SMED30035858

Overview
NameSMED30035858
Smed IDSMED30035858
Length (bp)1097
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30035858 (SMED30035858) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30035858 (SMED30035858) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30035858 (SMED30035858) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30035858 (SMED30035858) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035858

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30035858SMESG000064034.1 SmedASXL_010939SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30035858SMESG000064034.1 SmedASXL_010939SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30035858SMESG000064035.1 SMESG000064034.1 SmedASXL_014758SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30035858SMESG000064035.1 SMESG000064034.1 SmedASXL_014758SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30035858SMESG000064034.1 SMESG000064035.1 dd_Smed_v4_3054_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
testisSMED30035858SMESG000064034.1 KF664582smed_ncbi_20200123PMID:24063805
Jaber-Hijazi et al., 2013
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
neoblastSMED30035858SMESG000064034.1 KF664582smed_ncbi_20200123PMID:24063805
Jaber-Hijazi et al., 2013
whole organism juvenile colorimetric in situ hybridization evidence
neoblastSMED30035858SMESG000064034.1 KF664582smed_ncbi_20200123PMID:24063805
Jaber-Hijazi et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30035858SMESG000064034.1 KF664582smed_ncbi_20200123PMID:24063805
Jaber-Hijazi et al., 2013
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
parenchymaSMED30035858SMESG000064034.1 KF664582smed_ncbi_20200123PMID:24063805
Jaber-Hijazi et al., 2013
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
parenchymaSMED30035858SMESG000064034.1 KF664582smed_ncbi_20200123PMID:24063805
Jaber-Hijazi et al., 2013
whole organism juvenile colorimetric in situ hybridization evidence
parenchymaSMED30035858SMESG000064034.1 KF664582smed_ncbi_20200123PMID:24063805
Jaber-Hijazi et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
testis primordiumSMED30035858SMESG000064034.1 KF664582smed_ncbi_20200123PMID:24063805
Jaber-Hijazi et al., 2013
whole organism juvenile colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Alignments
SMED30035858 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000465:94060..104613 +3728
Homology
BLAST of SMED30035858 vs. Ensembl Human
Match: MBD3 (methyl-CpG binding domain protein 3 [Source:HGNC Symbol;Acc:HGNC:6918])

HSP 1 Score: 62.7734 bits (151), Expect = 4.599e-11
Identity = 34/91 (37.36%), Postives = 54/91 (59.34%), Query Frame = -1
Query:  798 PKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKV 1070
            P+Q+FW K+L+   AF+    E V++++LPK  Q  G PG  +  L  +I S ++ ST   +P+ GQ +  A++EKNP + +   QPL K 
Sbjct:   78 PRQLFWEKKLSGLNAFD-IAEELVKTMDLPKGLQGVG-PGCTDETLLSAIASALHTST---MPITGQLS--AAVEKNPGVWLNTTQPLCKA 161          
BLAST of SMED30035858 vs. Ensembl Human
Match: MBD3 (methyl-CpG binding domain protein 3 [Source:HGNC Symbol;Acc:HGNC:6918])

HSP 1 Score: 63.1586 bits (152), Expect = 7.608e-11
Identity = 34/91 (37.36%), Postives = 54/91 (59.34%), Query Frame = -1
Query:  798 PKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKV 1070
            P+Q+FW K+L+   AF+    E V++++LPK  Q  G PG  +  L  +I S ++ ST   +P+ GQ +  A++EKNP + +   QPL K 
Sbjct:   78 PRQLFWEKKLSGLNAFD-IAEELVKTMDLPKGLQGVG-PGCTDETLLSAIASALHTST---MPITGQLS--AAVEKNPGVWLNTTQPLCKA 161          
BLAST of SMED30035858 vs. Ensembl Human
Match: MBD3 (methyl-CpG binding domain protein 3 [Source:HGNC Symbol;Acc:HGNC:6918])

HSP 1 Score: 63.1586 bits (152), Expect = 9.222e-11
Identity = 34/91 (37.36%), Postives = 54/91 (59.34%), Query Frame = -1
Query:  798 PKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKV 1070
            P+Q+FW K+L+   AF+    E V++++LPK  Q  G PG  +  L  +I S ++ ST   +P+ GQ +  A++EKNP + +   QPL K 
Sbjct:  102 PRQLFWEKKLSGLNAFD-IAEELVKTMDLPKGLQGVG-PGCTDETLLSAIASALHTST---MPITGQLS--AAVEKNPGVWLNTTQPLCKA 185          
BLAST of SMED30035858 vs. Ensembl Human
Match: MBD3 (methyl-CpG binding domain protein 3 [Source:HGNC Symbol;Acc:HGNC:6918])

HSP 1 Score: 63.1586 bits (152), Expect = 1.371e-10
Identity = 34/91 (37.36%), Postives = 54/91 (59.34%), Query Frame = -1
Query:  798 PKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKV 1070
            P+Q+FW K+L+   AF+    E V++++LPK  Q  G PG  +  L  +I S ++ ST   +P+ GQ +  A++EKNP + +   QPL K 
Sbjct:  134 PRQLFWEKKLSGLNAFD-IAEELVKTMDLPKGLQGVG-PGCTDETLLSAIASALHTST---MPITGQLS--AAVEKNPGVWLNTTQPLCKA 217          
BLAST of SMED30035858 vs. Ensembl Human
Match: MBD2 (methyl-CpG binding domain protein 2 [Source:HGNC Symbol;Acc:HGNC:6917])

HSP 1 Score: 60.8474 bits (146), Expect = 1.147e-9
Identity = 33/93 (35.48%), Postives = 55/93 (59.14%), Query Frame = -1
Query:  798 EVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKV 1076
            E P+Q+FW KRL    A +  T + ++++ELPK  Q  G PG ++  L  ++ S ++ S+    P+ GQ +  A++EKNP + +  +QPL K 
Sbjct:  276 EQPRQLFWEKRLQGLSASD-VTEQIIKTMELPKGLQGVG-PGSNDETLLSAVASALHTSS---APITGQVS--AAVEKNPAVWLNTSQPLCKA 361          
BLAST of SMED30035858 vs. Ensembl Fly
Match: MBD-like (gene:FBgn0027950 transcript:FBtr0082068)

