Non-SMC condensin II complex subunit G2

Overview
NameNon-SMC condensin II complex subunit G2
Smed IDSMED30035875
Length (bp)1003
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Non-SMC condensin II complex subunit G2 (SMED30035875) t-SNE clustered cells

Violin plots show distribution of expression levels for Non-SMC condensin II complex subunit G2 (SMED30035875) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Non-SMC condensin II complex subunit G2 (SMED30035875) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Non-SMC condensin II complex subunit G2 (SMED30035875) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035875

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30035875SMESG000024947.1 SMESG000024945.1 SMESG000024886.1 SMESG000024883.1 SmedASXL_075938SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30035875SMESG000024947.1 SMESG000024945.1 SMESG000024886.1 SmedASXL_017059SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30035875SMESG000024947.1 SMESG000024945.1 SMESG000024886.1 SMESG000024883.1 dd_Smed_v4_15610_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30035875SMESG000024947.1 SMESG000024945.1 SMESG000024886.1 SMESG000024883.1 dd_15610dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30035875SMESG000024947.1 SMESG000024945.1 SMESG000024886.1 SMESG000024883.1 dd_15610dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
parapharyngeal regionSMED30035875SMESG000024947.1 SMESG000024945.1 SMESG000024886.1 SMESG000024883.1 dd_15610dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Zebrafish
Match: si:ch73-359m17.2 (si:ch73-359m17.2 [Source:ZFIN;Acc:ZDB-GENE-141222-90])

HSP 1 Score: 58.9214 bits (141), Expect = 4.370e-10
Identity = 41/125 (32.80%), Postives = 57/125 (45.60%), Query Frame = 2
Query:  161 QKAVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFYVSYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKRLYARTLAISKPLAADYINLCELEVY 535
            + AVDGN + +   GSC H+     N WW V L  +S V KV I +R DCC  R       +      SL NN N   N    A      +   T  F+ +  R L +  P   + ++LCE+EV+
Sbjct:   45 EHAVDGNTEADYRKGSCTHTS-REFNPWWRVDLGGVSSVNKVTITNRGDCCEERIRGAQIRI----GDSLENNGN---NNQLAATLLDAIKGSQTFEFQPIQGRYLNVFLPGNDETLSLCEVEVF 161          
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Zebrafish
Match: si:ch73-359m17.2 (si:ch73-359m17.2 [Source:ZFIN;Acc:ZDB-GENE-141222-90])

HSP 1 Score: 60.4622 bits (145), Expect = 6.470e-10
Identity = 42/128 (32.81%), Postives = 58/128 (45.31%), Query Frame = 2
Query:  161 QKAVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFYVSYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKRLYARTLAISKPLAADYINLCELEVYGYP 544
            + AVDGN + +   GSC H+     N WW V L  +S V KV I +R DCC  R       +      SL NN N   N    A      +   T  F+ +  R L +  P   + ++LCE+EV+  P
Sbjct:   45 EHAVDGNTEADYRKGSCTHTS-REFNPWWRVDLGGVSSVNKVTITNRGDCCEERIRGAQIRI----GDSLENNGN---NNQLAATLLDAIKGSQTFEFQPIQGRYLNVFLPGNDETLSLCEVEVFSGP 164          

HSP 2 Score: 55.4546 bits (132), Expect = 2.881e-8
Identity = 38/124 (30.65%), Postives = 55/124 (44.35%), Query Frame = 2
Query:  164 KAVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFYVSYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKRLYARTLAISKPLAADYINLCELEVY 535
             AVDG+ +     GSC H+ G   N WW V L  +  + +V I +R DCC  R +     +      SL NN N    ++     P       T  F+ +  R L I  P    Y+ LCE++V+
Sbjct:  188 NAVDGSTESEYQEGSCSHTLG-ETNPWWRVDLGRVFSIRRVSITNRGDCCEERLNGAEIRI----GNSLENNGNSNHLVATVEHIPAGN--TETFEFQPVQGRFLNIVLPGVNVYLTLCEVQVF 304          
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Zebrafish
Match: si:ch73-359m17.2 (si:ch73-359m17.2 [Source:ZFIN;Acc:ZDB-GENE-141222-90])

HSP 1 Score: 58.151 bits (139), Expect = 2.020e-9
Identity = 41/125 (32.80%), Postives = 57/125 (45.60%), Query Frame = 2
Query:  161 QKAVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFYVSYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKRLYARTLAISKPLAADYINLCELEVY 535
            + AVDGN + +   GSC H+     N WW V L  +S V KV I +R DCC  R       +      SL NN N   N    A      +   T  F+ +  R L +  P   + ++LCE+EV+
Sbjct:   45 EHAVDGNTEADYRKGSCTHTS-REFNPWWRVDLGGVSSVNKVTITNRGDCCEERIRGAQIRI----GDSLENNGN---NNQLAATLLDAIKGSQTFEFQPIQGRYLNVFLPGNDETLSLCEVEVF 161          
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Zebrafish
Match: si:ch211-215k15.4 (si:ch211-215k15.4 [Source:ZFIN;Acc:ZDB-GENE-131127-215])

HSP 1 Score: 56.225 bits (134), Expect = 1.391e-8
Identity = 45/158 (28.48%), Postives = 71/158 (44.94%), Query Frame = 2
Query:   77 IIAAQDLILSRGRPTFGTIIAGYSVWEP--QKAVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFYVSYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKRLYARTLAISKPLAADYINLCELEVYGYP 544
            +IAA++L LS GR T   ++      E     A+DGN D + ++GSC  +E  + + WW + L    VV  + I +R DCC  R      ++      +          ++      P G  +T    K +  R + +    +   + LCELEVYGYP
Sbjct:   17 LIAARNLALS-GRATQSDLLKNPWTGEALASNAIDGNRDPDFYHGSCTATEVQD-DPWWRLDLLDTYVVKSITITNRKDCCPERLDGAEVHIGNSLLNNGN-----SNPLAAKISSIPAGRSLTFKWKKGISGRYINVILRGSNRILTLCELEVYGYP 167          
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Zebrafish
Match: si:ch211-215k15.4 (si:ch211-215k15.4 [Source:ZFIN;Acc:ZDB-GENE-131127-215])

HSP 1 Score: 52.373 bits (124), Expect = 2.775e-7
Identity = 43/155 (27.74%), Postives = 68/155 (43.87%), Query Frame = 2
Query:   86 AQDLILSRGRPTFGTIIAGYSVWEP--QKAVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFYVSYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKRLYARTLAISKPLAADYINLCELEVYGYP 544
            A++L LS GR T   ++      E     A+DGN D + ++GSC  +E  + + WW + L    VV  + I +R DCC  R      ++      +          ++      P G  +T    K +  R + +    +   + LCELEVYGYP
Sbjct:   25 ARNLALS-GRATQSDLLKNPWTGEALASNAIDGNRDPDFYHGSCTATEVQD-DPWWRLDLLDTYVVKSITITNRKDCCPERLDGAEVHIGNSLLNNGN-----SNPLAAKISSIPAGRSLTFKWKKGISGRYINVILRGSNRILTLCELEVYGYP 172          
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Xenopus
Match: fucolectin (x-epilectin [Source:NCBI gene;Acc:100144955])

