAAGKTGGKGLPGPDGPSGSVGRRGESGVPGKSGGFGSKGKKGAEGPVGPAGKEGLPGKVGPLGKPGKPGKEGKPGKDGKTGPVGEPGHPGWMGPQGLLGPPGPQGDRGKPGDP------------------GSPGIEGSPGDVGDQGVPGPKGPTGPNGEMGLMGPMGVTGRDGPSGPHGLMGN 1077          

HSP 8 Score: 90.5077 bits (223), Expect = 1.922e-17
Identity = 229/574 (39.90%), Postives = 277/574 (48.26%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTG---APGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPG---VIGSLGSQGFPGARGPQGILGSPGPRGRTG------------------------------------------SKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQG---------PIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
             G PG +G TG +G+PG+ GP G KGD+G +G+ G +G+ G  G  G  G  G   APG  G+ G PG  G+ G  G QGI G  G  G PG+ G  G+ G++G  G +G  G  GI GS+G    PGS G  G PG  GDPG+ G  G  G+ G  G  G  G  G  G  G  G  G+ G  G+ G  G  GP GS GL G PG   V+G +G  G PGA  P G  G  GPRG TG                                          S G+ G IG AG PG PG DG  G  G+ G  G  G+ G  G  G  G+ G  G  G  G PG  G N +PG  G  G+ G  G +G  G PG  G PG +GL G         P+GP G +G  GLPG NGP G +G KG+ G  GK    G  G+ GP G RG+ G  G+TG     G        G +G  G PG+DG+ GK    G+ G IGP G  G  G  G  G  GP G +G  G  G  G +G  G  G  G  G VGP G +G  G +G PG PG+ G+ GPQ
Sbjct:  216 IGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNGRSGIIGSVGP---PGSLGPIGNPGNRGDPGRIGTPGTRGIPGTKGSQGPNGPPGINGSPGADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPVGLSGQPGANKPPGPQGKMGPRGLTGKPGSNGVPGPVGQPGPPGSQGSSGSPGLIGENGLLGNIGKPGSNGAPGAIGSAGAPGVPGDDGPPGPAGLRGPIGKKGKVGERGGPGGQGNQGARGVRGKPGPPGKDGVNGKPGKDGKPGDPGVIGITGKSGPPGPSGKPGPAGLMGLKGDIGPTGPLGPLGVTGISGLPGMNGPPGPQGYKGTMGLSGK---TGKVGSPGPPGNRGKPGSSGSTGNVQIAGRS-----SGGSGTKGKPGEDGDAGKPGSPGSPGEIGPPGDIGPTGQSGALGKPGPKGPVGFPGKDGRDGRLGLDGSQGPAGSSGKVGPQGAKGKVGPQGPPGGPGSTGMSGPQ 778          

HSP 9 Score: 77.0258 bits (188), Expect = 2.808e-13
Identity = 168/519 (32.37%), Postives = 208/519 (40.08%), Query Frame = 1
Query: 5686 PGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGP---TGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQ------------GFPGARGPQGILGSPG---PRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGI------RGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGI---QGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGN 7161
            P +KGP  + G++   G  G  G  GP G  GP+GP   TG  G+ G  G PGP+G  G  G  G  GR                                     G++G  G  G  G PG  G  G  G++GP G  G+ G  G+ G  G +GP+G              G++G  GP G PG+RG+ G  G +GS             GFPGA G  G+ G PG   P G  G +G QG  G  GV G PG DGK G VG                                           PG  G  G  G PG  G              G  GP G  GN+G  G PG +G  G +G KG  GP G  G +G  G+ GP G  G  G+ GN G+ G +G  G  GI      +G NG PGI G  G +G+D + G  G  G  GS G RG QG+ G+    G  G +GL G  G+  P G                  P+G  G +GL G 
Sbjct:   54 PSVKGPAPLTGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTGPQGKPGKDGKPGPIGPVGPQGPNGRMGRS------------------------------------GRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQGPKGDAGPPGGKGPKG------------PIGELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVG------------------------------------------DPGAPGEHGSNGIPGSKG------------SQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNGRSGIIGSVGPPGSLGPIGNPGNRGDPGRIGTPGTRGIPGTKGSQGPNGPPGINGSPGADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPVGLSGQPGANKPPG------------------PQGKMGPRGLTGK 452          

