Poly [ADP-ribose] polymerase

Overview
NamePoly [ADP-ribose] polymerase
Smed IDSMED30035855
Length (bp)2387
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Poly [ADP-ribose] polymerase (SMED30035855) t-SNE clustered cells

Violin plots show distribution of expression levels for Poly [ADP-ribose] polymerase (SMED30035855) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Poly [ADP-ribose] polymerase (SMED30035855) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Poly [ADP-ribose] polymerase (SMED30035855) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035855

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30035855SMESG000067451.1 SMESG000060010.1 Contig5535newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035855SMESG000067451.1 SMESG000060010.1 Contig5535uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035855SMESG000032522.1 Contig5535newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035855SMESG000032522.1 Contig5535uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
X1 cellSMED30035855SMESG000067451.1 SMESG000060010.1 SmedASXL_017092SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30035855SMESG000067451.1 SMESG000060010.1 SmedASXL_017092SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30035855SMESG000067451.1 SMESG000060010.1 dd_Smed_v4_6154_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035855SMESG000067451.1 SMESG000060010.1 dd_Smed_v4_6154_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035855SMESG000067451.1 SMESG000060010.1 dd_Smed_v4_6154_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30035855SMESG000067451.1 SMESG000060010.1 dd_Smed_v4_6154_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035855SMESG000067451.1 SMESG000060010.1 dd_Smed_v4_6154_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035855SMESG000067451.1 SMESG000060010.1 dd_Smed_v4_6154_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30035855SMESG000067451.1 SMESG000060010.1 SMESG000054330.1 OX_Smed_1.0.15117ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
neoblastSMED30035855SMESG000067451.1 SMESG000060010.1 SmWIOct06_014077GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Human
Match: PARP2 (poly(ADP-ribose) polymerase 2 [Source:HGNC Symbol;Acc:HGNC:272])

HSP 1 Score: 469.544 bits (1207), Expect = 3.127e-157
Identity = 233/447 (52.13%), Postives = 321/447 (71.81%), Query Frame = 3
Query:  840 SITVGMEKLDIPVDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYC--KKEILETNKIAS-QVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNF-DDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPDQS 2168
            S+   + K   PVD EC     KA +Y E ++V+DVMLNQTNLQFNNNK+Y+IQLL+D+ +  + VWMRW RVGK+GQ  L     NL  AKE F KKF DKTKN+W+DR+KFEK+ GKYD++Q+DY    ++  ET K  S +  L+P ES+L+ ++Q+L++++ +++ M + + EMKY+  K PLG+LT AQIKAGY +L++IE  +  G    ++L++ACN +YTRIPHDFG+R PPLIR+  E+  +++LLE L DI+IA+KL+        HPLD+HY+NLHC +  +  ++  +++I+ YL  TH  TH+ Y + +LDLFEV K+ E + F +D  NRMLLWHGSR +N+ GI+S GLRIAP EAP+TG+MFGKGIYFADMS+KSANY + +R KNTG LLL EV+LG CNEL++ N +A  L    HS KGLG +AP  +
Sbjct:   82 SVKALLLKGKAPVDPECTAKVGKAHVYCEGNDVYDVMLNQTNLQFNNNKYYLIQLLEDDAQRNFSVWMRWGRVGKMGQHSLVACSGNLNKAKEIFQKKFLDKTKNNWEDREKFEKVPGKYDMLQMDYATNTQDEEETKKEESLKSPLKP-ESQLDLRVQELIKLICNVQAMEEMMMEMKYNTKKAPLGKLTVAQIKAGYQSLKKIEDCIRAGQHG-RALMEACNEFYTRIPHDFGLRTPPLIRTQKELSEKIQLLEALGDIEIAIKLVKTELQSPEHPLDQHYRNLHCALRPLDHESYEFKVISQYLQSTHAPTHSDYTMTLLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAPPEAPITGYMFGKGIYFADMSSKSANYCFASRLKNTGLLLLSEVALGQCNELLEANPKAEGLLQGKHSTKGLGKMAPSSA 526          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Human
Match: PARP2 (poly(ADP-ribose) polymerase 2 [Source:HGNC Symbol;Acc:HGNC:272])