HSP 1 Score: 51.9878 bits (123), Expect = 1.741e-7
Identity = 30/93 (32.26%), Postives = 50/93 (53.76%), Query Frame = -1
Query:  804 NQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLV 1082
             +E PKQ+FW KRL    A + ++ E++  + LPK  +  G P ++   + QS+ + ++     N  V GQS+ KA + KN    +   QPL+
Sbjct:  109 TREKPKQLFWEKRLERLRACH-DSGEELDDISLPKTIRTVG-PNVNEQTVLQSVATALHML---NAGVHGQSSTKADLTKNAMAFMNPEQPLM 196          
BLAST of SMED30035858 vs. Ensembl Fly
Match: MBD-like (gene:FBgn0027950 transcript:FBtr0082069)

HSP 1 Score: 51.9878 bits (123), Expect = 4.317e-7
Identity = 30/93 (32.26%), Postives = 50/93 (53.76%), Query Frame = -1
Query:  804 NQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLV 1082
             +E PKQ+FW KRL    A + ++ E++  + LPK  +  G P ++   + QS+ + ++     N  V GQS+ KA + KN    +   QPL+
Sbjct:  222 TREKPKQLFWEKRLERLRACH-DSGEELDDISLPKTIRTVG-PNVNEQTVLQSVATALHML---NAGVHGQSSTKADLTKNAMAFMNPEQPLM 309          
BLAST of SMED30035858 vs. Ensembl Fly
Match: MBD-like (gene:FBgn0027950 transcript:FBtr0334654)

HSP 1 Score: 51.9878 bits (123), Expect = 4.332e-7
Identity = 30/93 (32.26%), Postives = 50/93 (53.76%), Query Frame = -1
Query:  804 NQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLV 1082
             +E PKQ+FW KRL    A + ++ E++  + LPK  +  G P ++   + QS+ + ++     N  V GQS+ KA + KN    +   QPL+
Sbjct:  223 TREKPKQLFWEKRLERLRACH-DSGEELDDISLPKTIRTVG-PNVNEQTVLQSVATALHML---NAGVHGQSSTKADLTKNAMAFMNPEQPLM 310          
BLAST of SMED30035858 vs. Ensembl Zebrafish
Match: mbd3a (methyl-CpG binding domain protein 3a [Source:ZFIN;Acc:ZDB-GENE-030131-9077])

HSP 1 Score: 60.8474 bits (146), Expect = 3.548e-10
Identity = 33/92 (35.87%), Postives = 54/92 (58.70%), Query Frame = -1
Query:  801 EVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVK 1076
            E P+Q+FW K+L+   AF+    E V++++LPK  Q  G PG  +  L  ++ S ++ S+    P+ GQ +  A++EKNP + +   QPL K
Sbjct:   99 EQPRQLFWEKKLSGLNAFD-IAEELVKTMDLPKGLQGVG-PGYSDKTLLSALASALHTSS---APITGQLS--AAVEKNPGVWLNTTQPLCK 183          
BLAST of SMED30035858 vs. Ensembl Zebrafish
Match: mbd3a (methyl-CpG binding domain protein 3a [Source:ZFIN;Acc:ZDB-GENE-030131-9077])

HSP 1 Score: 60.8474 bits (146), Expect = 3.548e-10
Identity = 33/92 (35.87%), Postives = 54/92 (58.70%), Query Frame = -1
Query:  801 EVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVK 1076
            E P+Q+FW K+L+   AF+    E V++++LPK  Q  G PG  +  L  ++ S ++ S+    P+ GQ +  A++EKNP + +   QPL K
Sbjct:   99 EQPRQLFWEKKLSGLNAFD-IAEELVKTMDLPKGLQGVG-PGYSDKTLLSALASALHTSS---APITGQLS--AAVEKNPGVWLNTTQPLCK 183          
BLAST of SMED30035858 vs. Ensembl Zebrafish
Match: mbd3a (methyl-CpG binding domain protein 3a [Source:ZFIN;Acc:ZDB-GENE-030131-9077])

HSP 1 Score: 60.8474 bits (146), Expect = 4.655e-10
Identity = 33/92 (35.87%), Postives = 54/92 (58.70%), Query Frame = -1
Query:  801 EVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVK 1076
            E P+Q+FW K+L+   AF+    E V++++LPK  Q  G PG  +  L  ++ S ++ S+    P+ GQ +  A++EKNP + +   QPL K
Sbjct:  131 EQPRQLFWEKKLSGLNAFDI-AEELVKTMDLPKGLQGVG-PGYSDKTLLSALASALHTSS---APITGQLS--AAVEKNPGVWLNTTQPLCK 215          
BLAST of SMED30035858 vs. Ensembl Zebrafish
Match: mbd3a (methyl-CpG binding domain protein 3a [Source:ZFIN;Acc:ZDB-GENE-030131-9077])

HSP 1 Score: 60.8474 bits (146), Expect = 4.655e-10
Identity = 33/92 (35.87%), Postives = 54/92 (58.70%), Query Frame = -1
Query:  801 EVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVK 1076
            E P+Q+FW K+L+   AF+    E V++++LPK  Q  G PG  +  L  ++ S ++ S+    P+ GQ +  A++EKNP + +   QPL K
Sbjct:  131 EQPRQLFWEKKLSGLNAFDI-AEELVKTMDLPKGLQGVG-PGYSDKTLLSALASALHTSS---APITGQLS--AAVEKNPGVWLNTTQPLCK 215          
BLAST of SMED30035858 vs. Ensembl Zebrafish
Match: mbd3b (methyl-CpG binding domain protein 3b [Source:ZFIN;Acc:ZDB-GENE-030131-9792])

HSP 1 Score: 59.3066 bits (142), Expect = 1.104e-9
Identity = 33/91 (36.26%), Postives = 52/91 (57.14%), Query Frame = -1
Query:  798 PKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKV 1070
            P+Q+FW K+L+   AF+    E V++++LPK  Q  G PG  +  L  +I S ++ S     P+ GQ +  A++EKNP + +   QPL K 
Sbjct:  102 PRQLFWEKKLSGLNAFDI-AEELVKTMDLPKGLQGVG-PGCTDKTLLSAIASALHTSA---APITGQLS--AAVEKNPGVWLNTAQPLCKA 185          
BLAST of SMED30035858 vs. Ensembl Xenopus
Match: cerkl (ceramide kinase like [Source:Xenbase;Acc:XB-GENE-6035280])