HSP 10 Score: 64.6994 bits (156), Expect = 1.390e-9
Identity = 105/266 (39.47%), Postives = 127/266 (47.74%), Query Frame = 1
Query: 5641 TGEPGINGPTGP---TGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGS---PGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVG 6420
            TG+PG  GP GP   TG PG+ G +G  G KG+ G  G  G+ G +G  GP G TG PG  G  G    PGP G +G  G +G SG             PG  G  G +G+KG++G +G  G  G  G  G  GK G PG+ G PGK G  GP G  G PG                         +G +G +GP GP G    RG PG  GS G +G PG  G QG+   PGP+G TG  G  G +G  GV G  G  G  G +G
Sbjct:  853 TGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPMGNTGKPGAAGKTGGKGLPGPDGPSGSVGRRGESG------------VPGKSGGFGSKGKKGAEGPVGPAGKEGLPGKVGPLGKPGKPGKEGKPGKDGKTGPVGEPGHPG------------------------WMGPQGLLGPPGPQGD---RGKPGDPGSPGIEGSPGDVGDQGV---PGPKGPTGPNGEMGLMGPMGVTGRDGPSGPHGLMG 1076          

HSP 11 Score: 62.003 bits (149), Expect = 8.214e-9
Identity = 94/255 (36.86%), Postives = 121/255 (47.45%), Query Frame = 1
Query: 6532 PGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSK---------------------GPYGKPGIAGDNGASGPQGPR---------------GENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGP 7188
            PGK+ +PGP GP+G +GP G+       G  G  G  G QGP G PG  G +G  G NGP G  G +G K                     GP G PGI GD G+ GP G                 G +G  G +G  G +G  G  G RG+ G  G  G DG  G   +DG  G++G  G+ G  G  G+ G +G  G  G +G IG+ G  GR G+ G+ G  G+ G  GP+G  G  G+ G+ G PG +GP
Sbjct:   99 PGKDGKPGPIGPVGPQGPNGRM------GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQGPKGDAGPPGGKGPKGPIGELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPG---IDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNGRSGIIGSVGPPGSLGP 344          

HSP 12 Score: 58.151 bits (139), Expect = 1.289e-7
Identity = 98/266 (36.84%), Postives = 122/266 (45.86%), Query Frame = 1
Query: 5641 TGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPT------GAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNP---GVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAG 6411
            +G  G  G  G  GVPG+ G  G+ G  G+ GR G  G+ G  G  GP+GP       GAPG  G +G PG  G  G+ G +G++G                                GI G +G  G PG+ GK G     G PG  G  G  G +G+ G  G  G  G +G +G  G  G  G+ G  G +GP+G  G PG  G P   G  G +G  G PG  GPQG+LG PGP+G  G  G  G+ GI G PG  G  G  G
Sbjct:  811 SGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQ------------------------------GITGPMGNTGKPGAAGKTGG---KGLPGPDGPSGSVGRRGESGVPGKSGGFGSKGKKGAEGPVGPAGKEGLPGKVGPLGKPGKPGKEGKPGKDGKTGPVGEPGHPGWMGPQGLLGPPGPQGDRGKPGDPGSPGIEGSPGDVGDQGVPG 1043          

HSP 13 Score: 58.151 bits (139), Expect = 1.551e-7
Identity = 81/183 (44.26%), Postives = 95/183 (51.91%), Query Frame = 1
Query: 6640 SGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGP 7188
            +GLQGP GP       G PG  GP+G  G +G  G  GKPG  G     GPQGP G  G  G  G  GP G  G  G+ G  G  G+ G  G NG+    G KG+ GP G  G +GP G  G  GP G  G++GD+GS GP+G  G  G PG  G +      GF G  G+ G  G PGVIGP
Sbjct:   72 AGLQGPDGP------EGRPGPKGPNGLTGPQGKPGKDGKPGPIG---PVGPQGPNGRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQ---GPKGDAGPPGGKGPKGPIGELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRI------GFPGADGITGVSGMPGVIGP 236          