HSP 1 Score: 469.544 bits (1207), Expect = 1.109e-156
Identity = 234/451 (51.88%), Postives = 324/451 (71.84%), Query Frame = 3
Query:  828 KENGSITVGMEKLDIPVDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYC--KKEILETNKIAS-QVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNF-DDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPDQS 2168
            K++ S+   + K   PVD EC     KA +Y E ++V+DVMLNQTNLQFNNNK+Y+IQLL+D+ +  + VWMRW RVGK+GQ  L     NL  AKE F KKF DKTKN+W+DR+KFEK+ GKYD++Q+DY    ++  ET K  S +  L+P ES+L+ ++Q+L++++ +++ M + + EMKY+  K PLG+LT AQIKAGY +L++IE  +  G    ++L++ACN +YTRIPHDFG+R PPLIR+  E+  +++LLE L DI+IA+KL+        HPLD+HY+NLHC +  +  ++  +++I+ YL  TH  TH+ Y + +LDLFEV K+ E + F +D  NRMLLWHGSR +N+ GI+S GLRIAP EAP+TG+MFGKGIYFADMS+KSANY + +R KNTG LLL EV+LG CNEL++ N +A  L    HS KGLG +AP  +
Sbjct:   65 KQDESVKALLLKGKAPVDPECTAKVGKAHVYCEGNDVYDVMLNQTNLQFNNNKYYLIQLLEDDAQRNFSVWMRWGRVGKMGQHSLVACSGNLNKAKEIFQKKFLDKTKNNWEDREKFEKVPGKYDMLQMDYATNTQDEEETKKEESLKSPLKP-ESQLDLRVQELIKLICNVQAMEEMMMEMKYNTKKAPLGKLTVAQIKAGYQSLKKIEDCIRAGQHG-RALMEACNEFYTRIPHDFGLRTPPLIRTQKELSEKIQLLEALGDIEIAIKLVKTELQSPEHPLDQHYRNLHCALRPLDHESYEFKVISQYLQSTHAPTHSDYTMTLLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAPPEAPITGYMFGKGIYFADMSSKSANYCFASRLKNTGLLLLSEVALGQCNELLEANPKAEGLLQGKHSTKGLGKMAPSSA 513          

HSP 2 Score: 54.6842 bits (130), Expect = 5.735e-7
Identity = 26/48 (54.17%), Postives = 34/48 (70.83%), Query Frame = 2
Query: 2243 DGTLVPVGIPVDTGVGEKRKGAYVLNYNEYIVYKQNQVKMRFLVKVRF 2386
            +G+ VP+G   DTG+       Y LNYNEYIVY  NQV+MR+L+KV+F
Sbjct:  519 NGSTVPLGPASDTGI--LNPDGYTLNYNEYIVYNPNQVRMRYLLKVQF 564          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Human
Match: PARP2 (poly(ADP-ribose) polymerase 2 [Source:HGNC Symbol;Acc:HGNC:272])

