M-phase inducer phosphatase

Overview
NameM-phase inducer phosphatase
Smed IDSMED30035864
Length (bp)1645
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of M-phase inducer phosphatase (SMED30035864) t-SNE clustered cells

Violin plots show distribution of expression levels for M-phase inducer phosphatase (SMED30035864) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of M-phase inducer phosphatase (SMED30035864) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for M-phase inducer phosphatase (SMED30035864) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035864

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30035864h1SMcG0017326 SmedASXL_010065SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30035864h1SMcG0017326 SmedASXL_010065SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30035864h1SMcG0017326 dd_Smed_v4_7176_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
testisSMED30035864h1SMcG0017326 KU852688smed_ncbi_20240424PMID:27330085
Iyer et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
male germ cellSMED30035864h1SMcG0017326 KU852688smed_ncbi_20240424PMID:27330085
Iyer et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of M-phase inducer phosphatase vs. Ensembl Human
Match: CDC25C (cell division cycle 25C [Source:HGNC Symbol;Acc:HGNC:1727])

HSP 1 Score: 110.923 bits (276), Expect = 1.107e-25
Identity = 55/160 (34.38%), Postives = 90/160 (56.25%), Query Frame = 1
Query:  718 SLNHLLIPEISNQTLSDLLVGRYSCYLSDYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISM 1197
            S  H  +  ++ +T++ LL G++   +  + +IDCR+PYEY GGHI  ++N+Y+  ++  +F +  +P +  D Q  +                  +F+CEFSS RGP++  CLR  D+  +L   P + +P +Y+L GGY +FF +Y ELC PQ Y  M
Sbjct:  223 SGKHQDLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLK--KPIVPLDTQKRI----------------IIVFHCEFSSERGPRMCRCLREEDR--SLNQYPALYYPELYILKGGYRDFFPEYMELCEPQSYCPM 362          
BLAST of M-phase inducer phosphatase vs. Ensembl Human
Match: CDC25C (cell division cycle 25C [Source:HGNC Symbol;Acc:HGNC:1727])

HSP 1 Score: 110.923 bits (276), Expect = 1.107e-25
Identity = 55/160 (34.38%), Postives = 90/160 (56.25%), Query Frame = 1
Query:  718 SLNHLLIPEISNQTLSDLLVGRYSCYLSDYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISM 1197
            S  H  +  ++ +T++ LL G++   +  + +IDCR+PYEY GGHI  ++N+Y+  ++  +F +  +P +  D Q  +                  +F+CEFSS RGP++  CLR  D+  +L   P + +P +Y+L GGY +FF +Y ELC PQ Y  M
Sbjct:  223 SGKHQDLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLK--KPIVPLDTQKRI----------------IIVFHCEFSSERGPRMCRCLREEDR--SLNQYPALYYPELYILKGGYRDFFPEYMELCEPQSYCPM 362          
BLAST of M-phase inducer phosphatase vs. Ensembl Human
Match: CDC25C (cell division cycle 25C [Source:HGNC Symbol;Acc:HGNC:1727])

HSP 1 Score: 110.923 bits (276), Expect = 1.807e-25
Identity = 55/160 (34.38%), Postives = 90/160 (56.25%), Query Frame = 1
Query:  718 SLNHLLIPEISNQTLSDLLVGRYSCYLSDYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISM 1197
            S  H  +  ++ +T++ LL G++   +  + +IDCR+PYEY GGHI  ++N+Y+  ++  +F +  +P +  D Q  +                  +F+CEFSS RGP++  CLR  D+  +L   P + +P +Y+L GGY +FF +Y ELC PQ Y  M
Sbjct:  266 SGKHQDLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLK--KPIVPLDTQKRI----------------IIVFHCEFSSERGPRMCRCLREEDR--SLNQYPALYYPELYILKGGYRDFFPEYMELCEPQSYCPM 405          
BLAST of M-phase inducer phosphatase vs. Ensembl Human
Match: CDC25C (cell division cycle 25C [Source:HGNC Symbol;Acc:HGNC:1727])

HSP 1 Score: 110.923 bits (276), Expect = 1.926e-25
Identity = 55/160 (34.38%), Postives = 90/160 (56.25%), Query Frame = 1
Query:  718 SLNHLLIPEISNQTLSDLLVGRYSCYLSDYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISM 1197
            S  H  +  ++ +T++ LL G++   +  + +IDCR+PYEY GGHI  ++N+Y+  ++  +F +  +P +  D Q  +                  +F+CEFSS RGP++  CLR  D+  +L   P + +P +Y+L GGY +FF +Y ELC PQ Y  M
Sbjct:  296 SGKHQDLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLK--KPIVPLDTQKRI----------------IIVFHCEFSSERGPRMCRCLREEDR--SLNQYPALYYPELYILKGGYRDFFPEYMELCEPQSYCPM 435          
BLAST of M-phase inducer phosphatase vs. Ensembl Human
Match: CDC25C (cell division cycle 25C [Source:HGNC Symbol;Acc:HGNC:1727])

HSP 1 Score: 110.923 bits (276), Expect = 1.926e-25
Identity = 55/160 (34.38%), Postives = 90/160 (56.25%), Query Frame = 1
Query:  718 SLNHLLIPEISNQTLSDLLVGRYSCYLSDYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISM 1197
            S  H  +  ++ +T++ LL G++   +  + +IDCR+PYEY GGHI  ++N+Y+  ++  +F +  +P +  D Q  +                  +F+CEFSS RGP++  CLR  D+  +L   P + +P +Y+L GGY +FF +Y ELC PQ Y  M
Sbjct:  296 SGKHQDLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLK--KPIVPLDTQKRI----------------IIVFHCEFSSERGPRMCRCLREEDR--SLNQYPALYYPELYILKGGYRDFFPEYMELCEPQSYCPM 435          
BLAST of M-phase inducer phosphatase vs. Ensembl Celegans
Match: cdc-25.2 (M-phase inducer phosphatase cdc-25.2 [Source:UniProtKB/Swiss-Prot;Acc:O44628])

HSP 1 Score: 90.1225 bits (222), Expect = 5.428e-19
Identity = 57/164 (34.76%), Postives = 76/164 (46.34%), Query Frame = 1
Query:  745 ISNQTLSDLLVGRYSCYLSD-YIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPE-----LCTPQGYISMKQTRYAL 1218
            I+ +TL D+          D YI+IDCR+PYEY+ GHI N+IN +                   D   V K+F   N  +     K  IFYCEFS  RGPK+A  LR +D+  N+   P+  +  +YVL  GY  FF    E     LC P  Y  M    + +
Sbjct:  226 ITAETLRDIFFRLSEKEFDDKYILIDCRYPYEYNRGHIKNAINHF-------------------DRVTVSKIFYDENGRKRC--NKIPIFYCEFSQARGPKMAYALRQVDRELNVNHYPKCDYEEMYVLDLGYRNFFFAANEANITNLCQPHAYCEMHDKEHTM 368          
BLAST of M-phase inducer phosphatase vs. Ensembl Celegans
Match: cdc-25.2 (M-phase inducer phosphatase cdc-25.2 [Source:UniProtKB/Swiss-Prot;Acc:O44628])

HSP 1 Score: 88.9669 bits (219), Expect = 6.007e-19
Identity = 57/164 (34.76%), Postives = 76/164 (46.34%), Query Frame = 1
Query:  745 ISNQTLSDLLVGRYSCYLSD-YIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPE-----LCTPQGYISMKQTRYAL 1218
            I+ +TL D+          D YI+IDCR+PYEY+ GHI N+IN +                   D   V K+F   N  +     K  IFYCEFS  RGPK+A  LR +D+  N+   P+  +  +YVL  GY  FF    E     LC P  Y  M    + +
Sbjct:  119 ITAETLRDIFFRLSEKEFDDKYILIDCRYPYEYNRGHIKNAINHF-------------------DRVTVSKIFYDENGRKRC--NKIPIFYCEFSQARGPKMAYALRQVDRELNVNHYPKCDYEEMYVLDLGYRNFFFAANEANITNLCQPHAYCEMHDKEHTM 261          
BLAST of M-phase inducer phosphatase vs. Ensembl Celegans
Match: cdc-25.2 (M-phase inducer phosphatase cdc-25.2 [Source:UniProtKB/Swiss-Prot;Acc:O44628])