HSP 1 Score: 64.6994 bits (156), Expect = 3.227e-11
Identity = 35/91 (38.46%), Postives = 55/91 (60.44%), Query Frame = -1
Query:  798 PKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKV 1070
            P+Q+FW K+L+   AF+    E V+++ELPK  Q  G PG  +  L  +I S ++ ST   +P+ GQ +  A++EKNP + +  +QPL K 
Sbjct:  134 PRQLFWEKKLSGLNAFD-IAEELVKTMELPKGLQGVG-PGCTDETLLSAIASALHTST---MPITGQLS--AAVEKNPGVWLNTSQPLCKA 217          
BLAST of SMED30035858 vs. Ensembl Xenopus
Match: cerkl (ceramide kinase like [Source:Xenbase;Acc:XB-GENE-6035280])

HSP 1 Score: 64.6994 bits (156), Expect = 4.226e-11
Identity = 35/91 (38.46%), Postives = 55/91 (60.44%), Query Frame = -1
Query:  798 PKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKV 1070
            P+Q+FW K+L+   AF+    E V+++ELPK  Q  G PG  +  L  +I S ++ ST   +P+ GQ +  A++EKNP + +  +QPL K 
Sbjct:  154 PRQLFWEKKLSGLNAFDI-AEELVKTMELPKGLQGVG-PGCTDETLLSAIASALHTST---MPITGQLS--AAVEKNPGVWLNTSQPLCKA 237          
BLAST of SMED30035858 vs. Ensembl Xenopus
Match: cfap58 (cilia and flagella associated protein 58 [Source:Xenbase;Acc:XB-GENE-5719803])

HSP 1 Score: 58.9214 bits (141), Expect = 2.828e-9
Identity = 33/93 (35.48%), Postives = 54/93 (58.06%), Query Frame = -1
Query:  798 EVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKV 1076
            E P+Q+FW KRL +  + +  T + ++ +ELPK  Q  G PG +   L  +I S ++ S+    P+ GQ +  A++EKNP + +  +QPL K 
Sbjct:  132 EQPRQLFWEKRL-EGLSASDVTEQVIKPMELPKGLQGVG-PGNNEQTLLAAIASALHTSS---APITGQLS--AAVEKNPSVWLNTSQPLCKA 217          
BLAST of SMED30035858 vs. Ensembl Xenopus
Match: cfap58 (cilia and flagella associated protein 58 [Source:Xenbase;Acc:XB-GENE-5719803])

HSP 1 Score: 58.9214 bits (141), Expect = 2.918e-9
Identity = 33/93 (35.48%), Postives = 54/93 (58.06%), Query Frame = -1
Query:  798 EVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKV 1076
            E P+Q+FW KRL +  + +  T + ++ +ELPK  Q  G PG +   L  +I S ++ S+    P+ GQ +  A++EKNP + +  +QPL K 
Sbjct:  146 EQPRQLFWEKRL-EGLSASDVTEQVIKPMELPKGLQGVG-PGNNEQTLLAAIASALHTSS---APITGQLS--AAVEKNPSVWLNTSQPLCKA 231          
BLAST of SMED30035858 vs. Ensembl Mouse
Match: Mbd3 (methyl-CpG binding domain protein 3 [Source:MGI Symbol;Acc:MGI:1333812])

HSP 1 Score: 65.0846 bits (157), Expect = 5.160e-12
Identity = 35/91 (38.46%), Postives = 54/91 (59.34%), Query Frame = -1
Query:  798 PKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKV 1070
            P+Q+FW K+L+   AF+    E VR+++LPK  Q  G PG  +  L  +I S ++ ST   +P+ GQ +  A++EKNP + +   QPL K 
Sbjct:   34 PRQLFWEKKLSGLSAFD-IAEELVRTMDLPKGLQGVG-PGCTDETLLSAIASALHTST---LPITGQLS--AAVEKNPGVWLNTAQPLCKA 117          
BLAST of SMED30035858 vs. Ensembl Mouse
Match: Mbd3 (methyl-CpG binding domain protein 3 [Source:MGI Symbol;Acc:MGI:1333812])

HSP 1 Score: 65.0846 bits (157), Expect = 1.562e-11
Identity = 35/91 (38.46%), Postives = 54/91 (59.34%), Query Frame = -1
Query:  798 PKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKV 1070
            P+Q+FW K+L+   AF+    E VR+++LPK  Q  G PG  +  L  +I S ++ ST   +P+ GQ +  A++EKNP + +   QPL K 
Sbjct:  102 PRQLFWEKKLSGLSAFD-IAEELVRTMDLPKGLQGVG-PGCTDETLLSAIASALHTST---LPITGQLS--AAVEKNPGVWLNTAQPLCKA 185          
BLAST of SMED30035858 vs. Ensembl Mouse
Match: Mbd3 (methyl-CpG binding domain protein 3 [Source:MGI Symbol;Acc:MGI:1333812])

HSP 1 Score: 64.6994 bits (156), Expect = 1.790e-11
Identity = 35/91 (38.46%), Postives = 54/91 (59.34%), Query Frame = -1
Query:  798 PKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKV 1070
            P+Q+FW K+L+   AF+    E VR+++LPK  Q  G PG  +  L  +I S ++ ST   +P+ GQ +  A++EKNP + +   QPL K 
Sbjct:  110 PRQLFWEKKLSGLSAFD-IAEELVRTMDLPKGLQGVG-PGCTDETLLSAIASALHTST---LPITGQLS--AAVEKNPGVWLNTAQPLCKA 193          
BLAST of SMED30035858 vs. Ensembl Mouse
Match: Mbd3 (methyl-CpG binding domain protein 3 [Source:MGI Symbol;Acc:MGI:1333812])

HSP 1 Score: 64.6994 bits (156), Expect = 2.396e-11
Identity = 35/91 (38.46%), Postives = 54/91 (59.34%), Query Frame = -1
Query:  798 PKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKV 1070
            P+Q+FW K+L+   AF+    E VR+++LPK  Q  G PG  +  L  +I S ++ ST   +P+ GQ +  A++EKNP + +   QPL K 
Sbjct:  134 PRQLFWEKKLSGLSAFD-IAEELVRTMDLPKGLQGVG-PGCTDETLLSAIASALHTST---LPITGQLS--AAVEKNPGVWLNTAQPLCKA 217          
BLAST of SMED30035858 vs. Ensembl Mouse
Match: Mbd3 (methyl-CpG binding domain protein 3 [Source:MGI Symbol;Acc:MGI:1333812])