HSP 1 Score: 65.4698 bits (158), Expect = 2.262e-11
Identity = 42/126 (33.33%), Postives = 59/126 (46.83%), Query Frame = 2
Query:  167 AVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFYV--SYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKRLYARTLAISKPLAADYINLCELEVYG 538
            A+DGN D N   GSC H+   N   WW + L     V KVVI +R DCC  R       V  S  N+  +   + D              ++  TL+ K +  R +++  P  A+Y+ LCE+EVYG
Sbjct:  213 AIDGNKDTNMMAGSCSHTNSDNP-AWWQLDLKKRYQVEKVVIVNRGDCCGERLRGAEIRVGDSPDNNNPVCATVTDV------------SQLTLTLSCKGIPGRYVSVVIPGRAEYLQLCEVEVYG 325          

HSP 2 Score: 56.225 bits (134), Expect = 2.265e-8
Identity = 38/140 (27.14%), Postives = 61/140 (43.57%), Query Frame = 2
Query:  161 QKAVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSR--TSLISFYVSYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKRLYARTLAISKPLAADYINLCELEVYGYPLIKSTFTLFK 574
            QKAVDGN D N F  SC H+   +   WW + L     +  +VI +R DCC  R   + I    S  N+  +   + D   +++             +    +  R +++     A+Y+ LCE+EVYG     +   L +
Sbjct:   68 QKAVDGNKDTNMFQNSCSHTNN-DKPSWWQLDLKKNYNIDTIVIANRGDCCAERLLRAEIRVGNSPDNNNPVCATITDVSKLTF------------PVCCNGMEGRYVSVVISDRAEYLQLCEVEVYGQEAKPADVNLAR 194          
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Xenopus
Match: fucolectin (x-epilectin [Source:NCBI gene;Acc:100144955])

HSP 1 Score: 65.0846 bits (157), Expect = 2.338e-11
Identity = 42/126 (33.33%), Postives = 59/126 (46.83%), Query Frame = 2
Query:  167 AVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFYV--SYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKRLYARTLAISKPLAADYINLCELEVYG 538
            A+DGN D N   GSC H+   N   WW + L     V KVVI +R DCC  R       V  S  N+  +   + D              ++  TL+ K +  R +++  P  A+Y+ LCE+EVYG
Sbjct:  192 AIDGNKDTNMMAGSCSHTNSDNP-AWWQLDLKKRYQVEKVVIVNRGDCCGERLRGAEIRVGDSPDNNNPVCATVTDV------------SQLTLTLSCKGIPGRYVSVVIPGRAEYLQLCEVEVYG 304          

HSP 2 Score: 56.225 bits (134), Expect = 2.379e-8
Identity = 38/140 (27.14%), Postives = 61/140 (43.57%), Query Frame = 2
Query:  161 QKAVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSR--TSLISFYVSYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKRLYARTLAISKPLAADYINLCELEVYGYPLIKSTFTLFK 574
            QKAVDGN D N F  SC H+   +   WW + L     +  +VI +R DCC  R   + I    S  N+  +   + D   +++             +    +  R +++     A+Y+ LCE+EVYG     +   L +
Sbjct:   47 QKAVDGNKDTNMFQNSCSHTNN-DKPSWWQLDLKKNYNIDTIVIANRGDCCAERLLRAEIRVGNSPDNNNPVCATITDVSKLTF------------PVCCNGMEGRYVSVVISDRAEYLQLCEVEVYGQEAKPADVNLAR 173          
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Xenopus
Match: fucolectin (x-epilectin [Source:NCBI gene;Acc:100144955])

HSP 1 Score: 65.0846 bits (157), Expect = 2.411e-11
Identity = 42/126 (33.33%), Postives = 59/126 (46.83%), Query Frame = 2
Query:  167 AVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFYV--SYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKRLYARTLAISKPLAADYINLCELEVYG 538
            A+DGN D N   GSC H+   N   WW + L     V KVVI +R DCC  R       V  S  N+  +   + D              ++  TL+ K +  R +++  P  A+Y+ LCE+EVYG
Sbjct:  191 AIDGNKDTNMMAGSCSHTNSDNP-AWWQLDLKKRYQVEKVVIVNRGDCCGERLRGAEIRVGDSPDNNNPVCATVTDV------------SQLTLTLSCKGIPGRYVSVVIPGRAEYLQLCEVEVYG 303          

HSP 2 Score: 53.9138 bits (128), Expect = 1.154e-7
Identity = 38/138 (27.54%), Postives = 60/138 (43.48%), Query Frame = 2
Query:  167 AVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTS--RTSLISFYVSYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKRLYARTLAISKPLAADYINLCELEVYGYPLIKSTFTLFK 574
            AVDGN + N   GSC H+   N   WW + L     V  VVI +R DCC    R ++I    S  N+  +   + D   +++             +    +  R +++     A+Y+ LCE+EVYG     +   L +
Sbjct:   48 AVDGNKNSNMMLGSCSHTNSDNP-AWWQLDLKKRYKVETVVIVNRGDCCWERLRGAVIRVGDSANNNNPVCATITDVSKLTF------------PVCCNGMEGRYVSVVISDRAEYLQLCEVEVYGQEAKPADVNLAR 172          
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Xenopus
Match: fucolectin (x-epilectin [Source:NCBI gene;Acc:100144955])

HSP 1 Score: 65.0846 bits (157), Expect = 2.434e-11
Identity = 42/126 (33.33%), Postives = 59/126 (46.83%), Query Frame = 2
Query:  167 AVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFYV--SYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKRLYARTLAISKPLAADYINLCELEVYG 538
            A+DGN D N   GSC H+   N   WW + L     V KVVI +R DCC  R       V  S  N+  +   + D              ++  TL+ K +  R +++  P  A+Y+ LCE+EVYG
Sbjct:  191 AIDGNKDTNMMAGSCSHTNSDNP-AWWQLDLKKRYQVEKVVIVNRGDCCGERLRGAEIRVGDSPDNNNPVCATVTDV------------SQLTLTLSCKGIPGRYVSVVIPGRAEYLQLCEVEVYG 303          

HSP 2 Score: 56.225 bits (134), Expect = 2.065e-8
Identity = 39/138 (28.26%), Postives = 59/138 (42.75%), Query Frame = 2
Query:  167 AVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFYV--SYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKRLYARTLAISKPLAADYINLCELEVYGYPLIKSTFTLFK 574
            AVDGN + N   GSC H+   N   WW + L     V KVVI +R DCC  R       V  S  N+  +   + D   +++             +    +  R +++     A+Y+ LCE+EVYG     +   L +
Sbjct:   48 AVDGNKNSNMMLGSCSHTNSDNP-AWWQLDLKKRYQVEKVVIVNRGDCCGERLRGAEVRVGNSADNNNPVCATITDVSKLTF------------PVCCNGMEGRYVSVVISDRAEYLQLCEVEVYGQEAKPADVNLAR 172          
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Xenopus
Match: fucolectin (x-epilectin [Source:NCBI gene;Acc:100144955])