HSP 1 Score: 89.7373 bits (221), Expect = 6.039e-19
Identity = 57/164 (34.76%), Postives = 76/164 (46.34%), Query Frame = 1
Query:  745 ISNQTLSDLLVGRYSCYLSD-YIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPE-----LCTPQGYISMKQTRYAL 1218
            I+ +TL D+          D YI+IDCR+PYEY+ GHI N+IN +                   D   V K+F   N  +     K  IFYCEFS  RGPK+A  LR +D+  N+   P+  +  +YVL  GY  FF    E     LC P  Y  M    + +
Sbjct:  204 ITAETLRDIFFRLSEKEFDDKYILIDCRYPYEYNRGHIKNAINHF-------------------DRVTVSKIFYDENGRKRC--NKIPIFYCEFSQARGPKMAYALRQVDRELNVNHYPKCDYEEMYVLDLGYRNFFFAANEANITNLCQPHAYCEMHDKEHTM 346          
BLAST of M-phase inducer phosphatase vs. Ensembl Celegans
Match: cdc-25.1 (M-phase inducer phosphatase cdc-25.1 [Source:UniProtKB/Swiss-Prot;Acc:O44552])

HSP 1 Score: 88.5817 bits (218), Expect = 2.393e-18
Identity = 43/140 (30.71%), Postives = 70/140 (50.00%), Query Frame = 1
Query:  805 YIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYP--ELCTPQGYISMKQTRYAL 1218
            YII+DCRFP+EY GGH+  +IN++   +                   +  +F   N     F  +  IFYCE+S  RGP +A  +R +D++ N    P V++P +Y+L  GY   +      ++C P  YI M  + +++
Sbjct:  309 YIIVDCRFPFEYKGGHVKGAINLFRHDK-------------------IKPIFFPENGEASSFQNRVPIFYCEYSQKRGPTMAHAVRSIDRVLNELRYPHVEYPEMYLLDYGYKSLWSTAECRQICEPCSYIPMTHSSFSM 429          
BLAST of M-phase inducer phosphatase vs. Ensembl Celegans
Match: cdc-25.1 (M-phase inducer phosphatase cdc-25.1 [Source:UniProtKB/Swiss-Prot;Acc:O44552])

HSP 1 Score: 88.5817 bits (218), Expect = 2.393e-18
Identity = 43/140 (30.71%), Postives = 70/140 (50.00%), Query Frame = 1
Query:  805 YIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYP--ELCTPQGYISMKQTRYAL 1218
            YII+DCRFP+EY GGH+  +IN++   +                   +  +F   N     F  +  IFYCE+S  RGP +A  +R +D++ N    P V++P +Y+L  GY   +      ++C P  YI M  + +++
Sbjct:  309 YIIVDCRFPFEYKGGHVKGAINLFRHDK-------------------IKPIFFPENGEASSFQNRVPIFYCEYSQKRGPTMAHAVRSIDRVLNELRYPHVEYPEMYLLDYGYKSLWSTAECRQICEPCSYIPMTHSSFSM 429          
BLAST of M-phase inducer phosphatase vs. Ensembl Fly
Match: stg (gene:FBgn0003525 transcript:FBtr0085397)

HSP 1 Score: 124.02 bits (310), Expect = 4.027e-30
Identity = 64/172 (37.21%), Postives = 94/172 (54.65%), Query Frame = 1
Query:  697 LPIMRESSLNHLLIPEISNQTLSDLLVGRYSCYLSDYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISMKQTRY 1212
            LP+M      H  +  IS++T++ LL G +S  ++ Y IIDCR+PYE++GGHI  + N+YT  Q++  F           L       +   ++E        IF+CEFSS RGPK++  LR LD+  N  + P + +P +Y+LH GY EFF  + ELC P  Y +M    Y
Sbjct:  287 LPLMEG---RHRDLKSISSETVARLLKGEFSDKVASYRIIDCRYPYEFEGGHIEGAKNLYTTEQILDEF-----------LTVQQTELQQQQNAESGHKRNIIIFHCEFSSERGPKMSRFLRNLDRERNTNAYPALHYPEIYLLHNGYKEFFESHVELCEPHAYRTMLDPAY 444          
BLAST of M-phase inducer phosphatase vs. Ensembl Fly
Match: stg (gene:FBgn0003525 transcript:FBtr0334867)

HSP 1 Score: 124.02 bits (310), Expect = 4.027e-30
Identity = 64/172 (37.21%), Postives = 94/172 (54.65%), Query Frame = 1
Query:  697 LPIMRESSLNHLLIPEISNQTLSDLLVGRYSCYLSDYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISMKQTRY 1212
            LP+M      H  +  IS++T++ LL G +S  ++ Y IIDCR+PYE++GGHI  + N+YT  Q++  F           L       +   ++E        IF+CEFSS RGPK++  LR LD+  N  + P + +P +Y+LH GY EFF  + ELC P  Y +M    Y
Sbjct:  287 LPLMEG---RHRDLKSISSETVARLLKGEFSDKVASYRIIDCRYPYEFEGGHIEGAKNLYTTEQILDEF-----------LTVQQTELQQQQNAESGHKRNIIIFHCEFSSERGPKMSRFLRNLDRERNTNAYPALHYPEIYLLHNGYKEFFESHVELCEPHAYRTMLDPAY 444          
BLAST of M-phase inducer phosphatase vs. Ensembl Fly
Match: twe (gene:FBgn0002673 transcript:FBtr0331444)

HSP 1 Score: 109.768 bits (273), Expect = 1.554e-25
Identity = 57/164 (34.76%), Postives = 86/164 (52.44%), Query Frame = 1
Query:  715 SSLNHLLIPEISNQTLSDLLVGRYSCYLS---DYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISM 1197
            + + H  +  IS+ TL+ L+ G +   L     Y IIDCR+PYE+ GGHI  + N+YT  Q+ + F                     P  + +  + + ++F+CEFSS RGPKL   LR  D+  +  + P + +P +Y+LH GY EFF  Y +LC P  Y+ M
Sbjct:  236 TGIRHRDLKTISSDTLARLIQGEFDEQLGSQGGYEIIDCRYPYEFLGGHIRGAKNLYTRGQIQEAF---------------------PTLTSNQENRRIYVFHCEFSSERGPKLLRYLRSNDRSQHTHNYPALDYPELYILHNGYKEFFGLYSQLCQPSQYVPM 378          
BLAST of M-phase inducer phosphatase vs. Ensembl Fly
Match: twe (gene:FBgn0002673 transcript:FBtr0331445)

HSP 1 Score: 109.768 bits (273), Expect = 1.554e-25
Identity = 57/164 (34.76%), Postives = 86/164 (52.44%), Query Frame = 1
Query:  715 SSLNHLLIPEISNQTLSDLLVGRYSCYLS---DYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISM 1197
            + + H  +  IS+ TL+ L+ G +   L     Y IIDCR+PYE+ GGHI  + N+YT  Q+ + F                     P  + +  + + ++F+CEFSS RGPKL   LR  D+  +  + P + +P +Y+LH GY EFF  Y +LC P  Y+ M
Sbjct:  236 TGIRHRDLKTISSDTLARLIQGEFDEQLGSQGGYEIIDCRYPYEFLGGHIRGAKNLYTRGQIQEAF---------------------PTLTSNQENRRIYVFHCEFSSERGPKLLRYLRSNDRSQHTHNYPALDYPELYILHNGYKEFFGLYSQLCQPSQYVPM 378          
BLAST of M-phase inducer phosphatase vs. Ensembl Fly
Match: twe (gene:FBgn0002673 transcript:FBtr0331446)

HSP 1 Score: 109.768 bits (273), Expect = 1.554e-25
Identity = 57/164 (34.76%), Postives = 86/164 (52.44%), Query Frame = 1
Query:  715 SSLNHLLIPEISNQTLSDLLVGRYSCYLS---DYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISM 1197
            + + H  +  IS+ TL+ L+ G +   L     Y IIDCR+PYE+ GGHI  + N+YT  Q+ + F                     P  + +  + + ++F+CEFSS RGPKL   LR  D+  +  + P + +P +Y+LH GY EFF  Y +LC P  Y+ M
Sbjct:  236 TGIRHRDLKTISSDTLARLIQGEFDEQLGSQGGYEIIDCRYPYEFLGGHIRGAKNLYTRGQIQEAF---------------------PTLTSNQENRRIYVFHCEFSSERGPKLLRYLRSNDRSQHTHNYPALDYPELYILHNGYKEFFGLYSQLCQPSQYVPM 378          
BLAST of M-phase inducer phosphatase vs. Ensembl Zebrafish
Match: cdc25d (cell division cycle 25 homolog d [Source:ZFIN;Acc:ZDB-GENE-090313-74])