HSP 1 Score: 64.6994 bits (156), Expect = 2.490e-11
Identity = 35/91 (38.46%), Postives = 54/91 (59.34%), Query Frame = -1
Query:  798 PKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKV 1070
            P+Q+FW K+L+   AF+    E VR+++LPK  Q  G PG  +  L  +I S ++ ST   +P+ GQ +  A++EKNP + +   QPL K 
Sbjct:  130 PRQLFWEKKLSGLSAFD-IAEELVRTMDLPKGLQGVG-PGCTDETLLSAIASALHTST---LPITGQLS--AAVEKNPGVWLNTAQPLCKA 213          
BLAST of SMED30035858 vs. UniProt/SwissProt
Match: sp|Q9Z2D8|MBD3_MOUSE (Methyl-CpG-binding domain protein 3 OS=Mus musculus OX=10090 GN=Mbd3 PE=1 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 1.676e-10
Identity = 35/91 (38.46%), Postives = 54/91 (59.34%), Query Frame = -1
Query:  798 PKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKV 1070
            P+Q+FW K+L+   AF+    E VR+++LPK  Q  G PG  +  L  +I S ++ ST   +P+ GQ +  A++EKNP + +   QPL K 
Sbjct:  134 PRQLFWEKKLSGLSAFD-IAEELVRTMDLPKGLQGVG-PGCTDETLLSAIASALHTST---LPITGQLS--AAVEKNPGVWLNTAQPLCKA 217          
BLAST of SMED30035858 vs. UniProt/SwissProt
Match: sp|O95983|MBD3_HUMAN (Methyl-CpG-binding domain protein 3 OS=Homo sapiens OX=9606 GN=MBD3 PE=1 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 6.582e-10
Identity = 34/91 (37.36%), Postives = 54/91 (59.34%), Query Frame = -1
Query:  798 PKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKV 1070
            P+Q+FW K+L+   AF+    E V++++LPK  Q  G PG  +  L  +I S ++ ST   +P+ GQ +  A++EKNP + +   QPL K 
Sbjct:  134 PRQLFWEKKLSGLNAFD-IAEELVKTMDLPKGLQGVG-PGCTDETLLSAIASALHTST---MPITGQLS--AAVEKNPGVWLNTTQPLCKA 217          
BLAST of SMED30035858 vs. UniProt/SwissProt
Match: sp|Q9UBB5|MBD2_HUMAN (Methyl-CpG-binding domain protein 2 OS=Homo sapiens OX=9606 GN=MBD2 PE=1 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 5.507e-9
Identity = 33/93 (35.48%), Postives = 55/93 (59.14%), Query Frame = -1
Query:  798 EVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKV 1076
            E P+Q+FW KRL    A +  T + ++++ELPK  Q  G PG ++  L  ++ S ++ S+    P+ GQ +  A++EKNP + +  +QPL K 
Sbjct:  276 EQPRQLFWEKRLQGLSASD-VTEQIIKTMELPKGLQGVG-PGSNDETLLSAVASALHTSS---APITGQVS--AAVEKNPAVWLNTSQPLCKA 361          
BLAST of SMED30035858 vs. UniProt/SwissProt
Match: sp|Q9Z2E1|MBD2_MOUSE (Methyl-CpG-binding domain protein 2 OS=Mus musculus OX=10090 GN=Mbd2 PE=2 SV=2)

HSP 1 Score: 60.8474 bits (146), Expect = 5.549e-9
Identity = 33/93 (35.48%), Postives = 55/93 (59.14%), Query Frame = -1
Query:  798 EVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKV 1076
            E P+Q+FW KRL    A +  T + ++++ELPK  Q  G PG ++  L  ++ S ++ S+    P+ GQ +  A++EKNP + +  +QPL K 
Sbjct:  279 EQPRQLFWEKRLQGLSASD-VTEQIIKTMELPKGLQGVG-PGSNDETLLSAVASALHTSS---APITGQVS--AAVEKNPAVWLNTSQPLCKA 364          
BLAST of SMED30035858 vs. TrEMBL
Match: V5UX13 (Methyl-CpG binding domain 2/3 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 3.528e-58
Identity = 95/95 (100.00%), Postives = 95/95 (100.00%), Query Frame = -1
Query:  801 DNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVK 1085
            DNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVK
Sbjct:  164 DNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVK 258          
BLAST of SMED30035858 vs. TrEMBL
Match: A0A4Z2D232 (Methyl-CpG-binding domain protein isoform 4 OS=Schistosoma japonicum OX=6182 GN=EWB00_005268 PE=4 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 5.081e-18
Identity = 43/97 (44.33%), Postives = 63/97 (64.95%), Query Frame = -1
Query:  798 NQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCI--YNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKV 1082
            N E+P Q+FW KRLAD+ A NP+T E  + + LPK  Q+AG PG    QL QS++  +   +S  N+ P++GQ    ++IEKNPC++I   QP++K 
Sbjct:   88 NHEIPHQLFWEKRLADHMAINPDTGEPFKPISLPKGMQSAGVPGYQPTQLIQSLIHALSSSSSNNNSSPIIGQEQQPSAIEKNPCVIINHLQPMIKT 184          
BLAST of SMED30035858 vs. TrEMBL
Match: A0A4Z2D235 (Methyl-CpG-binding domain protein isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_005268 PE=4 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 9.984e-18
Identity = 44/97 (45.36%), Postives = 64/97 (65.98%), Query Frame = -1
Query:  798 NQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCI--YNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKV 1082
            N E+P Q+FW KRLAD+ A NP+T E  + + LPK  Q+AG PG    QL QS++  +   +S  N+ P++GQ    ++IEKNPC++I   QP++KV
Sbjct:  171 NHEIPHQLFWEKRLADHMAINPDTGEPFKPISLPKGMQSAGVPGYQPTQLIQSLIHALSSSSSNNNSSPIIGQEQQPSAIEKNPCVIINHLQPMIKV 267          
BLAST of SMED30035858 vs. TrEMBL
Match: C1L5J0 (Methyl-CpG-binding domain protein 2 OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 3.282e-17
Identity = 43/97 (44.33%), Postives = 63/97 (64.95%), Query Frame = -1
Query:  798 NQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCI--YNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKV 1082
            N E+P Q+FW KRLAD+ A NP+T E  + + LPK  Q+AG PG    QL QS++  +   +S  N+ P++GQ    ++IEKNPC++I   QP++K 
Sbjct:  171 NHEIPHQLFWEKRLADHMAINPDTGEPFKPISLPKGMQSAGVPGYQPTQLIQSLIHALSSSSSNNNSSPIIGQEQQPSAIEKNPCVIINHLQPMIKT 267          
BLAST of SMED30035858 vs. TrEMBL
Match: Q5DC71 (Methyl-CpG-binding domain protein 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_005268 PE=2 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 3.315e-17
Identity = 43/97 (44.33%), Postives = 63/97 (64.95%), Query Frame = -1
Query:  798 NQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCI--YNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKV 1082
            N E+P Q+FW KRLAD+ A NP+T E  + + LPK  Q+AG PG    QL QS++  +   +S  N+ P++GQ    ++IEKNPC++I   QP++K 
Sbjct:  171 NHEIPHQLFWEKRLADHMAINPDTGEPFKPISLPKGMQSAGVPGYQPTQLIQSLIHALSSSSSNNNSSPIIGQEQQPSAIEKNPCVIINHLQPMIKT 267          
BLAST of SMED30035858 vs. Ensembl Cavefish
Match: MBD3 (methyl-CpG binding domain protein 3 [Source:NCBI gene;Acc:103030820])