HSP 1 Score: 63.929 bits (154), Expect = 6.353e-11
Identity = 42/126 (33.33%), Postives = 59/126 (46.83%), Query Frame = 2
Query:  167 AVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFYV--SYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKRLYARTLAISKPLAADYINLCELEVYG 538
            AVDGN + N   GSC H+   N   WW + L     V KVVI +R DCC  R       V  S  N+  +   + D              ++  TL+ K +  R +++  P  A+Y+ LCE+EVYG
Sbjct:  206 AVDGNKNSNMMLGSCSHTNSDNP-AWWQLDLKKRYQVEKVVIVNRGDCCGERLRGAEVRVGNSADNNNPVCATVTDV------------SQLTLTLSCKGIPGRYVSVVIPGRAEYLQLCEVEVYG 318          

HSP 2 Score: 52.373 bits (124), Expect = 3.899e-7
Identity = 36/126 (28.57%), Postives = 57/126 (45.24%), Query Frame = 2
Query:  161 QKAVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFYVSYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKRLYARTLAISKPLAADYINLCELEVYG 538
            Q AVDGN + N +   C H+   +   WW + L     +  VVI +R DCC+ R  L+   +   +S    N + D   +              TL  + L  R +++  P   + ++LCE+EVYG
Sbjct:   61 QTAVDGNKETNYYVHPCAHT-NKDFAPWWQLDLKKSIKIWTVVITTRRDCCSER--LLGAEIRVGDSADNKNPVCDTIKVGSQG--------TITLCCEGLEGRYVSVVIPGREENLSLCEVEVYG 175          
BLAST of Non-SMC condensin II complex subunit G2 vs. UniProt/SwissProt
Match: sp|Q9I929|FUCL3_ANGJA (Fucolectin-3 OS=Anguilla japonica OX=7937 PE=2 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 6.351e-11
Identity = 50/179 (27.93%), Postives = 78/179 (43.58%), Query Frame = 2
Query:   47 EIYLLVIILKIIAA---------------QDLILSRGRPTFGTIIAGY--SVWEPQKAVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFYVSYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKRLYARTLAISKPLAADYINLCELEV 532
            E+ +++++ +I+A                Q+ +  RGR T    + G          A+DGN D N  +GSC H+EG N   WW V L  +  +T V I +R DCC  R S     +      +  NN  +   I+  A     GE  T    + +  R + +  P  A+ + LCE+EV
Sbjct:    2 EVKMIILLFQILAISTLKSDSADIPEGYIQENVALRGRATQSAQLKGEFAGFAHASNAIDGNRDSNYHHGSCSHTEGDN--SWWRVDLKQVYTITSVTITNRGDCCGERISGARILIGKHLENNGINNP-ECSTINIMAA----GETKTFHCPQPMIGRYVTVYLP-KAESLQLCEVEV 172          
BLAST of Non-SMC condensin II complex subunit G2 vs. UniProt/SwissProt
Match: sp|Q7SIC1|FUCL_ANGAN (Fucolectin OS=Anguilla anguilla OX=7936 PE=1 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 5.985e-10
Identity = 34/99 (34.34%), Postives = 48/99 (48.48%), Query Frame = 2
Query:   89 QDLILSRGRPTFGTIIAGYSVW--EPQKAVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFYVSYKNSTSLTNN 379
            Q+ +  RG+ T    + G      E   A+DGN D N ++GSC HS G   N WW V L  +  +T V I +R DCC  R S     +    +++  NN
Sbjct:    8 QENVAVRGKATQSAQLRGEHAANSEASNAIDGNRDSNFYHGSCTHSSG-QANPWWRVDLLQVYTITSVTITNRGDCCGERISGAEINIGQHLASNGVNN 105          
BLAST of Non-SMC condensin II complex subunit G2 vs. UniProt/SwissProt
Match: sp|Q9I925|FUCL7_ANGJA (Fucolectin-7 OS=Anguilla japonica OX=7937 PE=2 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 1.576e-9
Identity = 47/181 (25.97%), Postives = 77/181 (42.54%), Query Frame = 2
Query:   41 KNEIYLLVIILKIIAA---------------QDLILSRGRPTFGTIIAG--YSVWEPQKAVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFYVSYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKRLYARTLAISKPLAADYINLCELEV 532
            + E+ +++++ +I+A                Q+ +  RGR T    + G    +     A+DGN D   ++GSC H+E      WW V L  +  +T V I +R DCC  R S     +      +  NN           GP   GE  T    + +  R + +  P  A+ ++LCE+EV
Sbjct:    9 RMEVKMIMLLFQILAISTLKSDSADIPEGYIQENVALRGRATQSAQLRGDHSGIAHASNAIDGNRDSVFYHGSCTHTEADK--PWWRVDLLQVYTITSVTITNRGDCCEERISGARILIGKHLENNGINNPQ-----CSVIGPMAAGETKTFRCPQPMIGRYVTVYLP-KAESLHLCEVEV 181          
BLAST of Non-SMC condensin II complex subunit G2 vs. UniProt/SwissProt
Match: sp|Q9I928|FUCL4_ANGJA (Fucolectin-4 OS=Anguilla japonica OX=7937 PE=2 SV=1)