HSP 14 Score: 54.299 bits (129), Expect = 1.587e-6
Identity = 96/249 (38.55%), Postives = 113/249 (45.38%), Query Frame = 1
Query: 6553 GPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLG---------------NTGEQGPVGEVGNAGIRGVNGAP------------------GIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGM---TGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGPQ 7191
            GP GP G  GP G +G  G  G  G  G+ G  GP+GP G +G+ G  G NG        G +GP GKPG+ G  G  G  GP+G NG+ G                 GE G  G +G  GIRG  G+                   G PG DG  G   V G  G IGP G+ G RG QG     G+ G PG  G  G +G  G  G  G  GIPG  G  G  GP+G  G+ G  G PG  G+IG Q
Sbjct:   76 GPDGPEGRPGPKGPNGLTGPQGKPGKDGKPGPIGPVGPQGPNGRMGRSGRNGAG------GPQGPTGKPGLMGSQGPQGMNGPKGPNGEQGPKGDAGPPGGKGPKGPIGELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITG---VSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQ 315          

HSP 15 Score: 19.631 bits (39), Expect = 1.587e-6
Identity = 12/24 (50.00%), Postives = 14/24 (58.33%), Query Frame = 1
Query: 7402 GERGPNGIDGSIGPPGRNGAPGAV 7473
            G RGP G  G  G PG++G  G V
Sbjct:  403 GSRGPRGSQGLAGLPGKDGVVGPV 426          

HSP 16 Score: 18.4754 bits (36), Expect = 1.587e-6
Identity = 13/43 (30.23%), Postives = 18/43 (41.86%), Query Frame = 2
Query: 7247 VGQVVSLGREANQAHQGSPAPVDRKGLLVLLVRWGNLGRQGRP 7375
            VG   SLG   N  ++G P  +   G   +    G+ G  G P
Sbjct:  336 VGPPGSLGPIGNPGNRGDPGRIGTPGTRGIPGTKGSQGPNGPP 378          

HSP 17 Score: 51.9878 bits (123), Expect = 9.758e-6
Identity = 79/178 (44.38%), Postives = 99/178 (55.62%), Query Frame = -3
Query: 3070 GSKGNVGPLGPKGEPGFQGNRGGRGSPGATGASGKRGSIGPQGENGFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDTGLQGSQGMPGLEGAKGKRGERGSIGMPGELGKRGVRGSPGIDGSIGYAGGRGLSGM---RXXXXXXXXXXXXGLQGDSGPPGAIGNKGSQG 3594
            G+ G  GP GP G PG  G  G  G  G+ G +G  G +GPQG  G  G  G  G PG  G  G +G  G++G  G  G  G  G  G  G+QG+PG+ G  G+RG++G +G+PG  G+ G+ G+PG DG  G AG RG +G    RG  GPEG  G  GL GD G PG  G  G+ G
Sbjct:  713 GALGKPGPKGPVGFPGKDGRDGRLGLDGSQGPAGSSGKVGPQGAKGKVGPQGPPGGPGSTGMSGPQGDDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTG 890          
BLAST of Collagen alpha-1(XXVII) chain B vs. Planmine SMEST
Match: SMESG000038928.1 (SMESG000038928.1)