HSP 1 Score: 131.724 bits (330), Expect = 3.075e-33
Identity = 68/167 (40.72%), Postives = 98/167 (58.68%), Query Frame = 1
Query:  745 ISNQTLSDLLVGRYSCYLSDYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQ-STQPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISMKQTRYALRSPINPYL 1242
            IS QT++ L+ G++   + D++I+DCR+PYEY GGHI  ++N+YT  Q+ Q   Q S Q  +           +S    E+    K  IF+CEFSS RGP L + LR LD+  N+   P + +P +Y+L GGY  F   YP+LC P GY+SM+Q  Y  R  +N +L
Sbjct:  204 ISAQTVASLIRGQFGSAVEDFLIVDCRYPYEYQGGHIKGAVNLYTEHQVQQVLHQASAQVSVSTSRLCGRSASDSLPEDEESPSRKLIIFHCEFSSERGPHLCQYLRRLDRCVNV--YPSLHYPELYLLLGGYKHFHASYPDLCDPCGYVSMRQREY--REQLNSFL 366          
BLAST of M-phase inducer phosphatase vs. Ensembl Zebrafish
Match: cdc25b (cell division cycle 25B [Source:ZFIN;Acc:ZDB-GENE-000330-5])

HSP 1 Score: 95.1301 bits (235), Expect = 3.230e-20
Identity = 54/156 (34.62%), Postives = 82/156 (52.56%), Query Frame = 1
Query:  733 LIPEISNQTLSDLLVGRYSCYLSDYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQST-QPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISM 1197
            + PEI  + +S    G++   +    +IDCR+PYEY+GGHI  ++N++   Q+  YF +S   PD  +  + VL                  IF+CEFSS RGP++   +R  D+  N    P + +P +Y+L GGY EFF  +  +C PQ Y  M
Sbjct:  398 ITPEIMVKAMS----GQFQDLVERLFVIDCRYPYEYEGGHIKGALNLHQEDQIEDYFLRSPILPDCPK--KRVL-----------------LIFHCEFSSERGPRMCRYVRERDRFVN--EYPNLHYPELYILKGGYKEFFQIHKAICEPQMYRPM 528          
BLAST of M-phase inducer phosphatase vs. Ensembl Xenopus
Match: cdc25c (cell division cycle 25C [Source:NCBI gene;Acc:100124300])

HSP 1 Score: 113.235 bits (282), Expect = 5.367e-26
Identity = 59/151 (39.07%), Postives = 84/151 (55.63%), Query Frame = 1
Query:  745 ISNQTLSDLLVGRYSCYLSDYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISM 1197
            I+ +TL+ L+ G +S  + +  IIDCR+PYEYDGGHI  ++N++   ++  YF +  QP      Q  L                  +F+CEFSS RGPK+   LR  D+  N    P + +P +Y+L GGY +FF +Y ELC PQGY  M
Sbjct:  385 ITAETLAALIHGDFSSLVENVFIIDCRYPYEYDGGHIKGALNLHRQEEVTDYFLK--QPLAPSVAQKRL----------------IIVFHCEFSSERGPKMCRFLREEDRARN--EYPGLYYPELYLLKGGYKDFFPEYKELCEPQGYCPM 515          
BLAST of M-phase inducer phosphatase vs. Ensembl Xenopus
Match: cdc25c (cell division cycle 25C [Source:NCBI gene;Acc:100124300])

HSP 1 Score: 113.235 bits (282), Expect = 6.158e-26
Identity = 59/151 (39.07%), Postives = 84/151 (55.63%), Query Frame = 1
Query:  745 ISNQTLSDLLVGRYSCYLSDYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISM 1197
            I+ +TL+ L+ G +S  + +  IIDCR+PYEYDGGHI  ++N++   ++  YF +  QP      Q  L                  +F+CEFSS RGPK+   LR  D+  N    P + +P +Y+L GGY +FF +Y ELC PQGY  M
Sbjct:  395 ITAETLAALIHGDFSSLVENVFIIDCRYPYEYDGGHIKGALNLHRQEEVTDYFLK--QPLAPSVAQKRL----------------IIVFHCEFSSERGPKMCRFLREEDRARN--EYPGLYYPELYLLKGGYKDFFPEYKELCEPQGYCPM 525          
BLAST of M-phase inducer phosphatase vs. Ensembl Xenopus
Match: ENSXETT00000036492.1 (M-phase inducer phosphatase 3-like [Source:NCBI gene;Acc:100497395])

HSP 1 Score: 110.153 bits (274), Expect = 1.737e-25
Identity = 64/167 (38.32%), Postives = 84/167 (50.30%), Query Frame = 1
Query:  697 LPIMRESSLNHLLIPEISNQTLSDLLVGRYSCYLSDYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISM 1197
            LP+ R     H  +  IS  TL+ LL G Y   +  Y I+DCR+PYEY GGHI  + N+Y    +   F               LK    P S      T   IF+CEFSS R PKL   LR LD+  N    P + +P +Y+L GGY EF+ K+   C P+GY++M
Sbjct:  226 LPLERGK---HQELKYISCTTLARLLRGGYQDVVQQYQIVDCRYPYEYAGGHIKGAYNLYKEEHISDTF---------------LKNATHPKS------TTLLIFHCEFSSERAPKLCRLLRNLDR--NANRYPHLHYPELYILKGGYKEFYEKFKGFCEPRGYVNM 366          
BLAST of M-phase inducer phosphatase vs. Ensembl Xenopus
Match: man2b1 (mannosidase, alpha, class 2B, member 1 [Source:Xenbase;Acc:XB-GENE-958698])

HSP 1 Score: 109.383 bits (272), Expect = 8.151e-25
Identity = 58/160 (36.25%), Postives = 89/160 (55.62%), Query Frame = 1
Query:  718 SLNHLLIPEISNQTLSDLLVGRYSCYLSDYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISM 1197
            S  H  +  I+ + +  +L GR+  ++   +IIDCR+PYEY+GGHI  +IN++  ++  +YF ++  P M    + V+                  IF+CEFSS RGP++ + LR  D+  N    P++ +P +Y+LHGGY EFF K    CTPQ Y  M
Sbjct:  354 SGRHQELKYITPELMVLILNGRFDPFIERCVIIDCRYPYEYEGGHIQGAINLHMEQEAEEYFLKN--PVMSNGSKRVI-----------------LIFHCEFSSERGPRMCKFLREKDRDRN--EYPQLYYPELYILHGGYKEFFQKCKTYCTPQTYRPM 492          
BLAST of M-phase inducer phosphatase vs. Ensembl Xenopus
Match: man2b1 (mannosidase, alpha, class 2B, member 1 [Source:Xenbase;Acc:XB-GENE-958698])

HSP 1 Score: 109.383 bits (272), Expect = 8.867e-25
Identity = 58/160 (36.25%), Postives = 89/160 (55.62%), Query Frame = 1
Query:  718 SLNHLLIPEISNQTLSDLLVGRYSCYLSDYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISM 1197
            S  H  +  I+ + +  +L GR+  ++   +IIDCR+PYEY+GGHI  +IN++  ++  +YF ++  P M    + V+                  IF+CEFSS RGP++ + LR  D+  N    P++ +P +Y+LHGGY EFF K    CTPQ Y  M
Sbjct:  333 SGRHQELKYITPELMVLILNGRFDPFIERCVIIDCRYPYEYEGGHIQGAINLHMEQEAEEYFLKN--PVMSNGSKRVI-----------------LIFHCEFSSERGPRMCKFLREKDRDRN--EYPQLYYPELYILHGGYKEFFQKCKTYCTPQTYRPM 471          
BLAST of M-phase inducer phosphatase vs. Ensembl Mouse
Match: Cdc25b (cell division cycle 25B [Source:MGI Symbol;Acc:MGI:99701])

HSP 1 Score: 112.079 bits (279), Expect = 1.072e-25
Identity = 56/156 (35.90%), Postives = 85/156 (54.49%), Query Frame = 1
Query:  745 ISNQTLSDLLVGRYSCYLSDYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISMKQTRY 1212
            IS +T+  LL G++S  +  ++I+DCR+PYEY+GGHI N++N+   R    +  Q  +P M   L   + L                IF+CEFSS RGP++   +R  D+ +N    P + +P +Y+L GGY EFF ++P  C PQ Y  M    +
Sbjct:  385 ISPETMVALLTGKFSNIVEKFVIVDCRYPYEYEGGHIKNAVNLPLERDAETFLLQ--RPIMPCSLDKRIIL----------------IFHCEFSSERGPRMCRFIRERDRAAN--DYPSLYYPEMYILKGGYKEFFPQHPNFCEPQDYRPMNHEAF 520          
BLAST of M-phase inducer phosphatase vs. Ensembl Mouse
Match: Cdc25b (cell division cycle 25B [Source:MGI Symbol;Acc:MGI:99701])