HSP 1 Score: 59.6918 bits (143), Expect = 2.205e-9
Identity = 46/144 (31.94%), Postives = 64/144 (44.44%), Query Frame = 2
Query:  107 RGRPTFGTIIAGY--SVWEPQKAVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFYVSYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKRLYARTLAISKPLAADYINLCELEV 532
            RGR T    + G   ++     A+DGN D N  +GSC H+EG   N WW V L  +  +  V I +R DCC  R S     +      SL NN  +    S   G    GE  T    + +  R + +  P   + + LCE+EV
Sbjct:   37 RGRATQSAQLRGEHAALAHASNAIDGNRDSNYHHGSCTHTEG--ANPWWRVDLLQVYTIASVTITNRGDCCGERISGARILI----GNSLENNGINNPQCSVI-GSLATGETRTFHCPQPMIGRYVTVYLP-KIESLQLCEVEV 172          
BLAST of Non-SMC condensin II complex subunit G2 vs. UniProt/SwissProt
Match: sp|Q9I927|FUCL5_ANGJA (Fucolectin-5 OS=Anguilla japonica OX=7937 PE=2 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 1.819e-8
Identity = 46/151 (30.46%), Postives = 69/151 (45.70%), Query Frame = 2
Query:   89 QDLILSRGRPTFGTIIAGYS--VWEPQKAVDGNYDGNQFNGSCFHS-EGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFYVSYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKRLYARTLAISKPLAADYINLCELEV 532
            Q+ +  RG+ T   + +G    +  P  A+DGN D +  +GSC H+  GPN   WW V L  +  +  V I +R DCC  R +     +      SL NN  +    S   G    GE  T    + +  R + +  P   +Y+ LCE+EV
Sbjct:   40 QENVAVRGKATQSALASGGGAVLSLPGYAIDGNRDSDSSHGSCSHTTNGPN--PWWRVDLLQVYTIASVTITNRGDCCGERITGAHILI----GNSLENNGINNPQCS-TVGIMTAGETRTFHCSRPMIGRYVTVYLP-KTEYLQLCEVEV 182          
BLAST of Non-SMC condensin II complex subunit G2 vs. TrEMBL
Match: A0A1S3KEU6 (fucolectin OS=Lingula unguis OX=7574 GN=LOC106181345 PE=4 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 2.792e-15
Identity = 63/201 (31.34%), Postives = 104/201 (51.74%), Query Frame = 2
Query:  101 LSRGRPTFGTIIAGYS-VWEPQKAVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFYVSYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKR-LYARTLAISKPLAADY-INLCELEVYGYPLIKSTFTLFKYFGTLSLYDSLGNVGIFTVVSNLDCALKCLLNEKCYSFSV 694
            +++G+P   +    Y   +    AVDGNYD N   GSC H+E    N WWLV L+S +++  VV+ +R +CC+ R  L++F V    S   T++   +   + Y G  P G   T+L+ +  L  R + I K  + D  + LCE+EV+G+P    + T F+  G      SL  +    V S  +C++ C+ + +C + +V
Sbjct:   26 VAKGKPAHQSSTYMYEGSYNASLAVDGNYDDNWQQGSCSHTEDGQGN-WWLVDLESTAILAGVVLTNRGECCSER--LVNFEVRVGYSFVGTSSFTQYRLCASYPGVAPVGN--TSLSCRSPLRGRYVLIIKVGSDDLPLQLCEVEVHGFP----STTTFQLVGA-GARASLSPISTLNVRSLTECSISCMQHWECAAINV 216          
BLAST of Non-SMC condensin II complex subunit G2 vs. TrEMBL
Match: A0A1S3I1T9 (fucolectin-like OS=Lingula unguis OX=7574 GN=LOC106160239 PE=4 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 7.666e-14
Identity = 63/203 (31.03%), Postives = 102/203 (50.25%), Query Frame = 2
Query:  101 LSRGRPTFG--TIIAGYSVWEPQKAVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFYV--SYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKRLYARTLAISKPLAAD-YINLCELEVYGYPLIKSTFTLFKYFGTLSLYDSLGNVGIFTVVSNLDCALKCLLNEKCYSFSV 694
            L++G+P +   T +    V    ++VDGNYD    NG C H++     +WWLV L++ + V  V+I +R DCC+ R + +   +  SY N++S T     +   + Y G  P G    +     L  R + I K  + D Y+ LCE+EV+G   I ST T FK         +L  +    V S ++C++ C+ N KC + ++
Sbjct:   28 LAKGKPAYQSTTYVNVNGVHPASRSVDGNYDNVMSNGRCSHTD-LGQGQWWLVDLETTASVAGVIITNRGDCCSERLNNVEVRIGTSYVNNSSFT----QYKLCASYPGVAPVGNTSMSCG-SPLRGRYVLIIKVGSDDSYLQLCEVEVHG---ITST-TTFKRVAA-DARATLVPISTLNVRSLIECSISCVQNWKCVAINI 219          
BLAST of Non-SMC condensin II complex subunit G2 vs. TrEMBL
Match: A0A1S3JYD2 (uncharacterized protein LOC106177245 OS=Lingula unguis OX=7574 GN=LOC106177245 PE=4 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.410e-12
Identity = 64/203 (31.53%), Postives = 105/203 (51.72%), Query Frame = 2
Query:  101 LSRGRPTFGTIIAGYSVWEPQKAVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFYV--SYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKR-LYARTLAISKPLAAD--YINLCELEVYGYPLIKSTFTLFKYFGTLSLYDSLGNVGIFTVVSNLDCALKCLLNEKCYSFSV 694
            L++G+P   +  + Y   + + AVDGNYD    +GSC ++ G    +WWLV L++ + V  V+I +R DCC+ R +     V  SY+N++S T     +   + Y G  P G   T+L+    L  R + I K + +D  Y+ LCE+EV+G     S+ T F+         SL  +    V S  +C++ C+ + KC + +V
Sbjct:   26 LAKGKPANQS--STYHTCDARLAVDGNYDDVLSHGSCSNTNGGQ-GQWWLVDLETTARVAGVIITNRGDCCSDRLNNFEVRVGTSYENNSSFTQ----YKLCASYPGVAPVG--TTSLSCGSPLRGRYVLIIK-VGSDYSYLQLCEVEVHGI----SSATTFQQVAA-DARASLVPISTLNVRSLTECSISCMQHWKCAAINV 213          
BLAST of Non-SMC condensin II complex subunit G2 vs. TrEMBL
Match: C3Z9Q2 (Uncharacterized protein (Fragment) OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_224255 PE=4 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 3.027e-11
Identity = 41/127 (32.28%), Postives = 64/127 (50.39%), Query Frame = 2
Query:  158 PQKAVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFYVSYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKRLYARTLAISKPLAADYINLCELEVYG 538
            P +AVDG   G   +GSC H++  + N WW V L+    V  + I++R DCC  R +    Y+  K  +++T N     + S+     P G+   T+    L  R + I+ P +   + LCE+EVYG
Sbjct:   24 PDRAVDGGRSGTFHDGSCTHTDTED-NPWWYVDLERTQEVDHITIFNRQDCCWDRITPFEVYIGDK--SNVTENQKLVGDFSF-----PAGQAEKTIQVGGLKGRYVGITLPGSNRILALCEVEVYG 142          

HSP 2 Score: 73.1738 bits (178), Expect = 6.150e-11
Identity = 41/127 (32.28%), Postives = 66/127 (51.97%), Query Frame = 2
Query:  158 PQKAVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFYVSYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKRLYARTLAISKPLAADYINLCELEVYG 538
            P +AVDG   G+  +GSC H++  + N WW V L+    V  + I++R DCC  R +    Y+  K  +++T N     + S+     P G+   T+    L  R ++I+ P +   + LCE+EVYG
Sbjct:  168 PGRAVDGGRSGSFADGSCSHTDTED-NPWWYVDLERTQEVDHITIFNRQDCCWDRITPFEVYIGDK--SNVTENQKLVGDFSF-----PAGQAEKTIQVGGLKGRYVSITLPGSNRILALCEVEVYG 286          
BLAST of Non-SMC condensin II complex subunit G2 vs. TrEMBL
Match: A0A1S3HEB9 (fucolectin-like OS=Lingula unguis OX=7574 GN=LOC106153850 PE=4 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 3.941e-11
Identity = 68/210 (32.38%), Postives = 106/210 (50.48%), Query Frame = 2
Query:  101 LSRGRPTF--GTIIAGYSVWE---PQKAVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFYV----SYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKR-LYARTLAISKPLAADY-INLCELEVYGYPL-IKSTFTLFKYFGTLSLYDSLGNVGIFTVVSNLDCALKCLLNEKCYSFSV 694
            L++G+P +   T    Y + +     +AVDGNY+ N  +GSC H++      WWLV L + + V  V+I +R DCC+ R  L +F V    SY NS+S T     +   + Y G  P G   T+L+ +  L  R + I K  + D  + LCE+EV+G+   +K          TL    +L NVG     S ++C++ C+   KC + +V
Sbjct:   33 LAKGKPAYQSSTYQNRYGITDLYYASRAVDGNYNDNGNHGSCSHTDAGQ-GGWWLVDLKTTARVAGVIITNRRDCCSYR--LTNFEVKVGTSYDNSSSFTQ----YKLCASYPGQAPVGN--TSLSCESPLTGRYVLIIKVGSDDQALQLCEVEVHGFRRSMKFKQVAADARATLVPLSTL-NVG-----SLIECSISCMQRWKCAAINV 227          
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Cavefish
Match: ENSAMXT00000050908.1 (pep primary_assembly:Astyanax_mexicanus-2.0:2:30949256:30953032:-1 gene:ENSAMXG00000032389.1 transcript:ENSAMXT00000050908.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.6254 bits (161), Expect = 3.767e-12
Identity = 48/153 (31.37%), Postives = 65/153 (42.48%), Query Frame = 2
Query:   77 IIAAQDLILSRGRPTFGTIIAGYSVWEPQKAVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFYVSYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKRLYARTLAISKPLAADYINLCELEVY 535
            I      + S   PT G          P+ AVDGN D +   GSC H+     N WW V L  +  VT V I +R DCC+ R      ++      SL N  ND   ++     P   EI  T  FK    R + I  P     ++LCE++V+
Sbjct:  144 IAVGAKAVQSSTTPTLGN---------PEYAVDGNTDTDSRRGSCSHTL-TEANPWWRVELPGVCNVTSVTIVNREDCCSDRIKGAQIHI----GNSLKNKGNDNKLVAVIG--PTLSEITMTYKFKATRGRFVNIFLPGEDKILSLCEVKVF 280          
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Cavefish
Match: ENSAMXT00000035078.1 (pep primary_assembly:Astyanax_mexicanus-2.0:2:30955763:30962150:-1 gene:ENSAMXG00000041548.1 transcript:ENSAMXT00000035078.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.0106 bits (162), Expect = 4.481e-12
Identity = 42/128 (32.81%), Postives = 60/128 (46.88%), Query Frame = 2
Query:  155 EPQKAVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFYVSYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKRLYARTLAISKPLAADYINLCELEVYG 538
            + + AVDGN D N   GSC H+  P  + W  V L  +  +T V I++R DCC+ R       +      SL NN N+   ++     P   E+I T  FK    R + I  P     + LCE++VY 
Sbjct:   41 DAEHAVDGNIDSNYMRGSCTHTM-PETDPWLRVELPGVYKITSVTIFNRGDCCSERIHGAQVRI----GNSLKNNGNENKIVAVIG--PMGSEVIKTYKFKATEGRFVNIFLPGQRKILTLCEVKVYA 161          