HSP 1 Score: 204.527 bits (519), Expect = 3.115e-52
Identity = 132/336 (39.29%), Postives = 191/336 (56.85%), Query Frame = 1
Query: 8194 GRPGSPGKPGTIGHPGWMGTVGNPGARGKSXXXXXXXXXXXXXXXXXXXXXXXQGSVGPTGTKGFPGENGSPGPVGMPGRDGPAXXXXXXXXXXXXXXXXXXAVFFPVRTVRRDLL--NDDALAVKYLGSDVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIESKSPSYKLKHWDASDVTEYRSWFGEITGTFKFDYQIEASQLMFLKLFSTNARQRITINCSRLSVVGNSEHPVILYSDHDEEVLRNGDLFKYSVIRDGCKNSAEIIDSTELEMDTEAIRLPIRDIALNTGSSK-EQQQFGLDIGQVCF 9192
            G  G+PGK G  G  G+ G +G  G +G  G  G  G  G +G  GP G  G  G+ GPTG +GF G+ G  G VG  G DG  G  GP G  GPPGPPGPP V       +  ++   DD L  KYLG+D + KPLGT + PAR+C  L + NP+  DG Y+IDPNGGK DDA +V C+ + K++CI+      +L+           +WF +        Y ++  Q+ FLK+ S  A Q ITINC  + V+ NS  P+ +++D+D  +  +  +F Y V+ D C+++++ + ST LE+ +   RLPI+DI ++T + + E+ Q   +I +VCF
Sbjct:  963 GEEGAPGKQGPRGDKGFTGEIGPDGKQGVKGKPGPNGIPGYSGPRGPSGSKGPIGNPGPTGEQGFQGDRGPNGNVGAQGIDGAQGPLGPQGPNGPPGPPGPPGVATMSNRQQGYMIIQADDPLIAKYLGNDAISKPLGTSNSPARSCLHLAEMNPSFPDGIYWIDPNGGKIDDAVQVYCKIKEKKTCIKPLVFKIQLQK-------PKFNWFSQSNDNKFISYSLDQQQMTFLKMISNKASQFITINCRNMPVIKNSVKPLRIFTDNDIILDSSDQIFSYKVLEDNCQHNSQDLSSTRLEITSRPTRLPIKDIEVDTVNVRSERSQIEYNIEEVCF 1291          

HSP 2 Score: 107.071 bits (266), Expect = 1.987e-22
Identity = 221/553 (39.96%), Postives = 267/553 (48.28%), Query Frame = 1
Query: 5653 GINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPG---KAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGD---IGPMGPSGSPGLRGNPGVIGSLGSQGF------PGARGPQGILGSPGPRGRTGSKGSQGTI------GIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGL---QGPIGPP------------------GNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGN---AGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIG 7185
            G +GPTGP G+PG +GP G  G KG  G  G DG   P+GN G  G  G PG  G  G+PGP G  G  G +G+ G  G  G+PG  GP G+PG  G  G  G +G  G +G +G  G PGS G  GAPG  G PG     G DGP G+KG+ G  G  G  G  GP G +G+ G  G  GSKG+   IGP+GP+GSPG   +PG+IG +G +G       PG +GP+G+ GS GP+G +G  G  G        G+ G+ G  GKDG  G +G                                   G PG+    G  GP GERG PG +G DG PG +G  GQ G    QG  G P                  G  GQR      GP+G  GN G KG  G PG  G  G+ G  G  G+ G  G+ G+ GP G VGN   AG  G  G PG  GK G NG    DG  G+ GP+G+ G  GPQG  G  GPPG  GL G  G TG  G                    G +G  G+PG PG+PG +G
Sbjct:  116 GPSGPTGPVGMPGNQGPDGPSGSKGPVGEKGPDG---PQGNSGDIGVLGLPGPPGHKGAPGPSGRQGPQGPRGLQGVDGLPGQPGPLGPQGVPGPPGMMGPTGVKGYAGKQGVLGSSGDPGSPGVNGAPGPIGQPGIMGSRGKDGPIGIKGENGPLGLLGPQGLSGPPGLQGSLGPPGPQGSKGNEGKIGPVGPAGSPG---SPGLIGEIGERGENGPFGNPGPQGPRGLRGSAGPKGVSGPVGPPGMPGNPGIDGMPGIRGLKGKDGDPGSLG---------------------------------AMGPPGRQGVSGRDGPRGERGYPGPNGQDGSPGAIGEIGQRGKLGSQGETGLPGNVGDPGQPGPAGPMGPPGPRGQR------GPTGNPGNLGEKGDNGPPGPLGPQGSRGKPGVVGKPGQQGSEGKLGPEGLVGNLGPAGQPGKEGTPGPDGKPGTNGLSGKDGEDGDSGPVGAPGADGPQGPKGKDGPPGFPGLIGQKGETGINGL------------------PGRRGISGMPGMPGSPGPVG 605          