HSP 1 Score: 468.003 bits (1203), Expect = 7.621e-156
Identity = 233/447 (52.13%), Postives = 321/447 (71.81%), Query Frame = 3
Query:  840 SITVGMEKLDIPVDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYC--KKEILETNKIAS-QVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNF-DDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPDQS 2168
            S+   + K   PVD EC     KA +Y E ++V+DVMLNQTNLQFNNNK+Y+IQLL+D+ +  + VWMRW RVGK+GQ  L     NL  AKE F KKF DKTKN+W+DR+KFEK+ GKYD++Q+DY    ++  ET K  S +  L+P ES+L+ ++Q+L++++ +++ M + + EMKY+  K PLG+LT AQIKAGY +L++IE  +  G    ++L++ACN +YTRIPHDFG+R PPLIR+  E+  +++LLE L DI+IA+KL+        HPLD+HY+NLHC +  +  ++  +++I+ YL  TH  TH+ Y + +LDLFEV K+ E + F +D  NRMLLWHGSR +N+ GI+S GLRIAP EAP+TG+MFGKGIYFADMS+KSANY + +R KNTG LLL EV+LG CNEL++ N +A  L    HS KGLG +AP  +
Sbjct:   82 SVKALLLKGKAPVDPECTAKVGKAHVYCEGNDVYDVMLNQTNLQFNNNKYYLIQLLEDDAQRNFSVWMRWGRVGKMGQHSLVACSGNLNKAKEIFQKKFLDKTKNNWEDREKFEKVPGKYDMLQMDYATNTQDEEETKKEESLKSPLKP-ESQLDLRVQELIKLICNVQAMEEMMMEMKYNTKKAPLGKLTVAQIKAGYQSLKKIEDCIRAGQHG-RALMEACNEFYTRIPHDFGLRTPPLIRTQKELSEKIQLLEALGDIEIAIKLVKTELQSPEHPLDQHYRNLHCALRPLDHESYEFKVISQYLQSTHAPTHSDYTMTLLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAPPEAPITGYMFGKGIYFADMSSKSANYCFASRLKNTGLLLLSEVALGQCNELLEANPKAEGLLQGKHSTKGLGKMAPSSA 526          

HSP 2 Score: 54.6842 bits (130), Expect = 5.861e-7
Identity = 26/48 (54.17%), Postives = 34/48 (70.83%), Query Frame = 2
Query: 2243 DGTLVPVGIPVDTGVGEKRKGAYVLNYNEYIVYKQNQVKMRFLVKVRF 2386
            +G+ VP+G   DTG+       Y LNYNEYIVY  NQV+MR+L+KV+F
Sbjct:  532 NGSTVPLGPASDTGI--LNPDGYTLNYNEYIVYNPNQVRMRYLLKVQF 577          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Human
Match: PARP1 (poly(ADP-ribose) polymerase 1 [Source:HGNC Symbol;Acc:HGNC:270])

HSP 1 Score: 318.931 bits (816), Expect = 1.585e-94
Identity = 177/431 (41.07%), Postives = 266/431 (61.72%), Query Frame = 3
Query:  897 LSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGK-IGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEP-IESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLI-NENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQN---FDDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPDQST 2171
            L   A +  +  +VF   L   ++    N +Y +QLL+D+KE  Y+++  W RVG  IG  KL +  +   A  E FMK + +KT N W  +  F K   K+  ++IDY + E     +   ++ + P  +SKL + +QDL++++FD++ M  A+ E + D  K+PLG+L++ QI+A Y  L E++  +S+G SS+  ++   N +YT IPHDFGM+ PPL+ +   ++ ++E+L+ L DI++A  L+   ++D    P+D +Y+ L   I +V  D+   ++I  Y+  TH +TH  Y+LE++D+F++ +E E Q    F    NR LLWHGSRTTN+ GI+SQGLRIAP EAPVTG+MFGKGIYFADM +KSANY + ++    G +LL EV+LG   EL K  S  +KLP   HSVKGLG   PD S 
Sbjct:  539 LEHSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNKLEQMPSKEDAI-EHFMKLYEEKTGNAWHSKN-FTKYPKKFYPLEIDYGQDE-----EAVKKLTVNPGTKSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAYSILSEVQQAVSQG-SSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEVALGNMYEL-KHASHISKLPKGKHSVKGLGKTTPDPSA 960          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Human
Match: PARP3 (poly(ADP-ribose) polymerase family member 3 [Source:HGNC Symbol;Acc:HGNC:273])