HSP 2 Score: 50.447 bits (119), Expect = 1.089e-6
Identity = 36/144 (25.00%), Postives = 61/144 (42.36%), Query Frame = 2
Query:  131 IIAGYSVWEPQKAVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFYVSYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKRLYARTLAISKPLAADYINLCELEVYGYPLIKSTF 562
            I AG+ +  P  A+DGN + +   GSC  ++    + WW + L    V++ V + +R DCC+         +      SL N   D   +       P G+         L    + +  P     ++LCE+EV+G P+ +  F
Sbjct:  197 ISAGFGL--PLNAIDGNRNSDLMKGSCMRTQ-QETSPWWRLSLPRRYVISSVALTNRGDCCSEHVDGAEIRI----GDSLENEGKD-NPLCTIVSSIPAGQTEHYNCTDLLEGSYVTVVLPGEERTLSLCEVEVFGLPVARCGF 332          
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Cavefish
Match: ENSAMXT00000008051.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000995.1:49634:61503:-1 gene:ENSAMXG00000007830.2 transcript:ENSAMXT00000008051.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.7734 bits (151), Expect = 1.574e-10
Identity = 43/129 (33.33%), Postives = 58/129 (44.96%), Query Frame = 2
Query:  155 EPQKAVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFYVSYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKRLYARTLAISKPLAADYINLCELEVYGY 541
             P KA+D N D N   GSC H+     N WW V L     +T +VI +R DCC  R      +V      SL NN N    +       P G+  T    K +  R + +  P +   + LCE+EV+GY
Sbjct:  193 HPSKAIDKNKDTNYHQGSCTHTV-IQQNPWWRVDLLDEFTITSIVITNRGDCCAGRLEGAEIHV----GNSLINNGNGNPRVEVIKS-IPAGKSQTFHLKKEVSGRYVNLIIPGSNQILTLCEVEVFGY 315          

HSP 2 Score: 58.151 bits (139), Expect = 4.852e-9
Identity = 37/128 (28.91%), Postives = 60/128 (46.88%), Query Frame = 2
Query:  164 KAVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFYVSYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKRLYARTLAISKPLAADYINLCELEVYGYPL 547
            KA+DGN DGN F+GSC H++  +++ WW + L     V+ + I +R D    R  L    +   ++ +     N    +    G  P      T     +  R + I  P   +Y+ LCE+EV+G P+
Sbjct:  492 KAIDGNRDGNYFSGSCTHTK-YDLSPWWKLDLQKTHKVSSITITNRQDAVPER--LNGAVIRIGDNPAHNGIQNPKCGVISSIGKNPS----VTFQCNGMKGRYVTIMIPGRKEYLTLCEVEVFGAPV 612          

HSP 3 Score: 58.151 bits (139), Expect = 5.259e-9
Identity = 44/153 (28.76%), Postives = 67/153 (43.79%), Query Frame = 2
Query:  155 EPQKAVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFYVSYKNSTSLTNNMNDFFNI----SYYAGPPPPGEIITTLNFKR-LYARTLAISKPLAADYINLCELEVYGYPLIKSTFTLFKYFGTLSLY 598
            +P KA+DG        GSC H+E  + N WW + L     +  + I +R DCC+ R +     V      SL+NN ND   +    S  AG         + +FK  +  R L +  P     + LCE++V+G+P  +    L  +    S Y
Sbjct:  344 DPSKAIDGKTTSEYSQGSCTHTETQD-NPWWRLDLLKEYNIYSITITNRGDCCSERINGAEIRV----GNSLSNNGNDNPRVGVISSITAGKS------KSFHFKEGVSGRYLNVIIPGKKRILTLCEVQVFGFPRSEGNAALKGFASQSSNY 485          

HSP 4 Score: 58.151 bits (139), Expect = 5.599e-9
Identity = 38/129 (29.46%), Postives = 59/129 (45.74%), Query Frame = 2
Query:  155 EPQKAVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFYVSYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKRLYARTLAISKPLAADYINLCELEVYGY 541
             P KA+DG        GSC H+E  + N WW + L    +VT V + +R DCC+ R +     +      SL+N+ N    +   +          TLN + +  R + +  P     + LCE+EV+GY
Sbjct:   47 HPYKAIDGKTTSEYSQGSCTHTETQD-NPWWRLDLQDEYIVTSVTVTNRGDCCSERLNGAEIRI----GNSLSNDGNSNPRVGVISSISAGKSQTFTLN-QGVSGRYVNVIIPGKKRILTLCEVEVFGY 169          
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Cavefish
Match: ENSAMXT00000056118.1 (fucolectin-4-like [Source:NCBI gene;Acc:103037148])

HSP 1 Score: 59.3066 bits (142), Expect = 2.210e-10
Identity = 40/126 (31.75%), Postives = 58/126 (46.03%), Query Frame = 2
Query:  164 KAVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFYVSYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKRLYARTLAISKPLAADYINLCELEVYGY 541
             A+DGN + N  +GSC H+   N N WW V L     +T + I +R DCC +R +     V      SL NN N    ++  +   P   +  T     +  R + +  P     + LCE+EVYGY
Sbjct:   48 NAIDGNPNSNYHDGSCSHTSTQN-NPWWRVDLLYKYKITSITITNRGDCCANRINGAEIRV----GNSLYNNGNSNTRVAVVSSILPGKSV--TFKLSNISGRYINVILPGYNRILTLCEVEVYGY 166          
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Cavefish
Match: si:ch211-215k15.4 (si:ch211-215k15.4 [Source:ZFIN;Acc:ZDB-GENE-131127-215])