HSP 3 Score: 104.375 bits (259), Expect = 1.327e-21
Identity = 56/170 (32.94%), Postives = 96/170 (56.47%), Query Frame = -3
Query:  355 DNLYKPPGSKLYPARSCADIQRDYQNKSNGMFYIDPNGGHWKDAIHVHCNFDRLETCIEPEVVNYKKTSYTKTISSWFSVLASLNKQISYKIPKEQLVFXXXXXXXXXXXXXXSCDQIALVSDDSITQDIRYNNSVQLFGDDNQILTVNNEDDLFQYKVVEDTCKDKSNN 864
            D + KP G+   PARSC  +     +  +G+++IDPNGG   DA+ V+C     +TCI+P V    K    K   +WFS  ++ NK ISY + ++Q+ FL++ S  +SQ +T++C  + ++ +            +++F D++ IL  ++ D +F YKV+ED C+  S +
Sbjct: 1093 DAISKPLGTSNSPARSCLHLAEMNPSFPDGIYWIDPNGGKIDDAVQVYCKIKEKKTCIKPLVF---KIQLQKPKFNWFS-QSNDNKFISYSLDQQQMTFLKMISNKASQFITINCRNMPVIKNSV--------KPLRIFTDNDIIL--DSSDQIFSYKVLEDNCQHNSQD 1248          

HSP 4 Score: 91.2781 bits (225), Expect = 1.111e-17
Identity = 197/522 (37.74%), Postives = 227/522 (43.49%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGI------LGPRGNLGPQGPTGAPG---------------------RRGTVGSPGPVGNAG---------------HPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEV---GNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGR 7071
            G+PG  G  GP G  G+ G  G +G++G  G  G+DG       +G RG LG QG TG PG                     +RG  G+PG +G  G                PGV G  G+ G                        S+G LG +G +G  G  G  GK G PG  G PG  G+ G  G  GD G                         +G+ G  GP GP G  G  G PG+IG  G  G  G  G +GI G PG     GS G  G  G  G PG P KDG  GQ G  G  G  G PGP G +       G  G PGP G  G PGKN   G QGP G  G PGK G  G  G        GL GP+GPPG  G+ G  G+ GP G  G  G  GP G PG  GD G  GP G  G+NG  G  G  GP G V   G+ GIRG NG  G PGK G +GK          GP G  G  GPQG  G  G PG  G  G+ G+ GP+G+
Sbjct:  377 GDPGSLGAMGPPGRQGVSGRDGPRGERGYPGPNGQDGSPGAIGEIGQRGKLGSQGETGLPGNVGDPGQPGPAGPMGPPGPRGQRGPTGNPGNLGEKGDNGPPGPLGPQGSRGKPGVVGKPGQQG------------------------SEGKLGPEGLVGNLGPAGQPGKEGTPGPDGKPGTNGLSGKDGEDGDSG------------------------PVGAPGADGPQGPKGKDGPPGFPGLIGQKGETGINGLPGRRGISGMPG---MPGSPGPVGVRGKVGKPGPPSKDGPPGQAGPQGPPGLDGPPGPDGSVKISGRSGGGRGSPGPKGHKGQPGKNGMNGLQGPTGLSGNPGKQGPPGEAGP------DGLLGPMGPPGKDGKPGEDGNLGPIGKTGKVGKDGPPGPPGPTGDVGPIGPNGLPGQNGKPGKAGPLGPTGPVGRPGSDGIRGPNGLRGPPGKSGADGKK---------GPAGDDGPPGPQGEAGDLGSPGQDGPPGNQGNRGPVGK 832          