HSP 1 Score: 112.079 bits (279), Expect = 1.179e-25
Identity = 56/156 (35.90%), Postives = 85/156 (54.49%), Query Frame = 1
Query:  745 ISNQTLSDLLVGRYSCYLSDYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISMKQTRY 1212
            IS +T+  LL G++S  +  ++I+DCR+PYEY+GGHI N++N+   R    +  Q  +P M   L   + L                IF+CEFSS RGP++   +R  D+ +N    P + +P +Y+L GGY EFF ++P  C PQ Y  M    +
Sbjct:  411 ISPETMVALLTGKFSNIVEKFVIVDCRYPYEYEGGHIKNAVNLPLERDAETFLLQ--RPIMPCSLDKRIIL----------------IFHCEFSSERGPRMCRFIRERDRAAN--DYPSLYYPEMYILKGGYKEFFPQHPNFCEPQDYRPMNHEAF 546          
BLAST of M-phase inducer phosphatase vs. Ensembl Mouse
Match: Cdc25c (cell division cycle 25C [Source:MGI Symbol;Acc:MGI:88350])

HSP 1 Score: 106.301 bits (264), Expect = 3.682e-24
Identity = 54/151 (35.76%), Postives = 86/151 (56.95%), Query Frame = 1
Query:  745 ISNQTLSDLLVGRYSCYLSDYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISM 1197
            IS  T++ LL G++   +  + IIDCR+PYEY GGHI  ++N+++ +++ ++F +  +P +  D+Q  +                  +F CEFSS RGP++   LR  D+   L   P + +P +Y+L GGY +FF +Y ELC PQ Y  M
Sbjct:  278 ISPDTVAALLSGKFQSVIERFYIIDCRYPYEYLGGHILGALNLHSQKELHEFFLR--KPVVPLDIQKRV----------------IIVFLCEFSSERGPRMCRSLREKDR--ALNQYPALYYPELYILKGGYRDFFPEYMELCDPQSYCPM 408          
BLAST of M-phase inducer phosphatase vs. Ensembl Mouse
Match: Cdc25a (cell division cycle 25A [Source:MGI Symbol;Acc:MGI:103198])

HSP 1 Score: 105.531 bits (262), Expect = 1.272e-23
Identity = 50/156 (32.05%), Postives = 87/156 (55.77%), Query Frame = 1
Query:  745 ISNQTLSDLLVGRYSCYLSDYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISMKQTRY 1212
            IS + ++ +L G+++  + +++IIDCR+PYEY+GGHI  ++N++   ++  +  ++  P +  D + V+                  +F+CEFSS RGP++   +R  D+L N    P++ +P +YVL GGY EFF+K    C P  Y  M    +
Sbjct:  350 ISPEIMASVLNGKFAGLIKEFVIIDCRYPYEYEGGHIKGAVNLHMEEEVEDFLLKN--PIVPTDGKRVI-----------------VVFHCEFSSERGPRMCRYVRERDRLGN--EYPKLHYPELYVLKGGYKEFFLKCQSHCEPPSYRPMHHEDF 484          
BLAST of M-phase inducer phosphatase vs. Ensembl Mouse
Match: Cdc25a (cell division cycle 25A [Source:MGI Symbol;Acc:MGI:103198])

HSP 1 Score: 100.138 bits (248), Expect = 3.149e-22
Identity = 46/138 (33.33%), Postives = 82/138 (59.42%), Query Frame = 1
Query:  745 ISNQTLSDLLVGRYSCYLSDYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIK 1158
            IS + ++ +L G+++  + +++IIDCR+PYEY+GGHI  ++N++   ++  +  ++  P +  D + V+                  +F+CEFSS RGP++   +R  D+L N    P++ +P +YVL GGY EFF+K
Sbjct:  289 ISPEIMASVLNGKFAGLIKEFVIIDCRYPYEYEGGHIKGAVNLHMEEEVEDFLLKN--PIVPTDGKRVI-----------------VVFHCEFSSERGPRMCRYVRERDRLGN--EYPKLHYPELYVLKGGYKEFFLK 405          
BLAST of M-phase inducer phosphatase vs. UniProt/SwissProt
Match: sp|P20483|MPIP_DROME (M-phase inducer phosphatase OS=Drosophila melanogaster OX=7227 GN=stg PE=1 SV=2)

HSP 1 Score: 124.02 bits (310), Expect = 4.037e-29
Identity = 64/172 (37.21%), Postives = 94/172 (54.65%), Query Frame = 1
Query:  697 LPIMRESSLNHLLIPEISNQTLSDLLVGRYSCYLSDYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISMKQTRY 1212
            LP+M      H  +  IS++T++ LL G +S  ++ Y IIDCR+PYE++GGHI  + N+YT  Q++  F           L       +   ++E        IF+CEFSS RGPK++  LR LD+  N  + P + +P +Y+LH GY EFF  + ELC P  Y +M    Y
Sbjct:  287 LPLMEG---RHRDLKSISSETVARLLKGEFSDKVASYRIIDCRYPYEFEGGHIEGAKNLYTTEQILDEF-----------LTVQQTELQQQQNAESGHKRNIIIFHCEFSSERGPKMSRFLRNLDRERNTNAYPALHYPEIYLLHNGYKEFFESHVELCEPHAYRTMLDPAY 444          
BLAST of M-phase inducer phosphatase vs. UniProt/SwissProt
Match: sp|P30308|MPI1A_XENLA (M-phase inducer phosphatase 1-A OS=Xenopus laevis OX=8355 GN=cdc25-1-a PE=2 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 2.411e-25
Identity = 60/151 (39.74%), Postives = 85/151 (56.29%), Query Frame = 1
Query:  745 ISNQTLSDLLVGRYSCYLSDYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISM 1197
            I+ +TL+ L+ G ++  +  + IIDCR+PYEYDGGHI ++ N++   ++  YF Q  QP     +Q  L                  IF+CEFSS RGPK+   LR  D+ SN    P + +P +Y+L GGY +FF +Y ELC PQ Y  M
Sbjct:  385 ITGETLAALMHGDFNSLVEKFFIIDCRYPYEYDGGHIKSAFNLHRQEEVTDYFLQ--QPLTPLMVQKRL----------------IIIFHCEFSSERGPKMCRFLREEDRASN--DYPSLYYPELYLLKGGYKDFFPEYKELCEPQSYCPM 515          
BLAST of M-phase inducer phosphatase vs. UniProt/SwissProt
Match: sp|P30310|MPIP2_XENLA (M-phase inducer phosphatase 2 OS=Xenopus laevis OX=8355 GN=cdc25-2 PE=2 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 4.363e-25
Identity = 60/151 (39.74%), Postives = 85/151 (56.29%), Query Frame = 1
Query:  745 ISNQTLSDLLVGRYSCYLSDYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISM 1197
            I+ +TL+ L+ G ++  +  + IIDCR+PYEYDGGHI ++ N++   ++  YF Q  QP     +Q  L                  IF+CEFSS RGPK+   LR  D+ SN    P + +P +Y+L GGY +FF +Y ELC PQ Y  M
Sbjct:  434 ITGETLAALMHGDFNSLVEKFFIIDCRYPYEYDGGHIKSAFNLHRQEEVTDYFLQ--QPLTPLMVQKRL----------------IIIFHCEFSSERGPKMCRFLREEDRASN--DYPSLYYPELYLLKGGYKDFFPEYKELCEPQSYCPM 564          
BLAST of M-phase inducer phosphatase vs. UniProt/SwissProt
Match: sp|P30311|MPIP3_XENLA (M-phase inducer phosphatase 3 OS=Xenopus laevis OX=8355 GN=cdc25-3 PE=1 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 6.809e-25
Identity = 60/151 (39.74%), Postives = 84/151 (55.63%), Query Frame = 1
Query:  745 ISNQTLSDLLVGRYSCYLSDYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISM 1197
            I+ +TL+ L+ G ++  +  + IIDCR+PYEYDGGHI ++ N++   ++  YF Q  QP      Q  L                  IF+CEFSS RGPK+   LR  D+ SN    P + +P +Y+L GGY +FF +Y ELC PQ Y  M
Sbjct:  404 ITGETLAALMHGDFNSLVEKFFIIDCRYPYEYDGGHIKSAFNLHRQDEVTDYFLQ--QPLTPLMAQKRL----------------IIIFHCEFSSERGPKMCRSLREEDRASN--DYPSLYYPELYLLKGGYKDFFPEYKELCEPQSYCPM 534          
BLAST of M-phase inducer phosphatase vs. UniProt/SwissProt
Match: sp|P30306|MPIP2_MOUSE (M-phase inducer phosphatase 2 OS=Mus musculus OX=10090 GN=Cdc25b PE=1 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 8.248e-25
Identity = 56/156 (35.90%), Postives = 85/156 (54.49%), Query Frame = 1
Query:  745 ISNQTLSDLLVGRYSCYLSDYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISMKQTRY 1212
            IS +T+  LL G++S  +  ++I+DCR+PYEY+GGHI N++N+   R    +  Q  +P M   L   + L                IF+CEFSS RGP++   +R  D+ +N    P + +P +Y+L GGY EFF ++P  C PQ Y  M    +
Sbjct:  411 ISPETMVALLTGKFSNIVEKFVIVDCRYPYEYEGGHIKNAVNLPLERDAETFLLQ--RPIMPCSLDKRIIL----------------IFHCEFSSERGPRMCRFIRERDRAAN--DYPSLYYPEMYILKGGYKEFFPQHPNFCEPQDYRPMNHEAF 546          
BLAST of M-phase inducer phosphatase vs. TrEMBL
Match: A0A172RVS8 (CDC25-2 protein (Fragment) OS=Schmidtea mediterranea OX=79327 GN=CDC25-2 PE=2 SV=2)