HSP 1 Score: 203.756 bits (517), Expect = 2.723e-56
Identity = 159/455 (34.95%), Postives = 243/455 (53.41%), Query Frame = 3
Query:  846 TVGMEKLDIPVDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQI---DYCKKEILETNKIASQVKLEPIES-KLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKI--ALKLINENEDV---HVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQE---WQNFDDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTR--SKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPDQS 2168
             +  EK  I VD  C  LS      V   E ++  LNQTN++ NNNKFYIIQLL+D     +  W RW RVG++GQ K+  F   L  AK+ F KKF +KTKN+W +R  F    GKY L+++   D  ++ +++ ++   +   + ++   L+   Q L+  +F  +   + ++ M  D  K+PLG+L++ QI  G+ AL  +E  L       +SL +  + +YT IPH+FG   PP I S   ++ + ++L  L+DI++  AL+ ++E E       HPLDR YQ L C + L+    P Y++I  YL  T GS H    L+   +++V +E E   +Q     GNR LLWHG+       I++ GLRI P     +G   GKGIYFA  ++KSA Y+   +  + + G++ L EV+LG  + +  +N      PP   SV   G   PD +
Sbjct:   38 AIPAEKRIIRVDPTCP-LSSNPGTQV--YEDYNCTLNQTNIENNNNKFYIIQLLQDSNR-FFTCWNRWGRVGEVGQSKINHF-TRLEDAKKDFEKKFREKTKNNWAERDHFVSHPGKYTLIEVQAEDEAQEAVVKVDRGPVRTVTKRVQPCSLDPATQKLITNIFSKEMFKNTMALMDLDVKKMPLGKLSKQQIARGFEALEALEEALKGPTDGGQSLEELSSHFYTVIPHNFGHSQPPPINSPELLQAKKDMLLVLADIELAQALQAVSEQEKTVEEVPHPLDRDYQLLKCQLQLLDSGAPEYKVIQTYLEQT-GSNHRCPTLQ--HIWKVNQEGEEDRFQAHSKLGNRKLLWHGTNMAVVAAILTSGLRIMPH----SGGRVGKGIYFASENSKSAGYVIGMKCGAHHVGYMFLGEVALGREHHINTDNPSLKSPPPGFDSVIARGHTEPDPT 480          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Celegans
Match: parp-1 (Poly [ADP-ribose] polymerase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9N4H4])

HSP 1 Score: 265.774 bits (678), Expect = 5.316e-76
Identity = 155/419 (36.99%), Postives = 237/419 (56.56%), Query Frame = 3
Query:  927 NSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVG-KIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENE-----DVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNFDDK-GNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELI-KENSRANKLPPNCHSVKGLGIIAP 2159
            +  ++   L+ T+L  N N +Y IQLLKD++   YYV+  W RVG ++G  K   + N+  A  + F   F++KTKNDW  R+ F K+ G +  V+ DY +   +   +I    K     + L + +++++  +FD++ M  A+   + D NK+PLGRL+  QI   +  L +I  LL +       ++   N +YT IPH+FGMR+P  I S  +IK +  +L  L DIK A   I+  +      + + P+D +YQ L CI+  +      + +I+ YL  THG+TH    +E++D+ ++ ++ E   F    GNR LLWHGS   N+ GI+ QGLRIAP EAPV+G+MFGKG+YFADM +KS  Y     +K   +LLLC+V+LG   +L+  +N     LP    SV+GLG   P
Sbjct:  473 DGSLYQATLSFTDLTQNKNSYYKIQLLKDDQRENYYVFRSWGRVGTEVGGNKHESYSNSNEAILK-FQDVFHEKTKNDWIYRKHFRKMPGMFSYVETDYSEFAQITDTEITPGSK-----TLLPKSVKEVVMSIFDVENMKSALKSFEMDVNKMPLGRLSHNQINLAFEVLNDISDLLVKLPIDASRILDFSNKFYTIIPHNFGMRVPEPIDSFHKIKEKNNMLNALLDIKFAYDQISGGDVPASTSLGIDPVDINYQKLKCIMEPLQQGCDDWNMIHQYLKNTHGATHDL-KVELIDILKLNRDNESSKFKRHIGNRRLLWHGSGKMNFAGILGQGLRIAPPEAPVSGYMFGKGVYFADMFSKSFFYCR-ANAKEEAYLLLCDVALGNVQQLMASKNVSRQTLPAGFQSVQGLGRQCP 883          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Celegans
Match: parp-1 (Poly [ADP-ribose] polymerase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9N4H4])