HSP 1 Score: 61.6178 bits (148), Expect = 2.353e-10
Identity = 52/169 (30.77%), Postives = 76/169 (44.97%), Query Frame = 2
Query:   50 IYLLVIILKIIAAQDLILSRGRPTFGTIIA----GYSVWEPQKAVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFYVSYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKRLYARTLAISKPLAADYINLCELEVYGYP 544
            + LLV +      Q+L L RG+ T   ++     G+       A+DGN D N ++GSC  ++    N WW V L     +T +VI +R D C+   +    +V      SL NN N    +       PPG   T    K +  R + +  P     + LCE+EVYGYP
Sbjct:    4 VLLLVALYGSDNRQNLAL-RGKATQSDLVEYPYTGHG--HAYNAIDGNTDPNYYHGSCSSTDWQQ-NPWWRVDLLDEYTITSIVITNRGDSCSELINGAEVHV----GNSLINNGNSNLRVGVIT-SIPPGRSHTFTWDKGVSGRYVNVIIPGNKRMLILCEVEVYGYP 163          
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Nematostella
Match: EDO29994 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T225])

HSP 1 Score: 69.707 bits (169), Expect = 1.102e-13
Identity = 43/123 (34.96%), Postives = 60/123 (48.78%), Query Frame = 2
Query:  167 AVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFYVSYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKRLYARTLAISKPLAADYINLCELEVY 535
            AVDGN DGN  N SC H+     N WW V L +   V +V I +R+DCC  +  L +  +   +S +   N N     +Y     P G+ +T      L  R ++I  P A   + LCE+EVY
Sbjct:  161 AVDGNRDGNYGNWSCTHTNA-ETNPWWRVDLGASHRVAQVFIVARSDCCGDKQELRNIVIHVGDSLANNGNTNARCGGAYTI---PQGKNLTITCSPALQGRYVSIMLPGAKQILTLCEVEVY 279          
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Nematostella
Match: EDO34462 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPB1])

HSP 1 Score: 51.9878 bits (123), Expect = 1.484e-8
Identity = 42/125 (33.60%), Postives = 57/125 (45.60%), Query Frame = 2
Query:  161 QKAVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFYVSYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKRLYARTLAISKPLAADYINLCELEVY 535
            + AVDGN +G  F+ SC  ++    N WW V L    V+ ++ I +R DCC  R  L +F +   +  SL NN ND          P  G I        L  R + I  P     + LCE+EVY
Sbjct:   12 EHAVDGNRNGRYFDLSCTETK-VQSNPWWRVDLQKSYVILRLFIVNRADCCNHR--LDNFEIRIGD--SLENNGNDNPTCGGSYIIPKNGSIAC---HTLLKGRYVNIWIPGPNRLLTLCEVEVY 128          
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Nematostella
Match: EDO40750 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6H5])

HSP 1 Score: 50.8322 bits (120), Expect = 6.755e-8
Identity = 45/135 (33.33%), Postives = 59/135 (43.70%), Query Frame = 2
Query:  167 AVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFYVSYKNSTSLTNNMNDFFNI-SYYAGPPPPGEIITTLNFKRLYARTLAISKPLAADYINLCELEVYGYPLIKSTFTL 568
            AVDGN  GN +  SC  S     N WW V L    V  ++ + +R DCC  R  L +F +   +  SL N+ ND  +  S Y  P   G  I       L  R + I        + LCE+EV  YP I+    L
Sbjct:   27 AVDGNRSGNYYQKSC-SSTTAQTNPWWRVDLQKSHVNLRLFVVNRADCCGER--LDNFEIRIGD--SLVNDGNDNPSCGSSYIIPQGRGNTIACHTL--LKGRYVNIWIQGPDKVLTLCEVEV--YPFIEGEIDL 152          
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Nematostella
Match: EDO42275 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1W6])

HSP 1 Score: 50.0618 bits (118), Expect = 7.501e-8
Identity = 45/137 (32.85%), Postives = 60/137 (43.80%), Query Frame = 2
Query:  161 QKAVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFYVSYKNSTSLTNNMNDFFNI-SYYAGPPPPGEIITTLNFKRLYARTLAISKPLAADYINLCELEVYGYPLIKSTFTL 568
            + AVDG   GN  + SC  S     N WW V L    V+ +  I +R DCC  R  L +F +   +  SL NN ND  +  S Y  P   G+ I       L  R + I        + LCE+EV  YP I+    +
Sbjct:    2 KHAVDGIRSGNYKDKSCA-STARQTNPWWRVDLQKSYVILRFFIVNRADCCGER--LDNFEIRIGD--SLVNNGNDNPSCGSSYIIPQGRGKSIACHTL--LKGRYVNIRIQGPDRSVTLCEVEV--YPFIEGEVQI 129          
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Nematostella
Match: EDO38933 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBJ4])

HSP 1 Score: 50.8322 bits (120), Expect = 1.807e-7
Identity = 49/178 (27.53%), Postives = 77/178 (43.26%), Query Frame = 2
Query:   47 EIYLLVIILKIIAAQDLILSRG--RPTFGTIIAGYSVWEPQKAVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFY-VSYKNSTSLTNNMN------DFFNI------SYYAGPPPPGEIITTLNFKRLYARTLAISKPLAADYINLCELEVY 535
            EI  +++ L     Q+    RG  +P   + I  Y    P++AVDGN DG+    +C H+     N WW V L +   V++V + +R       +S+   Y V  +   SLT+N N      D F++      S Y  P   G  +      RL   ++ ++         LCE+EVY
Sbjct:   86 EICEVMVNLNPTGEQETQGWRGGDKPANQSSIDSYG--NPERAVDGNTDGDYHRQTCTHTSHHEGNPWWRVDLGTTQPVSEVFLVNRL------SSVDRLYNVEVRVGDSLTDNGNTNPRCGDMFSMATLQKLSIYCKPRKSGRYVNV----RLVGASMILT---------LCEVEVY 242          
BLAST of Non-SMC condensin II complex subunit G2 vs. Planmine SMEST
Match: SMESG000024886.1 (SMESG000024886.1)