HSP 1 Score: 555.058 bits (1429), Expect = 0.000e+0
Identity = 266/267 (99.63%), Postives = 266/267 (99.63%), Query Frame = 1
Query:  643 LRQRHQRSYQKISNQLSPLPIMRESSLNHLLIPEISNQTLSDLLVGRYSCYLSDYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISMKQTRYALRSPINPYLMANSPTKHGNLTVESDSVRVPNVLTPKLTDEVTCTLYRKQQINCQRQLRCDIKRLVDIVQTITKNND 1443
            LRQRHQR YQKISNQLSPLPIMRESSLNHLLIPEISNQTLSDLLVGRYSCYLSDYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISMKQTRYALRSPINPYLMANSPTKHGNLTVESDSVRVPNVLTPKLTDEVTCTLYRKQQINCQRQLRCDIKRLVDIVQTITKNND
Sbjct:    1 LRQRHQRRYQKISNQLSPLPIMRESSLNHLLIPEISNQTLSDLLVGRYSCYLSDYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISMKQTRYALRSPINPYLMANSPTKHGNLTVESDSVRVPNVLTPKLTDEVTCTLYRKQQINCQRQLRCDIKRLVDIVQTITKNND 267          
BLAST of M-phase inducer phosphatase vs. TrEMBL
Match: A0A224YSX0 (M-phase inducer phosphatase OS=Rhipicephalus zambeziensis OX=60191 PE=4 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 3.649e-32
Identity = 63/152 (41.45%), Postives = 93/152 (61.18%), Query Frame = 1
Query:  757 TLSDLLVGRYSCYLSDYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISMKQTRY 1212
            TL+D+L G+Y   + DY +IDCR+P+E+DGGHI N+INVY+   +M  F + +   +  D + +L                  +F+CEFSS RGPKL+  LR +D+  N E  P +K+P +YVL GGY  F+ ++ +LCTPQGY+ M+   Y
Sbjct:  200 TLADVLQGKYDSVVDDYTVIDCRYPFEFDGGHIKNAINVYSSEHLMSEFLEKSA--LTPDSRRIL------------------VFHCEFSSERGPKLSRLLREMDRQINNEQYPALKYPEIYVLEGGYKAFYEEFQDLCTPQGYVPMRHKDY 331          
BLAST of M-phase inducer phosphatase vs. TrEMBL
Match: A0A4W4EKQ8 (Cell division cycle 25 homolog d OS=Electrophorus electricus OX=8005 PE=4 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 1.088e-31
Identity = 68/173 (39.31%), Postives = 107/173 (61.85%), Query Frame = 1
Query:  697 LPIMRESSLNHLLIPEISNQTLSDLLVGRYSCYLSDYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNSSEDDFD-TKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISMKQTRY 1212
            LP+ R   + H  +  +S++T++ L+ G++S  + D++IIDCR+PYEY+GGHI  ++N+YT  Q+ Q F Q++   ++ + +         +SS       K  +F+CEFSS RGP+LA  LRGLD+  N    P + +P VY+L GGYN F+ + PELC P+GY+ M    +
Sbjct:  166 LPVER---VEHRDLHCVSSETVAALIRGQFSDVVEDFLIIDCRYPYEYNGGHIKGAVNLYTESQIQQAFLQASAGQVQINEEASSPSSSPSSSSSSSQSLRKLLVFHCEFSSERGPRLAHYLRGLDRALNALLYPVLLYPEVYLLQGGYNSFYTQCPELCVPRGYVHMHHGEF 335          
BLAST of M-phase inducer phosphatase vs. TrEMBL
Match: A0A4W4EKU8 (Cell division cycle 25 homolog d OS=Electrophorus electricus OX=8005 PE=4 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 1.172e-31
Identity = 68/173 (39.31%), Postives = 107/173 (61.85%), Query Frame = 1
Query:  697 LPIMRESSLNHLLIPEISNQTLSDLLVGRYSCYLSDYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNSSEDDFD-TKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISMKQTRY 1212
            LP+ R   + H  +  +S++T++ L+ G++S  + D++IIDCR+PYEY+GGHI  ++N+YT  Q+ Q F Q++   ++ + +         +SS       K  +F+CEFSS RGP+LA  LRGLD+  N    P + +P VY+L GGYN F+ + PELC P+GY+ M    +
Sbjct:  186 LPVER---VEHRDLHCVSSETVAALIRGQFSDVVEDFLIIDCRYPYEYNGGHIKGAVNLYTESQIQQAFLQASAGQVQINEEASSPSSSPSSSSSSSQSLRKLLVFHCEFSSERGPRLAHYLRGLDRALNALLYPVLLYPEVYLLQGGYNSFYTQCPELCVPRGYVHMHHGEF 355          
BLAST of M-phase inducer phosphatase vs. TrEMBL
Match: A0A172RVQ2 (CDC25-3 protein (Fragment) OS=Schmidtea mediterranea OX=79327 GN=CDC25-3 PE=2 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 3.187e-30
Identity = 76/169 (44.97%), Postives = 107/169 (63.31%), Query Frame = 1
Query:  697 LPIMRESSLNHLLIPEISNQTLSDLLVGRYSCYLSDYI-IIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDL-QHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISM 1197
            LPI  E++  HL IP+IS+ TL+ L+ G ++  L++ I I DCRFPYEY  GHI NS NV+  +QM+    Q+  P  E  L +H        N   DD     ++FYCE+SS+R P LA+C+R LD++ N+++   +  P++Y+L GGY EFF  YP LC PQGY+SM
Sbjct:   66 LPITTETT-GHLFIPQISSLTLAKLISGNHT--LNNPIEIFDCRFPYEYSAGHIVNSKNVHN-KQML---LQTLFPISESTLSRHSTDDALKENLKNDD---TIYVFYCEYSSYRAPDLAQCIRELDRIVNVQA-GNLFIPNIYILTGGYREFFYSYPTLCCPQGYMSM 223          
BLAST of M-phase inducer phosphatase vs. Ensembl Cavefish
Match: cdc25d (cell division cycle 25 homolog d [Source:ZFIN;Acc:ZDB-GENE-090313-74])