HSP 1 Score: 204.527 bits (519), Expect = 6.252e-59
Identity = 114/286 (39.86%), Postives = 166/286 (58.04%), Query Frame = 3
Query: 1323 VFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENE-----DVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNFDDK-GNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELI-KENSRANKLPPNCHSVKGLGIIAP 2159
            +FD++ M  A+   + D NK+PLGRL+  QI   +  L +I  LL +       ++   N +YT IPH+FGMR+P  I S  +IK +  +L  L DIK A   I+  +      + + P+D +YQ L CI+  +      + +I+ YL  THG+TH    +E++D+ ++ ++ E   F    GNR LLWHGS   N+ GI+ QGLRIAP EAPV+G+MFGKG+YFADM +KS  Y     +K   +LLLC+V+LG   +L+  +N     LP    SV+GLG   P
Sbjct:    3 IFDVENMKSALKSFEMDVNKMPLGRLSHNQINLAFEVLNDISDLLVKLPIDASRILDFSNKFYTIIPHNFGMRVPEPIDSFHKIKEKNNMLNALLDIKFAYDQISGGDVPASTSLGIDPVDINYQKLKCIMEPLQQGCDDWNMIHQYLKNTHGATHDL-KVELIDILKLNRDNESSKFKRHIGNRRLLWHGSGKMNFAGILGQGLRIAPPEAPVSGYMFGKGVYFADMFSKSFFYCR-ANAKEEAYLLLCDVALGNVQQLMASKNVSRQTLPAGFQSVQGLGRQCP 286          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Celegans
Match: parp-1 (Poly [ADP-ribose] polymerase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9N4H4])

HSP 1 Score: 143.665 bits (361), Expect = 3.113e-38
Identity = 81/197 (41.12%), Postives = 116/197 (58.88%), Query Frame = 3
Query: 1590 LLETLSDIKIALKLINENE-----DVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNFDDK-GNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELI-KENSRANKLPPNCHSVKGLGIIAP 2159
            +L  L DIK A   I+  +      + + P+D +YQ L CI+  +      + +I+ YL  THG+TH    +E++D+ ++ ++ E   F    GNR LLWHGS   N+ GI+ QGLRIAP EAPV+G+MFGKG+YFADM +KS  Y     +K   +LLLC+V+LG   +L+  +N     LP    SV+GLG   P
Sbjct:    1 MLNALLDIKFAYDQISGGDVPASTSLGIDPVDINYQKLKCIMEPLQQGCDDWNMIHQYLKNTHGATHDL-KVELIDILKLNRDNESSKFKRHIGNRRLLWHGSGKMNFAGILGQGLRIAPPEAPVSGYMFGKGVYFADMFSKSFFYC-RANAKEEAYLLLCDVALGNVQQLMASKNVSRQTLPAGFQSVQGLGRQCP 195          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Celegans
Match: parp-2 (Poly [ADP-ribose] polymerase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q09525])