HSP 1 Score: 59.3066 bits (142), Expect = 1.091e-9
Identity = 32/93 (34.41%), Postives = 55/93 (59.14%), Query Frame = -1
Query:  798 EVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKV 1076
            E+PKQ+FW K+L+   A++    E +++++LPK  Q  G PG  +  L  +I S ++ ++    P+ GQ +  A++EKNP + +   QPL K 
Sbjct:  132 ELPKQLFWEKKLSGLNAYDI-AEELMKNLDLPKGLQGVG-PGYTDKTLLSAIASALHTTS---APITGQLS--AAVEKNPGVWLNTTQPLCKA 217          
BLAST of SMED30035858 vs. Ensembl Cavefish
Match: ENSAMXT00000030741.1 (methyl-CpG-binding domain protein 2-like [Source:NCBI gene;Acc:103022882])

HSP 1 Score: 56.6102 bits (135), Expect = 8.401e-9
Identity = 34/93 (36.56%), Postives = 51/93 (54.84%), Query Frame = -1
Query:  798 EVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKV 1076
            E P+Q+FW KRL      +  T E +R++ELPK  Q+ G P   +  L  +I S ++ S+    P+ GQ++  A  EKNP + +   QPL K 
Sbjct:  134 EQPRQLFWEKRL-KGLRSSDVTEEVLRTMELPKGLQSVG-PDASDETLLSAIASALHLSSG---PITGQTSTAA--EKNPAIWLNTFQPLCKA 219          
BLAST of SMED30035858 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000463.1 (pep scaffold:Pmarinus_7.0:GL477935:20172:42036:1 gene:ENSPMAG00000000415.1 transcript:ENSPMAT00000000463.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 8.036e-11
Identity = 32/92 (34.78%), Postives = 53/92 (57.61%), Query Frame = -1
Query:  801 EVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVK 1076
            +VPKQ+FW KRL    + +    E +R++ELP+  Q  G P I  + L  +I S +++S+    P+ GQ +   ++E+NP + +   QPL K
Sbjct:  100 DVPKQVFWEKRL-QGLSASDIAEEVMRAIELPRLLQGVG-PNITGDALLSTITSALHHSSG---PITGQLS--TAVERNPAVWLNTGQPLCK 184          
BLAST of SMED30035858 vs. Ensembl Sea Lamprey
Match: mbd2 (methyl-CpG binding domain protein 2 [Source:NCBI gene;Acc:337105])

HSP 1 Score: 55.0694 bits (131), Expect = 4.026e-9
Identity = 31/90 (34.44%), Postives = 51/90 (56.67%), Query Frame = -1
Query:  798 KQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKV 1067
            +Q+FW KRL   ++ +  T E ++S++LPK  Q  G PG     L  S+ S ++ S+ +   + GQ +  A +EKNP + +  +QPL K 
Sbjct:   99 QQLFWEKRL-QGWSASDITEEILKSMDLPKGIQGVG-PGWSAETLLSSLASALHTSSSS---ITGQMS--AGVEKNPAIWLNTSQPLCKA 181          
BLAST of SMED30035858 vs. Ensembl Nematostella
Match: EDO34622 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNU1])

HSP 1 Score: 55.0694 bits (131), Expect = 7.883e-9
Identity = 33/91 (36.26%), Postives = 52/91 (57.14%), Query Frame = -1
Query:  810 NQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQP 1082
            ++E PKQ+FW KR+    A N     K+ +  L K F+  G PG+D   L  ++V+ I+  TK++I   GQS    ++EK+P + I  +QP
Sbjct:  108 DKEKPKQLFWEKRIQGLTAVNAEDERKLDAFNLGKTFRVIG-PGMDEKALVHALVTNIH--TKSSIK--GQSMSLVALEKHPEIWINVDQP 193          
BLAST of SMED30035858 vs. Ensembl Medaka
Match: mbd3a (methyl-CpG-binding domain protein 3 [Source:NCBI gene;Acc:101172482])

HSP 1 Score: 61.2326 bits (147), Expect = 3.206e-10
Identity = 34/91 (37.36%), Postives = 52/91 (57.14%), Query Frame = -1
Query:  798 PKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKV 1070
            P+Q+FW K+L+   A++    E VR++ELPK  Q  G PG  +  L  +I S ++ S     P+ GQ +  A++EKNP + +   QPL K 
Sbjct:  141 PRQLFWEKKLSGLNAYDI-AEELVRTMELPKGLQGVG-PGCTDKTLLSAIASALHTSA---APITGQLS--AAVEKNPGVWLNTAQPLCKA 224          
BLAST of SMED30035858 vs. Ensembl Medaka
Match: mbd3a (methyl-CpG-binding domain protein 3 [Source:NCBI gene;Acc:101172482])