HSP 1 Score: 95.1301 bits (235), Expect = 2.655e-21
Identity = 67/212 (31.60%), Postives = 103/212 (48.58%), Query Frame = 1
Query:  745 ISNQTLSDLLVGRYSCYLSDYIIIDCRFPYEYDGGHI--SNSINVYTCRQMMQYFCQS-----TQPDMEQDLQHVLKLFESPNSS----------------------EDDFDT---KAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISMKQTRYALRSPINPYLMANSPTKHGNLTVE 1284
            +S QT++ L+  ++S  + D++IIDCR+PYE+ GGHI    ++N+YT  Q+ Q F QS     T P  +QD +       SP +                       +D   +   K  +F+CEFSS RGP+  + LR LD+  N ++ P + +P +Y+L GGY  F+  YP+LC P  Y+          S I     + S      +T E
Sbjct:   87 VSAQTVAGLITAQFSAVVEDFLIIDCRYPYEFKGGHIKLQGAVNLYTEHQIHQAFLQSFSNFQTSPGAQQDPR-------SPEAGAVGGVQGPGSGGSRSSAVSGEIKDGGSSCPRKLIVFHCEFSSERGPRC-QYLRELDRAVNTQNYPLLLYPELYLLQGGYKHFYTHYPDLCDPCNYVHASSGLQGAASTIQQEKGSASQQTANQITAE 290          
BLAST of M-phase inducer phosphatase vs. Ensembl Cavefish
Match: CDC25B (cell division cycle 25B [Source:HGNC Symbol;Acc:HGNC:1726])

HSP 1 Score: 92.8189 bits (229), Expect = 1.535e-19
Identity = 52/171 (30.41%), Postives = 85/171 (49.71%), Query Frame = 1
Query:  700 PIMRESSLNHLLIPEISNQTLSDLLVGRYSCYLSDYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISMKQTRY 1212
            P +   S  H  +  I+ + +   + G++S  +    +IDCR+PYE++GGHI  ++N++   Q+   F   +QP + Q     + L                +F+CEFSS RGP++   +R  D+  +L   P + +P +YVL GGY +FF  +   C PQ Y  M    Y
Sbjct:  376 PALPTVSGKHQDLKYITPEVMVAAMSGQFSDVVERLFVIDCRYPYEFEGGHIKGALNLHLEEQIEDRFF--SQPFLPQSPDKRVLL----------------VFHCEFSSERGPRMCRFVRERDR--DLNEYPNLHYPELYVLKGGYKDFFPLHKRECEPQDYRPMVHEDY 526          
BLAST of M-phase inducer phosphatase vs. Ensembl Yeast
Match: MIH1 (Protein tyrosine phosphatase involved in cell cycle control; regulates the phosphorylation state of Cdc28p; homolog of S. pombe cdc25 [Source:SGD;Acc:S000004639])

HSP 1 Score: 103.99 bits (258), Expect = 5.288e-24
Identity = 57/156 (36.54%), Postives = 85/156 (54.49%), Query Frame = 1
Query:  733 LIPEISNQTLSDLLVGRY-SCYLSDYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISM 1197
              P IS +TL ++L       + +   IIDCRF YEY GGHI NS+N+++ R  ++Y             + + K+  S  S+ +   T   I +CEFSS RGP LA  LR  D++ N +  P++ +P + +L GGY   F  +PELC P+ Y+ M
Sbjct:  240 FFPRISPETLKNILQNNMCESFYNSCRIIDCRFEYEYTGGHIINSVNIHS-RDELEY-------------EFIHKVLHSDTSNNNTLPT-LLIIHCEFSSHRGPSLASHLRNCDRIINQDHYPKLFYPDILILDGGYKAVFDNFPELCYPRQYVGM 380          
BLAST of M-phase inducer phosphatase vs. Ensembl Nematostella
Match: EDO39841 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8Z1])

HSP 1 Score: 103.605 bits (257), Expect = 1.055e-25
Identity = 56/157 (35.67%), Postives = 86/157 (54.78%), Query Frame = 1
Query:  745 ISNQTLSDLLVGRYSCYLSDYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISMKQTRYA 1215
            IS +T++ L+ G Y   + +Y IIDCR+P+E+DGGH+  +IN+YT  +M++ F  +  P  ++  + V+                  IF+CEFSS RGP +   LR  D+  +  S P + +P +Y+L GGY  FF    E C PQ Y+ M    Y+
Sbjct:   36 ISPETVTKLINGDYKDEIDEYYIIDCRYPFEFDGGHVKGAINIYTKDEMLKQFIDT--PKCKEGKRVVV------------------IFHCEFSSKRGPDMCRFLRNRDRDIHRPSYPSLFYPELYLLDGGYKNFFNTCKEHCEPQNYVLMLDENYS 172          
BLAST of M-phase inducer phosphatase vs. Ensembl Medaka
Match: ENSORLT00000022793.2 (cell division cycle 25B [Source:NCBI gene;Acc:101168663])

HSP 1 Score: 91.6633 bits (226), Expect = 3.345e-19
Identity = 47/151 (31.13%), Postives = 78/151 (51.66%), Query Frame = 1
Query:  745 ISNQTLSDLLVGRYSCYLSDYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISM 1197
            I++  +   L G +   +   I+IDCR+PYE++GGHI  ++N +   Q+ ++               +L+    P+S E        +F+CEFSS RGP++   +R  D+   L   P++ +P +Y+L GGY +FF  +   C PQ Y  M
Sbjct:  407 ITSDMMVAALSGHFHEVVDQVIVIDCRYPYEFEGGHIKGALNFHLESQVEEF---------------LLRTPIVPSSPEKRV---VVVFHCEFSSERGPRMCRFIRERDRA--LNDYPKLHYPELYILKGGYKDFFPHFQAQCEPQAYRPM 537          
BLAST of M-phase inducer phosphatase vs. Planmine SMEST
Match: SMESG000054042.1 (SMESG000054042.1)

HSP 1 Score: 853.203 bits (2203), Expect = 0.000e+0
Identity = 455/459 (99.13%), Postives = 456/459 (99.35%), Query Frame = 1
Query:   67 FVEMNKRNSSHLATELKDSRKISKSLEVPDFDLCPSKLPDWDVSSLKTLSNSTIXXXXXXXXXXXXXMNLRSRRRCSINPFDLSSDCGDSDILEIKYSLRSKKRQLHXXXXXXXXXXXXFTSTVDGESNAWSQIDSYSMTGGDICNMYEFLDNVPNEKLMETIDKNKVHSSINEXXXXXXXXXXXXLAFCYELRQRHQRSYQKISNQLSPLPIMRESSLNHLLIPEISNQTLSDLLVGRYSCYLSDYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISMKQTRYALRSPINPYLMANSPTKHGNLTVESDSVRVPNVLTPKLTDEVTCTLYRKQQINCQRQLRCDIKRLVDIVQTITKNND 1443
             +EMNKRNSSHLATELKDSRKISKSLEVPDFDLCPSKLPDWDVSSLKTLSNSTIDSSRDSFGSNSSGMNLRSRRRCSINPFDLSSDCGDSDILEIKYSLRSKKRQLHSKSSSIINCNKN TSTVDGESNAWSQIDSYSMTGGDICNMYEFLDNVPNEKLMETIDKNKVHSSINESDCDDSDKKKPKLAFCYELRQRHQR YQKISNQLSPLPIMRESSLNHLLIPEISNQTLSDLLVGRYSCYLSDYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISMKQTRYALRSPINPYLMANSPTKHGNLTVESDSVRVPNVLTPKLTDEVTCTLYRKQQINCQRQLRCDIKRLVDIVQTITKNND
Sbjct:   15 ILEMNKRNSSHLATELKDSRKISKSLEVPDFDLCPSKLPDWDVSSLKTLSNSTIDSSRDSFGSNSSGMNLRSRRRCSINPFDLSSDCGDSDILEIKYSLRSKKRQLHSKSSSIINCNKNLTSTVDGESNAWSQIDSYSMTGGDICNMYEFLDNVPNEKLMETIDKNKVHSSINESDCDDSDKKKPKLAFCYELRQRHQRRYQKISNQLSPLPIMRESSLNHLLIPEISNQTLSDLLVGRYSCYLSDYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISMKQTRYALRSPINPYLMANSPTKHGNLTVESDSVRVPNVLTPKLTDEVTCTLYRKQQINCQRQLRCDIKRLVDIVQTITKNND 473          
BLAST of M-phase inducer phosphatase vs. Planmine SMEST
Match: SMESG000065054.1 (SMESG000065054.1)