HSP 5 Score: 76.6406 bits (187), Expect = 3.716e-13
Identity = 176/482 (36.51%), Postives = 222/482 (46.06%), Query Frame = 1
Query: 5644 GEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRXXXXXXXXXXXXXXXXXXXXXXXXXXSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLG---SQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPG------SNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGP 7062
            G PG+NG  GP G PG      + G +G+ G +G  G  GP G LGPQG +G PG +G++G PGP G+ G+                                    +G +G  G  G  G PG  G+ G  GE+G  G  G  GP G++G  G  G  G  G  G  G  G  G+ G  G KG              G+PG +G++G    QG  G  GP+G  G PGP G+ GS G+ G IG  G      K G  G+ G+PG  G PG+PGP GP+G PG  G+ G  G  G  G  G N  PGP GP G RG PG  G  G  G+ G  G  GL G +GP G  G+ G PG      +NG SG  G  G  GP G P      GA GPQGP+G+                        +G PG PG  G+ G+  ++G           GRRG  GM G+ G PG +G++G +G  GP
Sbjct:  233 GSPGVNGAPGPIGQPG------IMGSRGKDGPIGIKGENGPLGLLGPQGLSGPPGLQGSLGPPGPQGSKGN------------------------------------EGKIGPVGPAGSPGSPGLIGEIGERGENGPFGNPGPQGPRGLRGSAGPKGVSGPVGPPGMPGNPGIDGMPGIRGLKGK------------DGDPGSLGAMGPPGRQGVSGRDGPRGERGYPGPNGQDGSPGAIGEIGQRG------KLGSQGETGLPGNVGDPGQPGPAGPMGPPGPRGQRGPTGNPGNLGEKGDNGPPGPLGPQGSRGKPGVVGKPGQQGSEGKLGPEGLVGNLGPAGQPGKEGTPGPDGKPGTNGLSGKDGEDGDSGPVGAP------GADGPQGPKGK------------------------DGPPGFPGLIGQKGETGINGL---------PGRRGISGMPGMPGSPGPVGVRGKVGKPGP 615          

HSP 6 Score: 73.559 bits (179), Expect = 2.784e-12
Identity = 178/436 (40.83%), Postives = 210/436 (48.17%), Query Frame = 1
Query: 5965 QGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTXXXXXXXXXXXXXXXXXXXXXXELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGV---------------NGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPG---------SIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGT---------P 7173
            QG LG+ G  G +G PG DG  GAPG  G  G +G  GP G+ G+ G                          G  G  GP+G  G  G +GN G IG LG  G PG +G      +PGP GR G +G +G  G+ G+PG         Q G  G  G PG PG +GP G+ G+ GK G  G +G PG+PG N  PGP G  G  G  GK G  G+ G  GP G  G QG  GPPG  G  G PG   P G+KGN+G  GP G  G  G  G  G  G RGENG  GN G QGP G  G+AG +GV               +G PGI G  G++G     GA G  G  G SGR GP+G  G  GP G          IG +G +GS G  G  G  G PG+PG  GP GP G +G +G  GNPG          P
Sbjct:   85 QGVLGLIGPTGINGKPGVDGSIGAPGPVGPDGPSGPTGPVGMPGNQGPD------------------------GPSGSKGPVGEKGPDGPQGNSGDIGVLGLPGPPGHKG------APGPSGRQGPQGPRGLQGVDGLPG---------QPGPLGPQGVPGPPGMMGPTGVKGYAGKQGVLGSSGDPGSPGVNGAPGPIGQPGIMGSRGKDGPIGIKGENGPLGLLGPQGLSGPPGLQGSLGPPG---PQGSKGNEGKIGPVGPAGSPGSPGLIGEIGERGENGPFGNPGPQGPRGLRGSAGPKGVSGPVGPPGMPGNPGIDGMPGIRGLKGKDGDPGSLGAMGPPGRQGVSGRDGPRGERGYPGPNGQDGSPGAIGEIGQRGKLGSQGETGLPGNVGDPGQPGPAGPMGPPGPRGQRGPTGNPGNLGEKGDNGPP 478          