HSP 1 Score: 60.4622 bits (145), Expect = 6.784e-10
Identity = 34/90 (37.78%), Postives = 52/90 (57.78%), Query Frame = -1
Query:  801 PKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVK 1070
            P+Q+FW K+L+   A++    E VR++ELPK  Q  G PG  +  L  +I S ++ S     P+ GQ +  A++EKNP + +   QPL K
Sbjct:  210 PRQLFWEKKLSGLNAYDI-AEELVRTMELPKGLQGVG-PGCTDKTLLSAIASALHTSAA---PITGQLS--AAVEKNPGVWLNTAQPLCK 292          
BLAST of SMED30035858 vs. Ensembl Medaka
Match: ENSORLT00000019084.2 (methyl-CpG-binding domain protein 3 [Source:NCBI gene;Acc:101163357])

HSP 1 Score: 56.9954 bits (136), Expect = 4.680e-9
Identity = 33/90 (36.67%), Postives = 51/90 (56.67%), Query Frame = -1
Query:  801 PKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVK 1070
            PKQ+FW ++L+   AF+    E V+S++LPK  Q  G P   +  L  +I S ++ S    +P+ GQ    A++EKNP + +   QPL K
Sbjct:  103 PKQLFWERKLSGLNAFD-VAEEPVKSMDLPKGLQGVG-PVCSDRTLLSAIASSLHTSP---VPITGQLT--AAVEKNPGVWLNTAQPLCK 185          
BLAST of SMED30035858 vs. Ensembl Medaka
Match: ENSORLT00000037808.1 (methyl-CpG-binding domain protein 2-like [Source:NCBI gene;Acc:101168266])

HSP 1 Score: 56.9954 bits (136), Expect = 6.793e-9
Identity = 32/92 (34.78%), Postives = 54/92 (58.70%), Query Frame = -1
Query:  801 EVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVK 1076
            E P+Q+FW KRL    + +    + +R++ELPK  Q  G P   ++ L  +I S ++ S+    P+ GQ++  A+ EKNP + + A+QPL +
Sbjct:  134 EQPRQLFWEKRLKGLRSSD-VAEQVLRTMELPKGLQGVG-PDPSDDTLLSAIASALHMSS---APITGQTS--AAAEKNPAIWLNASQPLCR 218          
BLAST of SMED30035858 vs. Ensembl Medaka
Match: ENSORLT00000040966.1 (methyl-CpG-binding domain protein 2-like [Source:NCBI gene;Acc:101168266])

HSP 1 Score: 56.6102 bits (135), Expect = 1.622e-8
Identity = 32/92 (34.78%), Postives = 54/92 (58.70%), Query Frame = -1
Query:  801 EVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGIDNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVK 1076
            E P+Q+FW KRL    + +    + +R++ELPK  Q  G P   ++ L  +I S ++ S+    P+ GQ++  A+ EKNP + + A+QPL +
Sbjct:  134 EQPRQLFWEKRLKGLRSSD-VAEQVLRTMELPKGLQGVG-PDPSDDTLLSAIASALHMSS---APITGQTS--AAAEKNPAIWLNASQPLCR 218          
BLAST of SMED30035858 vs. Planmine SMEST
Match: SMESG000064035.1 (SMESG000064035.1)

HSP 1 Score: 268.085 bits (684), Expect = 4.552e-89
Identity = 132/132 (100.00%), Postives = 132/132 (100.00%), Query Frame = 2
Query:   44 MFYHFVKPSVGALSNSNKVATSLWERWKSTCSYLNFLCLNNSITIDTNKSFLNIPKEFSDFQNTIQINDKDLSDFPASFLLIEKSLQKEVKINNDKHRLLETNKPNEESSSLAVDNITPINVKFESRARLQQ 439
            MFYHFVKPSVGALSNSNKVATSLWERWKSTCSYLNFLCLNNSITIDTNKSFLNIPKEFSDFQNTIQINDKDLSDFPASFLLIEKSLQKEVKINNDKHRLLETNKPNEESSSLAVDNITPINVKFESRARLQQ
Sbjct:   85 MFYHFVKPSVGALSNSNKVATSLWERWKSTCSYLNFLCLNNSITIDTNKSFLNIPKEFSDFQNTIQINDKDLSDFPASFLLIEKSLQKEVKINNDKHRLLETNKPNEESSSLAVDNITPINVKFESRARLQQ 216          
BLAST of SMED30035858 vs. Planmine SMEST
Match: SMESG000064035.1 (SMESG000064035.1)

HSP 1 Score: 267.7 bits (683), Expect = 4.022e-88
Identity = 132/132 (100.00%), Postives = 132/132 (100.00%), Query Frame = 2
Query:   44 MFYHFVKPSVGALSNSNKVATSLWERWKSTCSYLNFLCLNNSITIDTNKSFLNIPKEFSDFQNTIQINDKDLSDFPASFLLIEKSLQKEVKINNDKHRLLETNKPNEESSSLAVDNITPINVKFESRARLQQ 439
            MFYHFVKPSVGALSNSNKVATSLWERWKSTCSYLNFLCLNNSITIDTNKSFLNIPKEFSDFQNTIQINDKDLSDFPASFLLIEKSLQKEVKINNDKHRLLETNKPNEESSSLAVDNITPINVKFESRARLQQ
Sbjct:  142 MFYHFVKPSVGALSNSNKVATSLWERWKSTCSYLNFLCLNNSITIDTNKSFLNIPKEFSDFQNTIQINDKDLSDFPASFLLIEKSLQKEVKINNDKHRLLETNKPNEESSSLAVDNITPINVKFESRARLQQ 273          
BLAST of SMED30035858 vs. Planmine SMEST
Match: SMESG000064035.1 (SMESG000064035.1)