HSP 1 Score: 158.688 bits (400), Expect = 4.879e-43
Identity = 83/180 (46.11%), Postives = 124/180 (68.89%), Query Frame = 1
Query:  697 LPIMRESSLNHLLIPEISNQTLSDLLVGRYSCYLSDYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFC---QS-TQPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISMKQTRYALRS 1224
            LPI  +S+ N +LIPEIS+ TL+++L G ++   ++  I DCRFPYEY GGHI+N+INVYT +Q++Q      QS T   +E+D+ ++ K  +         D   ++FYCEFSS+R PK+A+CLRGLD+L++  S   +  P++YVL+ GY +F+ +YP+ C P+ Y+SMKQTRY LR+
Sbjct:  173 LPIASDSTHN-VLIPEISSLTLANILSGNHTL-DNNITIFDCRFPYEYSGGHIANAINVYTSQQLLQILFPIKQSCTDRKLEEDISNLNKKLKR--------DNTIYVFYCEFSSYRAPKMAQCLRGLDRLAHCGSRD-LFIPNIYVLNAGYRDFYNEYPKFCFPRNYVSMKQTRYPLRN 341          
BLAST of M-phase inducer phosphatase vs. Planmine SMEST
Match: SMESG000065054.1 (SMESG000065054.1)

HSP 1 Score: 147.132 bits (370), Expect = 6.567e-39
Identity = 77/176 (43.75%), Postives = 116/176 (65.91%), Query Frame = 1
Query:  697 LPIMRESSLNHLLIPEISNQTLSDLLVGRYSCYLSDYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISMKQTRYALRS 1224
            LPI  +S+ N +LIPEIS+ TL+++L G ++   ++  I DCRFPYEY GGHI+N+IN  T R++            E+D+ ++ K  +         D   ++FYCEFSS+R PK+A+CLRGLD+L++  S   +  P++YVL+ GY +F+ +YP+ C P+ Y+SMKQTRY LR+
Sbjct:  173 LPIASDSTHN-VLIPEISSLTLANILSGNHTL-DNNITIFDCRFPYEYSGGHIANAINSCTDRKL------------EEDISNLNKKLKR--------DNTIYVFYCEFSSYRAPKMAQCLRGLDRLAHCGSRD-LFIPNIYVLNAGYRDFYNEYPKFCFPRNYVSMKQTRYPLRN 325          
BLAST of M-phase inducer phosphatase vs. Planmine SMEST
Match: SMESG000075488.1 (SMESG000075488.1)

HSP 1 Score: 125.946 bits (315), Expect = 8.407e-31
Identity = 64/171 (37.43%), Postives = 100/171 (58.48%), Query Frame = 1
Query:  724 NHLLIPEISNQTLSDLLVGRYSCYLSDYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQ-------------DLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISM 1197
            N + I E+S   ++ ++   ++     Y IIDCR+PYEYDGGH+  ++N+YT  Q++ Y   + Q D+E              DL + +   + PNSS   + T+AFIF+CEFSS RGP++A C+R +D+  N      + FP V+++  GY EF+ K+  LC+P GY+ M
Sbjct:  267 NDIKITEVSADFVAKIIENDFTSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLA-QNDLEYLKQPVENTEDSMVDLINTIINIKKPNSS---WKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYSKHKSLCSPCGYVKM 433          
BLAST of M-phase inducer phosphatase vs. Planmine SMEST
Match: SMESG000025390.1 (SMESG000025390.1)

HSP 1 Score: 110.538 bits (275), Expect = 1.879e-26
Identity = 59/173 (34.10%), Postives = 96/173 (55.49%), Query Frame = 1
Query:  706 MRESSLNHLLIPEISNQTLSDLLVGRYSCYLSDYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYF-------CQSTQPDMEQDLQHVLKL--FESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISM 1197
            + E + N + I +I    +  ++   Y+    +Y IID RFP+E++GGHI  ++N+YT   + QYF        QS + ++E  +++++ L  F S             IF+CEFSS R PK+AE LR +D+ +NL+  P + +P +++L GGY  F++   ELC P  Y  M
Sbjct:   92 ISEPTDNIITIEDIDVDRVKKIVENNYTIDGLNYCIIDSRFPFEFNGGHIIGAVNLYTPLDVFQYFFGPDQLKTQSDKDNLELVVRNIINLQKFSS---------NLNLIFHCEFSSARAPKMAEELRCIDRFANLDCYPHLFYPKIFILKGGYRAFYMNNKELCEPSSYRKM 255          
The following BLAST results are available for this feature:
BLAST of M-phase inducer phosphatase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CDC25C1.107e-2534.38cell division cycle 25C [Source:HGNC Symbol;Acc:HG... [more]
CDC25C1.107e-2534.38cell division cycle 25C [Source:HGNC Symbol;Acc:HG... [more]
CDC25C1.807e-2534.38cell division cycle 25C [Source:HGNC Symbol;Acc:HG... [more]
CDC25C1.926e-2534.38cell division cycle 25C [Source:HGNC Symbol;Acc:HG... [more]
CDC25C1.926e-2534.38cell division cycle 25C [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of M-phase inducer phosphatase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdc-25.25.428e-1934.76M-phase inducer phosphatase cdc-25.2 [Source:UniP... [more]
cdc-25.26.007e-1934.76M-phase inducer phosphatase cdc-25.2 [Source:UniP... [more]
cdc-25.26.039e-1934.76M-phase inducer phosphatase cdc-25.2 [Source:UniP... [more]
cdc-25.12.393e-1830.71M-phase inducer phosphatase cdc-25.1 [Source:UniP... [more]
cdc-25.12.393e-1830.71M-phase inducer phosphatase cdc-25.1 [Source:UniP... [more]
back to top
BLAST of M-phase inducer phosphatase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stg4.027e-3037.21gene:FBgn0003525 transcript:FBtr0085397[more]
stg4.027e-3037.21gene:FBgn0003525 transcript:FBtr0334867[more]
twe1.554e-2534.76gene:FBgn0002673 transcript:FBtr0331444[more]
twe1.554e-2534.76gene:FBgn0002673 transcript:FBtr0331445[more]
twe1.554e-2534.76gene:FBgn0002673 transcript:FBtr0331446[more]
back to top
BLAST of M-phase inducer phosphatase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cdc25d3.075e-3340.72cell division cycle 25 homolog d [Source:ZFIN;Acc:... [more]
cdc25b3.230e-2034.62cell division cycle 25B [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of M-phase inducer phosphatase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdc25c5.367e-2639.07cell division cycle 25C [Source:NCBI gene;Acc:1001... [more]
cdc25c6.158e-2639.07cell division cycle 25C [Source:NCBI gene;Acc:1001... [more]
ENSXETT00000036492.11.737e-2538.32M-phase inducer phosphatase 3-like [Source:NCBI ge... [more]
man2b18.151e-2536.25mannosidase, alpha, class 2B, member 1 [Source:Xen... [more]
man2b18.867e-2536.25mannosidase, alpha, class 2B, member 1 [Source:Xen... [more]
back to top
BLAST of M-phase inducer phosphatase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cdc25b1.072e-2535.90cell division cycle 25B [Source:MGI Symbol;Acc:MGI... [more]
Cdc25b1.179e-2535.90cell division cycle 25B [Source:MGI Symbol;Acc:MGI... [more]
Cdc25c3.682e-2435.76cell division cycle 25C [Source:MGI Symbol;Acc:MGI... [more]
Cdc25a1.272e-2332.05cell division cycle 25A [Source:MGI Symbol;Acc:MGI... [more]
Cdc25a3.149e-2233.33cell division cycle 25A [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of M-phase inducer phosphatase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P20483|MPIP_DROME4.037e-2937.21M-phase inducer phosphatase OS=Drosophila melanoga... [more]
sp|P30308|MPI1A_XENLA2.411e-2539.74M-phase inducer phosphatase 1-A OS=Xenopus laevis ... [more]
sp|P30310|MPIP2_XENLA4.363e-2539.74M-phase inducer phosphatase 2 OS=Xenopus laevis OX... [more]
sp|P30311|MPIP3_XENLA6.809e-2539.74M-phase inducer phosphatase 3 OS=Xenopus laevis OX... [more]
sp|P30306|MPIP2_MOUSE8.248e-2535.90M-phase inducer phosphatase 2 OS=Mus musculus OX=1... [more]
back to top
BLAST of M-phase inducer phosphatase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A172RVS80.000e+099.63CDC25-2 protein (Fragment) OS=Schmidtea mediterran... [more]
A0A224YSX03.649e-3241.45M-phase inducer phosphatase OS=Rhipicephalus zambe... [more]
A0A4W4EKQ81.088e-3139.31Cell division cycle 25 homolog d OS=Electrophorus ... [more]
A0A4W4EKU81.172e-3139.31Cell division cycle 25 homolog d OS=Electrophorus ... [more]
A0A172RVQ23.187e-3044.97CDC25-3 protein (Fragment) OS=Schmidtea mediterran... [more]
back to top
BLAST of M-phase inducer phosphatase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cdc25d2.655e-2131.60cell division cycle 25 homolog d [Source:ZFIN;Acc:... [more]
CDC25B1.535e-1930.41cell division cycle 25B [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of M-phase inducer phosphatase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of M-phase inducer phosphatase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
MIH15.288e-2436.54Protein tyrosine phosphatase involved in cell cycl... [more]
back to top
BLAST of M-phase inducer phosphatase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO398411.055e-2535.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of M-phase inducer phosphatase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000022793.23.345e-1931.13cell division cycle 25B [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of M-phase inducer phosphatase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000054042.10.000e+099.13SMESG000054042.1[more]
SMESG000065054.14.879e-4346.11SMESG000065054.1[more]
SMESG000065054.16.567e-3943.75SMESG000065054.1[more]
SMESG000075488.18.407e-3137.43SMESG000075488.1[more]
SMESG000025390.11.879e-2634.10SMESG000025390.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035864 ID=SMED30035864|Name=M-phase inducer phosphatase|organism=Schmidtea mediterranea sexual|type=transcript|length=1645bp
ATAATTCTAAATTTATTTAACGACCTAGAATATATTGAATAATCTCATTT
TATATTGAATTTTATTTTCGTTGAAATGAATAAAAGAAATTCAAGCCATC
TAGCTACAGAATTAAAAGATTCGAGAAAAATTTCTAAATCTCTGGAAGTT
CCTGATTTTGATTTATGTCCTTCAAAGTTGCCAGATTGGGATGTATCTAG
TTTGAAAACCTTGAGCAATTCCACGATAGATAGTTCTCGAGATTCATTTG
GATCAAACTCTAGTGGCATGAATTTACGAAGTCGTCGCCGCTGCTCTATT
AACCCGTTTGACTTGTCATCAGATTGTGGCGACAGCGATATTCTAGAAAT
CAAATATTCTCTGCGCAGTAAAAAGAGGCAATTACATTCGAAATCATCTT
CGATAATAAACTGTAATAAAAATTTCACGTCTACGGTTGATGGTGAGTCA
AATGCTTGGTCTCAAATTGATTCGTATTCCATGACAGGAGGGGATATTTG
TAACATGTATGAATTTCTGGACAATGTCCCCAATGAGAAATTAATGGAAA
CTATTGATAAAAATAAAGTTCATTCTTCAATTAATGAATCCGATTGCGAT
GACTCAGATAAAAAGAAACCAAAATTGGCGTTTTGTTATGAATTGAGACA
ACGGCACCAGCGAAGTTATCAAAAAATATCAAATCAACTGTCACCGTTAC
CCATAATGCGTGAATCGTCCTTGAATCATTTATTAATTCCCGAAATATCT
AATCAAACTCTTTCTGATTTGTTAGTCGGCCGATATTCGTGTTATTTATC
AGATTATATAATAATTGATTGTCGTTTCCCGTACGAATACGACGGTGGTC
ACATTAGCAACTCCATAAATGTGTACACTTGTCGACAAATGATGCAATAT
TTCTGTCAGTCAACTCAACCTGACATGGAGCAGGATCTCCAGCACGTATT
AAAGTTATTTGAATCTCCAAATTCTTCTGAAGATGATTTTGATACGAAAG
CTTTCATCTTTTACTGTGAATTCTCATCCTTTCGAGGACCTAAATTAGCT
GAATGCCTCCGAGGACTGGATAAGCTCTCTAATCTTGAGTCTCTCCCGAG
AGTAAAATTCCCTCATGTTTACGTTTTGCATGGAGGATATAATGAGTTTT
TTATTAAATATCCAGAATTATGTACTCCACAAGGATATATTAGTATGAAA
CAGACGCGATATGCTTTACGATCACCAATAAATCCGTATTTGATGGCCAA
TTCTCCGACCAAGCATGGTAATCTCACTGTTGAATCCGACAGTGTTAGAG
TGCCCAACGTCCTCACTCCGAAACTCACCGATGAAGTTACTTGTACATTA
TATAGGAAGCAACAGATAAACTGCCAGAGACAATTACGATGTGATATTAA
GCGTCTTGTTGATATAGTGCAAACGATAACAAAAAACAATGACATTATTC
GTTTTTTTAAGTTTGAAGAAATATTTTGAAGTTTTTCATCTCTATAAATG
AATAAAGTTTTAGGTTTATTATTTCAAGTTGGTTTGCGTCCATACTTTGT
TTTTATTATAAATACATAATTTATTTCCATATGAAATGATTTTAGTTATT
AATTTTATTTAATTTGTATAAATGGTTTCTCGTTTATGAGTATGT
back to top