HSP 1 Score: 449.129 bits (1154), Expect = 2.075e-160
Identity = 225/249 (90.36%), Postives = 227/249 (91.16%), Query Frame = 2
Query:   26 MTKLFKNEIYLLVIILKIIAAQ-----------------DLILSRGRPTFGTIIAGYSVWEPQKAVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFYVSYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKRLYARTLAISKPLAADYINLCELEVYGYPLIKSTFTLFKYFGTLSLYDSLGNVGIFTVVSNLDCALKCLLNEKCYSFSVQLGVYCFIY 721
            MTKLFKNEIYLLVIILKII AQ                 DLILSRGRPTFGTIIAGYSVWEPQKAVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCT+RTS ISFYVSYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKRLYARTLAISKPLAAD+INLCELEVYGYPLIKS FTLFKYFGTLSLYDSLGNVGIFTVVSNLDCALKCLLNEKCYSFSVQL VYCF Y
Sbjct:    1 MTKLFKNEIYLLVIILKIITAQGNEIYFKETIYSLSFVLDLILSRGRPTFGTIIAGYSVWEPQKAVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTNRTSFISFYVSYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKRLYARTLAISKPLAADHINLCELEVYGYPLIKSMFTLFKYFGTLSLYDSLGNVGIFTVVSNLDCALKCLLNEKCYSFSVQLKVYCFNY 249          
BLAST of Non-SMC condensin II complex subunit G2 vs. Planmine SMEST
Match: SMESG000024945.1 (SMESG000024945.1)

HSP 1 Score: 430.254 bits (1105), Expect = 4.511e-153
Identity = 220/249 (88.35%), Postives = 224/249 (89.96%), Query Frame = 2
Query:   26 MTKLFKNEIYLLVIILKIIAAQ-----------------DLILSRGRPTFGTIIAGYSVWEPQKAVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFYVSYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKRLYARTLAISKPLAADYINLCELEVYGYPLIKSTFTLFKYFGTLSLYDSLGNVGIFTVVSNLDCALKCLLNEKCYSFSVQLGVYCFIY 721
            MTKLFKNEIYLLVIILKIIAAQ                 DLILSRGRPTFGTIIAGYSVW PQKAVDGNYDGN F+GSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFYVSY NSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKRL  +TLAISKPLAAD I+LCEL+VYGYPLIKSTFTLFKYFGTLSLYDSLGNVGIFTVVSNLDCALKCLLNEKCYSF VQLGVYCF Y
Sbjct:    1 MTKLFKNEIYLLVIILKIIAAQGNEIYFKETIYSLSFVLDLILSRGRPTFGTIIAGYSVWGPQKAVDGNYDGNHFDGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFYVSYINSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKRL-VKTLAISKPLAADPISLCELDVYGYPLIKSTFTLFKYFGTLSLYDSLGNVGIFTVVSNLDCALKCLLNEKCYSFLVQLGVYCFNY 248          
BLAST of Non-SMC condensin II complex subunit G2 vs. Planmine SMEST
Match: SMESG000024947.1 (SMESG000024947.1)

HSP 1 Score: 328.946 bits (842), Expect = 1.260e-113
Identity = 177/249 (71.08%), Postives = 185/249 (74.30%), Query Frame = 2
Query:   26 MTKLFKNEIYLLVIILKIIAAQ-----------------DLILSRGRPTFGTIIAGYSVWEPQKAVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFYVSYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKRLYARTLAISKPLAADYINLCELEVYGYPLIKSTFTLFKYFGTLSLYDSLGNVGIFTVVSNLDCALKCLLNEKCYSFSVQLGVYCFIY 721
            MTKLFKNEIYLLVIILKIIAAQ                 DLILSRGRPTFGTIIAGYSVW PQKAVDGNYDG   +GSCF+S+G NVNKWWLVILDSLSVVT+V+IYSRTDCCTSRT+LISFY                                        YARTLAISKPLAAD I+LCEL+VYGYPLIKSTFTLFKYFGTLSLYDSLGNVGIFTVVSNLDCALKCLLNEKCYSFSVQLGVYCF Y
Sbjct:    1 MTKLFKNEIYLLVIILKIIAAQGNEIYFKETIYSLSFVLDLILSRGRPTFGTIIAGYSVWGPQKAVDGNYDGIHLDGSCFYSDGANVNKWWLVILDSLSVVTRVIIYSRTDCCTSRTNLISFY----------------------------------------YARTLAISKPLAADPISLCELDVYGYPLIKSTFTLFKYFGTLSLYDSLGNVGIFTVVSNLDCALKCLLNEKCYSFSVQLGVYCFNY 209          
BLAST of Non-SMC condensin II complex subunit G2 vs. Planmine SMEST
Match: SMESG000024705.1 (SMESG000024705.1)

HSP 1 Score: 316.62 bits (810), Expect = 1.622e-108
Identity = 167/232 (71.98%), Postives = 182/232 (78.45%), Query Frame = 2
Query:   26 MTKLFKNEIYLLVIILKIIAAQDLILSRGRPTFGTIIAGYSVWEPQKAVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFYVSYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKRLYARTLAISKPLAADYINLCELEVYGYPLIKSTFTLFKYFGTLSLYDSLGNVGIFTVVSNLDCALKCLLNEKCYSFSVQLGVYCFIY 721
            M K+F N IYLLVII++II A+D +LS GRPTF         W   KAVDGNY+GN   GSC+HSE  N +KWWLVILDSLSVVTKVVIYSRTDCCT RTSL+SFYVSYK+STSL+NN NDF N+SYYAGPPPPGE ITTLNF RLYARTLAISKP   D INLCELEVYGYP  K+    FKYFG LS+YDSLGN G F V SNLDCA+ CLL  KC SFSVQ GV CFIY
Sbjct:    1 MRKIFINNIYLLVIIVEIIVAEDSLLSIGRPTFAN--NAMFPWTSDKAVDGNYNGNMSKGSCYHSETFNYDKWWLVILDSLSVVTKVVIYSRTDCCTQRTSLLSFYVSYKSSTSLSNNNNDFVNVSYYAGPPPPGEFITTLNFTRLYARTLAISKPSLEDAINLCELEVYGYPFTKTMSMTFKYFGALSIYDSLGNFGTFPVQSNLDCAMICLLEAKCLSFSVQFGVKCFIY 230          
BLAST of Non-SMC condensin II complex subunit G2 vs. Planmine SMEST
Match: SMESG000046841.1 (SMESG000046841.1)