HSP 1 Score: 267.314 bits (682), Expect = 4.300e-88
Identity = 132/132 (100.00%), Postives = 132/132 (100.00%), Query Frame = 2
Query:   44 MFYHFVKPSVGALSNSNKVATSLWERWKSTCSYLNFLCLNNSITIDTNKSFLNIPKEFSDFQNTIQINDKDLSDFPASFLLIEKSLQKEVKINNDKHRLLETNKPNEESSSLAVDNITPINVKFESRARLQQ 439
            MFYHFVKPSVGALSNSNKVATSLWERWKSTCSYLNFLCLNNSITIDTNKSFLNIPKEFSDFQNTIQINDKDLSDFPASFLLIEKSLQKEVKINNDKHRLLETNKPNEESSSLAVDNITPINVKFESRARLQQ
Sbjct:  125 MFYHFVKPSVGALSNSNKVATSLWERWKSTCSYLNFLCLNNSITIDTNKSFLNIPKEFSDFQNTIQINDKDLSDFPASFLLIEKSLQKEVKINNDKHRLLETNKPNEESSSLAVDNITPINVKFESRARLQQ 256          
BLAST of SMED30035858 vs. Planmine SMEST
Match: SMESG000064035.1 (SMESG000064035.1)

HSP 1 Score: 266.929 bits (681), Expect = 4.438e-88
Identity = 132/132 (100.00%), Postives = 132/132 (100.00%), Query Frame = 2
Query:   44 MFYHFVKPSVGALSNSNKVATSLWERWKSTCSYLNFLCLNNSITIDTNKSFLNIPKEFSDFQNTIQINDKDLSDFPASFLLIEKSLQKEVKINNDKHRLLETNKPNEESSSLAVDNITPINVKFESRARLQQ 439
            MFYHFVKPSVGALSNSNKVATSLWERWKSTCSYLNFLCLNNSITIDTNKSFLNIPKEFSDFQNTIQINDKDLSDFPASFLLIEKSLQKEVKINNDKHRLLETNKPNEESSSLAVDNITPINVKFESRARLQQ
Sbjct:  117 MFYHFVKPSVGALSNSNKVATSLWERWKSTCSYLNFLCLNNSITIDTNKSFLNIPKEFSDFQNTIQINDKDLSDFPASFLLIEKSLQKEVKINNDKHRLLETNKPNEESSSLAVDNITPINVKFESRARLQQ 248          
BLAST of SMED30035858 vs. Planmine SMEST
Match: SMESG000064035.1 (SMESG000064035.1)