protein sequence of SMED30035864-orf-1

>SMED30035864-orf-1 ID=SMED30035864-orf-1|Name=SMED30035864-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=468bp
MNKRNSSHLATELKDSRKISKSLEVPDFDLCPSKLPDWDVSSLKTLSNST
IDSSRDSFGSNSSGMNLRSRRRCSINPFDLSSDCGDSDILEIKYSLRSKK
RQLHSKSSSIINCNKNFTSTVDGESNAWSQIDSYSMTGGDICNMYEFLDN
VPNEKLMETIDKNKVHSSINESDCDDSDKKKPKLAFCYELRQRHQRSYQK
ISNQLSPLPIMRESSLNHLLIPEISNQTLSDLLVGRYSCYLSDYIIIDCR
FPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQDLQHVLKLFESPNS
SEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYV
LHGGYNEFFIKYPELCTPQGYISMKQTRYALRSPINPYLMANSPTKHGNL
TVESDSVRVPNVLTPKLTDEVTCTLYRKQQINCQRQLRCDIKRLVDIVQT
ITKNNDIIRFFKFEEIF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:1902751positive regulation of cell cycle G2/M phase transition
GO:0006470protein dephosphorylation
GO:0000087mitotic M phase
GO:0000086G2/M transition of mitotic cell cycle
GO:0000278mitotic cell cycle
GO:0007030Golgi organization
GO:0007049cell cycle
GO:0007067mitotic nuclear division
GO:0007099centriole replication
GO:0007346regulation of mitotic cell cycle
GO:0007369gastrulation
GO:0007422peripheral nervous system development
GO:0007424open tracheal system development
GO:0007488histoblast morphogenesis
GO:0007498mesoderm development
GO:0008283cell proliferation
GO:0008284positive regulation of cell proliferation
GO:0035335peptidyl-tyrosine dephosphorylation
GO:0045792negative regulation of cell size
GO:0045930negative regulation of mitotic cell cycle
GO:0045931positive regulation of mitotic cell cycle
GO:0045977positive regulation of mitotic cell cycle, embryonic
GO:0046331lateral inhibition
GO:0051301cell division
GO:0060305regulation of cell diameter
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
PLANA:0000228male germ cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036873Rhodanese-like_dom_sf
IPR018247EF_Hand_1_Ca_BS
IPR000751MPI_Phosphatase
IPR001763Rhodanese-like_dom
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005634nucleus
GO:0005694chromosome
Vocabulary: molecular function
TermDefinition
GO:0004725protein tyrosine phosphatase activity
GO:0004721phosphoprotein phosphatase activity
GO:0008138protein tyrosine/serine/threonine phosphatase activity
GO:0016787hydrolase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000751M-phase inducer phosphatasePRINTSPR00716MPIPHPHTASEcoord: 246..266
score: 66.95
coord: 224..244
score: 25.77
IPR001763Rhodanese-like domainSMARTSM00450rhod_4coord: 225..364
e-value: 7.1E-10
score: 48.8
IPR001763Rhodanese-like domainPFAMPF00581Rhodanesecoord: 244..358
e-value: 4.5E-12
score: 46.4
IPR001763Rhodanese-like domainPROSITEPS50206RHODANESE_3coord: 240..367
score: 15.216
IPR036873Rhodanese-like domain superfamilyGENE3DG3DSA:3.40.250.10coord: 193..383
e-value: 9.9E-49
score: 167.1
IPR036873Rhodanese-like domain superfamilySUPERFAMILYSSF52821Rhodanese/Cell cycle control phosphatasecoord: 221..379
NoneNo IPR availablePANTHERPTHR10828:SF17CDC25-LIKE PROTEIN PHOSPHATASE TWINE-RELATEDcoord: 68..379
NoneNo IPR availablePANTHERPTHR10828M-PHASE INDUCER PHOSPHATASE DUAL SPECIFICITY PHOSPHATASE CDC25coord: 68..379