HSP 1 Score: 304.294 bits (778), Expect = 1.496e-103
Identity = 149/233 (63.95%), Postives = 170/233 (72.96%), Query Frame = 2
Query:   26 MTKLFKNEIYLLVIILKIIAAQDLILSRGRPTFGT-IIAGYSVWEPQKAVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRTSLISFYVSYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKRLYARTLAISKPLAADYINLCELEVYGYPLIKSTFTLFKYFGTLSLYDSLGNVGIFTVVSNLDCALKCLLNEKCYSFSVQLGVYCFIY 721
            M  +F N    L+ + +I  AQ+ +LSRGRPTF   +I     W   KAVDGNYDGN  +G C+HS+  N  KWWL+ILDSLSVVT+VVIYSRT+CCT RTSL+SFYVSY NSTSL+ N NDF N+SYY G PPPGE ITTLNF RLYARTLAISKP A    NLCELEVYGYP IK+    FKY   LS+YDSLGN+G F V+SNLD A+ CL   KC SFSVQ  V CFIY
Sbjct:    1 MINVFINSSKFLLFVFQITTAQNALLSRGRPTFAANVIDNQPYWSSDKAVDGNYDGNMVDGHCYHSKELNSTKWWLIILDSLSVVTRVVIYSRTECCTQRTSLLSFYVSYTNSTSLSTNSNDFTNVSYYPGSPPPGEFITTLNFTRLYARTLAISKPFAEQPFNLCELEVYGYPFIKTMPMTFKYLRALSIYDSLGNIGTFPVLSNLDSAMICLQEAKCISFSVQFSVKCFIY 233          
The following BLAST results are available for this feature:
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-359m17.24.370e-1032.80si:ch73-359m17.2 [Source:ZFIN;Acc:ZDB-GENE-141222-... [more]
si:ch73-359m17.26.470e-1032.81si:ch73-359m17.2 [Source:ZFIN;Acc:ZDB-GENE-141222-... [more]
si:ch73-359m17.22.020e-932.80si:ch73-359m17.2 [Source:ZFIN;Acc:ZDB-GENE-141222-... [more]
si:ch211-215k15.41.391e-828.48si:ch211-215k15.4 [Source:ZFIN;Acc:ZDB-GENE-131127... [more]
si:ch211-215k15.42.775e-727.74si:ch211-215k15.4 [Source:ZFIN;Acc:ZDB-GENE-131127... [more]
back to top
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fucolectin2.262e-1133.33x-epilectin [Source:NCBI gene;Acc:100144955][more]
fucolectin2.338e-1133.33x-epilectin [Source:NCBI gene;Acc:100144955][more]
fucolectin2.411e-1133.33x-epilectin [Source:NCBI gene;Acc:100144955][more]
fucolectin2.434e-1133.33x-epilectin [Source:NCBI gene;Acc:100144955][more]
fucolectin6.353e-1133.33x-epilectin [Source:NCBI gene;Acc:100144955][more]
back to top
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Non-SMC condensin II complex subunit G2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9I929|FUCL3_ANGJA6.351e-1127.93Fucolectin-3 OS=Anguilla japonica OX=7937 PE=2 SV=... [more]
sp|Q7SIC1|FUCL_ANGAN5.985e-1034.34Fucolectin OS=Anguilla anguilla OX=7936 PE=1 SV=1[more]
sp|Q9I925|FUCL7_ANGJA1.576e-925.97Fucolectin-7 OS=Anguilla japonica OX=7937 PE=2 SV=... [more]
sp|Q9I928|FUCL4_ANGJA2.205e-931.94Fucolectin-4 OS=Anguilla japonica OX=7937 PE=2 SV=... [more]
sp|Q9I927|FUCL5_ANGJA1.819e-830.46Fucolectin-5 OS=Anguilla japonica OX=7937 PE=2 SV=... [more]
back to top
BLAST of Non-SMC condensin II complex subunit G2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3KEU62.792e-1531.34fucolectin OS=Lingula unguis OX=7574 GN=LOC1061813... [more]
A0A1S3I1T97.666e-1431.03fucolectin-like OS=Lingula unguis OX=7574 GN=LOC10... [more]
A0A1S3JYD21.410e-1231.53uncharacterized protein LOC106177245 OS=Lingula un... [more]
C3Z9Q23.027e-1132.28Uncharacterized protein (Fragment) OS=Branchiostom... [more]
A0A1S3HEB93.941e-1132.38fucolectin-like OS=Lingula unguis OX=7574 GN=LOC10... [more]
back to top
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000050908.13.767e-1231.37pep primary_assembly:Astyanax_mexicanus-2.0:2:3094... [more]
ENSAMXT00000035078.14.481e-1232.81pep primary_assembly:Astyanax_mexicanus-2.0:2:3095... [more]
ENSAMXT00000008051.21.574e-1033.33pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000056118.12.210e-1031.75fucolectin-4-like [Source:NCBI gene;Acc:103037148][more]
si:ch211-215k15.42.353e-1030.77si:ch211-215k15.4 [Source:ZFIN;Acc:ZDB-GENE-131127... [more]
back to top
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO299941.102e-1334.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO344621.484e-833.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO407506.755e-833.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO422757.501e-832.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO389331.807e-727.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Non-SMC condensin II complex subunit G2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000024886.12.075e-16090.36SMESG000024886.1[more]
SMESG000024945.14.511e-15388.35SMESG000024945.1[more]
SMESG000024947.11.260e-11371.08SMESG000024947.1[more]
SMESG000024705.11.622e-10871.98SMESG000024705.1[more]
SMESG000046841.11.496e-10363.95SMESG000046841.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035875 ID=SMED30035875|Name=Non-SMC condensin II complex subunit G2|organism=Schmidtea mediterranea sexual|type=transcript|length=1003bp
GATCTTTTAAAATGAGTTTGCAGCAATGACAAAATTATTCAAAAACGAAA
TTTATTTATTAGTTATTATCTTAAAAATAATCGCAGCTCAAGATCTCATT
CTGTCAAGAGGACGACCGACTTTTGGAACAATTATTGCTGGATACTCGGT
GTGGGAACCTCAAAAGGCGGTTGACGGAAATTATGACGGGAATCAATTTA
ACGGATCTTGTTTTCATAGTGAAGGACCAAATGTCAATAAATGGTGGCTC
GTTATTCTTGATTCTTTATCCGTTGTTACAAAGGTTGTCATTTACAGTCG
TACTGACTGCTGTACATCCAGAACAAGTTTAATTTCGTTCTATGTTAGTT
ATAAAAATTCAACTTCCCTCACAAATAATATGAATGATTTTTTTAATATT
TCATATTACGCGGGGCCTCCGCCACCGGGTGAAATTATTACGACTCTGAA
TTTCAAAAGATTATATGCTAGAACTCTTGCTATATCTAAACCATTAGCAG
CGGATTATATCAATCTCTGTGAACTAGAGGTGTATGGCTATCCACTTATT
AAATCAACGTTCACATTGTTCAAATATTTCGGTACTCTGTCATTGTATGA
TAGCCTAGGAAATGTCGGAATATTTACCGTCGTGTCCAATCTTGATTGTG
CATTGAAATGCTTGTTAAATGAAAAATGCTACTCGTTTTCGGTTCAGTTG
GGAGTCTATTGCTTTATTTATGATACCAATAATATCATTACAATCGGATC
CTCAATTTTTATTGATAAATTCTTGATACACCTTTAATCAATGAAAGAAG
TTTCAATTTTCCTTAAGCATTTCTTCTTTCAATTAACTAGATCCCCTTAA
AAATATCATAAAACTTACTCTTAACCAATTATTTCACCTTAATATCACAT
CAATGTTTCATAAGTATTTTTTTCTCAAAAATTACTAAATTAAACAAACA
ATCAGTAACTTTCCAACATGCAATATATATAATTTTCAAACACACACACA
CAC
back to top

protein sequence of SMED30035875-orf-1

>SMED30035875-orf-1 ID=SMED30035875-orf-1|Name=SMED30035875-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=254bp
MTKLFKNEIYLLVIILKIIAAQDLILSRGRPTFGTIIAGYSVWEPQKAVD
GNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTSRT
SLISFYVSYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKRLYART
LAISKPLAADYINLCELEVYGYPLIKSTFTLFKYFGTLSLYDSLGNVGIF
TVVSNLDCALKCLLNEKCYSFSVQLGVYCFIYDTNNIITIGSSIFIDKFL
IHL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
GO:0001868regulation of complement activation, lectin pathway
GO:0010185regulation of cellular defense response
GO:0045088regulation of innate immune response
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR006585FTP1
IPR008979Galactose-bd-like_sf
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0030246carbohydrate binding
GO:0042806fucose binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region