HSP 7 Score: 71.633 bits (174), Expect = 9.685e-12
Identity = 136/316 (43.04%), Postives = 161/316 (50.95%), Query Frame = 1
Query: 6277 FPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX---------XXXXXTPGKNMQPGPQGPLGERGPPGKSXXXXXXXXXXXXXQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQ---GPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRXXXXXXXXXXXXXXXXXXEGFKGDKGLPGNPGTPGVIGP 7188
             PG  GPQG+LG  GP G  G  G  G+IG  G  G  G  G  G VG+PG  GP G  G  GP+G  G  G  G  G           G  G PG + + GPQGP G +G  G  G  G  G  G PG  G+ GP G  G +G++G+ GS+G  G+ G  G+ GP G+PGI G  G  GP G +GENG LG  G Q   GP G  G+ G  G  G+ G  GK G  G     G+ G IG IG  G  GP G  G QGP      +G  GS GP G  G  G PG PG  G  G  G +G KG  G+PG+ G +GP
Sbjct:   78 VPGKDGPQGVLGLIGPTGINGKPGVDGSIGAPGPVGPDGPSGPTGPVGMPGNQGPDGPSGSKGPVGEKGPDGPQGNSGDIGVLGLPGPPGHKGAPGPSGRQGPQGPRGLQGVDGLPGQPGPLGPQGVPGPPGMMGPTGVKGYAGKQGVLGSSGDPGSPGVNGAPGPIGQPGIMGSRGKDGPIGIKGENGPLGLLGPQGLSGPPGLQGSLGPPGPQGSKGNEGKIGPVGPAGSPGSPGLIGEIGERGENGPFGNPGPQGP------RGLRGSAGPKGVSGPVGPPGMPGNPGIDGMPGIRGLKGKDGDPGSLGAMGP 387          
The following BLAST results are available for this feature:
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
COL1A21.926e-3633.33collagen type I alpha 2 chain [Source:HGNC Symbol;... [more]
COL1A22.058e-3633.33collagen type I alpha 2 chain [Source:HGNC Symbol;... [more]
COL2A11.049e-3532.28collagen type II alpha 1 chain [Source:HGNC Symbol... [more]
COL2A17.698e-3532.28collagen type II alpha 1 chain [Source:HGNC Symbol... [more]
COL3A12.119e-3233.78collagen type III alpha 1 chain [Source:HGNC Symbo... [more]
back to top
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
col-1352.613e-2835.94COLlagen [Source:UniProtKB/TrEMBL;Acc:G3MU58][more]
col-1351.158e-2435.67COLlagen [Source:UniProtKB/TrEMBL;Acc:G3MU58][more]
emb-92.967e-2136.08Collagen alpha-1(IV) chain [Source:UniProtKB/Swis... [more]
emb-91.818e-1936.15Collagen alpha-1(IV) chain [Source:UniProtKB/Swis... [more]
let-22.250e-1535.82Collagen alpha-2(IV) chain [Source:UniProtKB/Swis... [more]
back to top
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vkg3.448e-2436.33gene:FBgn0016075 transcript:FBtr0333541[more]
vkg3.448e-2436.33gene:FBgn0016075 transcript:FBtr0079036[more]
vkg3.448e-2436.33gene:FBgn0016075 transcript:FBtr0333540[more]
Col4a13.411e-2236.27gene:FBgn0000299 transcript:FBtr0079003[more]
Col4a13.411e-2236.27gene:FBgn0000299 transcript:FBtr0079002[more]
back to top
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
col2a1b1.062e-3835.29collagen, type II, alpha 1b [Source:ZFIN;Acc:ZDB-G... [more]
col2a1a2.704e-3833.86collagen, type II, alpha 1a [Source:ZFIN;Acc:ZDB-G... [more]
col1a25.250e-3835.69collagen, type I, alpha 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
col2a1a2.154e-3733.86collagen, type II, alpha 1a [Source:ZFIN;Acc:ZDB-G... [more]
col2a1a4.989e-3733.86collagen, type II, alpha 1a [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
col1a22.351e-3834.87collagen type I alpha 2 [Source:NCBI gene;Acc:7801... [more]
col2a13.573e-3834.65collagen, type II, alpha 1 [Source:NCBI gene;Acc:3... [more]
col2a12.066e-3734.65collagen, type II, alpha 1 [Source:NCBI gene;Acc:3... [more]
col1a23.234e-3734.87collagen type I alpha 2 [Source:NCBI gene;Acc:7801... [more]
col1a23.434e-3734.87collagen type I alpha 2 [Source:NCBI gene;Acc:7801... [more]
back to top
BLAST of Collagen alpha-1(XXVII) chain B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Col2a11.269e-3532.51collagen, type II, alpha 1 [Source:MGI Symbol;Acc:... [more]
Col2a11.074e-3432.51collagen, type II, alpha 1 [Source:MGI Symbol;Acc:... [more]
Col1a12.621e-3434.69collagen, type I, alpha 1 [Source:MGI Symbol;Acc:M... [more]
Col5a21.137e-3334.20collagen, type V, alpha 2 [Source:MGI Symbol;Acc:M... [more]
Col1a21.973e-3331.22collagen, type I, alpha 2 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Collagen alpha-1(XXVII) chain B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5