HSP 1 Score: 202.601 bits (514), Expect = 1.346e-63
Identity = 98/99 (98.99%), Postives = 99/99 (100.00%), Query Frame = 2
Query:   44 MFYHFVKPSVGALSNSNKVATSLWERWKSTCSYLNFLCLNNSITIDTNKSFLNIPKEFSDFQNTIQINDKDLSDFPASFLLIEKSLQKEVKINNDKHRL 340
            MFYHFVKPSVGALSNSNKVATSLWERWKSTCSYLNFLCLNNSITIDTNKSFLNIPKEFSDFQNTIQINDKDLSDFPASFLLIEKSLQKEVKINNDKHR+
Sbjct:  117 MFYHFVKPSVGALSNSNKVATSLWERWKSTCSYLNFLCLNNSITIDTNKSFLNIPKEFSDFQNTIQINDKDLSDFPASFLLIEKSLQKEVKINNDKHRI 215          
The following BLAST results are available for this feature:
BLAST of SMED30035858 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MBD34.599e-1137.36methyl-CpG binding domain protein 3 [Source:HGNC S... [more]
MBD37.608e-1137.36methyl-CpG binding domain protein 3 [Source:HGNC S... [more]
MBD39.222e-1137.36methyl-CpG binding domain protein 3 [Source:HGNC S... [more]
MBD31.371e-1037.36methyl-CpG binding domain protein 3 [Source:HGNC S... [more]
MBD21.147e-935.48methyl-CpG binding domain protein 2 [Source:HGNC S... [more]
back to top
BLAST of SMED30035858 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035858 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
MBD-like1.741e-732.26gene:FBgn0027950 transcript:FBtr0082068[more]
MBD-like4.317e-732.26gene:FBgn0027950 transcript:FBtr0082069[more]
MBD-like4.332e-732.26gene:FBgn0027950 transcript:FBtr0334654[more]
back to top
BLAST of SMED30035858 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mbd3a3.548e-1035.87methyl-CpG binding domain protein 3a [Source:ZFIN;... [more]
mbd3a3.548e-1035.87methyl-CpG binding domain protein 3a [Source:ZFIN;... [more]
mbd3a4.655e-1035.87methyl-CpG binding domain protein 3a [Source:ZFIN;... [more]
mbd3a4.655e-1035.87methyl-CpG binding domain protein 3a [Source:ZFIN;... [more]
mbd3b1.104e-936.26methyl-CpG binding domain protein 3b [Source:ZFIN;... [more]
back to top
BLAST of SMED30035858 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cerkl3.227e-1138.46ceramide kinase like [Source:Xenbase;Acc:XB-GENE-6... [more]
cerkl4.226e-1138.46ceramide kinase like [Source:Xenbase;Acc:XB-GENE-6... [more]
cfap582.828e-935.48cilia and flagella associated protein 58 [Source:X... [more]
cfap582.918e-935.48cilia and flagella associated protein 58 [Source:X... [more]
back to top
BLAST of SMED30035858 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mbd35.160e-1238.46methyl-CpG binding domain protein 3 [Source:MGI Sy... [more]
Mbd31.562e-1138.46methyl-CpG binding domain protein 3 [Source:MGI Sy... [more]
Mbd31.790e-1138.46methyl-CpG binding domain protein 3 [Source:MGI Sy... [more]
Mbd32.396e-1138.46methyl-CpG binding domain protein 3 [Source:MGI Sy... [more]
Mbd32.490e-1138.46methyl-CpG binding domain protein 3 [Source:MGI Sy... [more]
back to top
BLAST of SMED30035858 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q9Z2D8|MBD3_MOUSE1.676e-1038.46Methyl-CpG-binding domain protein 3 OS=Mus musculu... [more]
sp|O95983|MBD3_HUMAN6.582e-1037.36Methyl-CpG-binding domain protein 3 OS=Homo sapien... [more]
sp|Q9UBB5|MBD2_HUMAN5.507e-935.48Methyl-CpG-binding domain protein 2 OS=Homo sapien... [more]
sp|Q9Z2E1|MBD2_MOUSE5.549e-935.48Methyl-CpG-binding domain protein 2 OS=Mus musculu... [more]
back to top
BLAST of SMED30035858 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V5UX133.528e-58100.00Methyl-CpG binding domain 2/3 OS=Schmidtea mediter... [more]
A0A4Z2D2325.081e-1844.33Methyl-CpG-binding domain protein isoform 4 OS=Sch... [more]
A0A4Z2D2359.984e-1845.36Methyl-CpG-binding domain protein isoform 2 OS=Sch... [more]
C1L5J03.282e-1744.33Methyl-CpG-binding domain protein 2 OS=Schistosoma... [more]
Q5DC713.315e-1744.33Methyl-CpG-binding domain protein 2 OS=Schistosoma... [more]
back to top
BLAST of SMED30035858 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
MBD31.091e-934.41methyl-CpG binding domain protein 3 [Source:NCBI g... [more]
ENSAMXT00000030741.18.401e-936.56methyl-CpG-binding domain protein 2-like [Source:N... [more]
back to top
BLAST of SMED30035858 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000000463.18.036e-1134.78pep scaffold:Pmarinus_7.0:GL477935:20172:42036:1 g... [more]
mbd24.026e-934.44methyl-CpG binding domain protein 2 [Source:NCBI g... [more]
back to top
BLAST of SMED30035858 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035858 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO346227.883e-936.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30035858 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mbd3a3.206e-1037.36methyl-CpG-binding domain protein 3 [Source:NCBI g... [more]
mbd3a6.784e-1037.78methyl-CpG-binding domain protein 3 [Source:NCBI g... [more]
ENSORLT00000019084.24.680e-936.67methyl-CpG-binding domain protein 3 [Source:NCBI g... [more]
ENSORLT00000037808.16.793e-934.78methyl-CpG-binding domain protein 2-like [Source:N... [more]
ENSORLT00000040966.11.622e-834.78methyl-CpG-binding domain protein 2-like [Source:N... [more]
back to top
BLAST of SMED30035858 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064035.14.552e-89100.00SMESG000064035.1[more]
SMESG000064035.14.022e-88100.00SMESG000064035.1[more]
SMESG000064035.14.300e-88100.00SMESG000064035.1[more]
SMESG000064035.14.438e-88100.00SMESG000064035.1[more]
SMESG000064035.11.346e-6398.99SMESG000064035.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035858 ID=SMED30035858|Name=SMED30035858|organism=Schmidtea mediterranea sexual|type=transcript|length=1097bp
AATGAAGTAAGTATTTTATTATAAAGTTTTATAAACTCTCTAGATGTTCT
ATCATTTTGTTAAACCGTCAGTTGGAGCACTTTCCAATTCTAATAAGGTT
GCAACTTCTTTATGGGAAAGATGGAAATCAACATGTAGCTATCTTAATTT
TCTCTGCTTGAATAATTCAATTACAATTGACACTAATAAATCATTTTTAA
ACATTCCCAAGGAATTTTCAGATTTTCAAAATACCATACAAATAAATGAT
AAGGATCTATCAGATTTTCCAGCATCATTTCTTCTGATAGAAAAAAGTTT
ACAAAAGGAAGTTAAAATAAATAATGACAAACATAGGTTACTAGAAACTA
ATAAACCAAATGAAGAATCAAGTTCGTTAGCTGTTGATAATATAACTCCA
ATAAATGTCAAATTTGAATCACGGGCAAGACTTCAACAATTATCAGAAAA
ACTTGAACTCGAACGCAAAAAACCGAAAATGGAAAAGAAAAAATTGATTT
AAAAACATTTATTAAACAAATACAAGCTGCTATCATTTTTATTATCGATT
TCTTGATGTTACACAAAATCTCATTTGTTTAGGCTGCTTCATCTACGCTC
AATTTCTAAATATACATGTTCAGCACTTATTATCGATTATTCAATTCAAT
ACTGGCAGAAGCGTTCGTCGCACCAGTTCTAATTTCCGTCGCAATTCTTT
CACTTTGGCCTCTTGTCGATTAATGATATCATCGGTGATGACTACTTGCT
ATATATAATGGAAATAAGGCGATGTTATAATGTTATTTATTTTAGCTTAC
TTTGACCAATGGCTGATTGGCTGTGATAAGTAGGCAGGGATTTTTCTCAA
TACTCGCTTTATGGTTACTTTGACCGAGCACGGGAATATTGTTTTTAGTT
GAGTTGTATATACACGAGACAATGCTCTGAAACAATTGGTTATTGTCGAT
CCCTGGGAACCCAGCATTCTGAAATTCTTTGGGCAATTCCACGGAACGGA
CTTTTTCATTGGTATTTGGATTAAAGGCATAATTATCGGCTAGCCTTTTA
TGCCAGAAAATTTGTTTGGGTACTTCTTGATTATCAAGATAGGAAGA
back to top

protein sequence of SMED30035858-orf-1

>SMED30035858-orf-1 ID=SMED30035858-orf-1|Name=SMED30035858-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=153bp
MFYHFVKPSVGALSNSNKVATSLWERWKSTCSYLNFLCLNNSITIDTNKS
FLNIPKEFSDFQNTIQINDKDLSDFPASFLLIEKSLQKEVKINNDKHRLL
ETNKPNEESSSLAVDNITPINVKFESRARLQQLSEKLELERKKPKMEKKK
LI*
back to top

protein sequence of SMED30035858-orf-2

>SMED30035858-orf-2 ID=SMED30035858-orf-2|Name=SMED30035858-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=102bp
SSYLDNQEVPKQIFWHKRLADNYAFNPNTNEKVRSVELPKEFQNAGFPGI
DNNQLFQSIVSCIYNSTKNNIPVLGQSNHKASIEKNPCLLITANQPLVKV
S*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR037965MBD3
IPR025884MeCpG-bd_2/3_C_dom
Vocabulary: molecular function
TermDefinition
GO:0008327methyl-CpG binding
Vocabulary: cellular component
TermDefinition
GO:0016581NuRD complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR025884Methyl-CpG binding protein 2/3, C-terminal domainPFAMPF14048MBD_Ccoord: 26..95
e-value: 4.6E-12
score: 46.5
NoneNo IPR availablePANTHERPTHR12396METHYL-CPG BINDING PROTEIN, MBDcoord: 4..95
IPR037965Methyl-CpG-binding domain protein 3PANTHERPTHR12396:SF12METHYL-CPG-BINDING DOMAIN PROTEIN 3coord: 4..95