HSP 1 Score: 139.043 bits (349), Expect = 2.226e-34
Identity = 136/464 (29.31%), Postives = 211/464 (45.47%), Query Frame = 3
Query:  924 ENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESK--------------------------LEEKLQDLMRIVFDLKEMNDAVSEMKYDNN-KVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSL-------------------VQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETL-SDIKIALKLIN-----ENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEW--------QNFDDKGNR----------------MLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELI 2087
            EN   + V L +TN+  NNNKFY ++LL +  +  + V +   R+G  G  +L  F ++L  AK+ F  KFY+KT   W++R   E +  KY +V++    ++  +  K         ++ K                          + EKL++LM+ + D       + ++K++     P+  L+ AQ+  GY  L +IE  +  G S+ +S                    +   N YY+ IPH FG  +PP I S ++I+ E ELL+ L   I+ +L+L +      ++D++     R Y+ L C  +L  +   I   I D L +  G TH  Y L ++D FE++   E         Q    K  R                 LLWHG+R TN   I+  GL+    +    G MFG G+YFA++ TKSANY  P  SK   F+LLCEV   T N L+
Sbjct:    7 ENGRGYKVHLCKTNIAQNNNKFYDMELLDEGGD--FIVKLINGRIGYRGVTQLKDF-DDLDRAKKFFESKFYEKTHLHWEERDD-EPVPNKYAVVELATNARQTEKEVKKEEPEPEPKVDEKNTRGRKKRGIVKEKKEIKKEEEPVEEVNEKLKELMKCICDEDVHLGLLKQLKFNEAFGRPIDCLSLAQLTTGYEILSKIEESIG-GKSARRSTRGRPRVADRVLAVKSDGPSLHDINKYYSLIPHSFGFCVPPKIDSHAKIQAERELLDALKGSIEASLELKDLKKTASSKDIY----QRLYERLPC--HLEPVSEEIAGKIGDCLAM-RGPTHC-YKLSLIDAFELKDPNEIPTEAPVEVQEVPKKRGRKSTKTAAPTVPPPTTKRLLWHGTRVTNVFSILMNGLQFPVGDR--CGLMFGNGVYFANVPTKSANYCCPEASKRV-FMLLCEVE--TANPLV 452          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Celegans
Match: parp-2 (Poly [ADP-ribose] polymerase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q09525])

HSP 1 Score: 139.043 bits (349), Expect = 2.226e-34
Identity = 136/464 (29.31%), Postives = 211/464 (45.47%), Query Frame = 3
Query:  924 ENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESK--------------------------LEEKLQDLMRIVFDLKEMNDAVSEMKYDNN-KVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSL-------------------VQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETL-SDIKIALKLIN-----ENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEW--------QNFDDKGNR----------------MLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELI 2087
            EN   + V L +TN+  NNNKFY ++LL +  +  + V +   R+G  G  +L  F ++L  AK+ F  KFY+KT   W++R   E +  KY +V++    ++  +  K         ++ K                          + EKL++LM+ + D       + ++K++     P+  L+ AQ+  GY  L +IE  +  G S+ +S                    +   N YY+ IPH FG  +PP I S ++I+ E ELL+ L   I+ +L+L +      ++D++     R Y+ L C  +L  +   I   I D L +  G TH  Y L ++D FE++   E         Q    K  R                 LLWHG+R TN   I+  GL+    +    G MFG G+YFA++ TKSANY  P  SK   F+LLCEV   T N L+
Sbjct:    7 ENGRGYKVHLCKTNIAQNNNKFYDMELLDEGGD--FIVKLINGRIGYRGVTQLKDF-DDLDRAKKFFESKFYEKTHLHWEERDD-EPVPNKYAVVELATNARQTEKEVKKEEPEPEPKVDEKNTRGRKKRGIVKEKKEIKKEEEPVEEVNEKLKELMKCICDEDVHLGLLKQLKFNEAFGRPIDCLSLAQLTTGYEILSKIEESIG-GKSARRSTRGRPRVADRVLAVKSDGPSLHDINKYYSLIPHSFGFCVPPKIDSHAKIQAERELLDALKGSIEASLELKDLKKTASSKDIY----QRLYERLPC--HLEPVSEEIAGKIGDCLAM-RGPTHC-YKLSLIDAFELKDPNEIPTEAPVEVQEVPKKRGRKSTKTAAPTVPPPTTKRLLWHGTRVTNVFSILMNGLQFPVGDR--CGLMFGNGVYFANVPTKSANYCCPEASKRV-FMLLCEVE--TANPLV 452          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Fly
Match: Parp (gene:FBgn0010247 transcript:FBtr0113885)

HSP 1 Score: 293.123 bits (749), Expect = 1.637e-85
Identity = 166/426 (38.97%), Postives = 263/426 (61.74%), Query Frame = 3
Query:  909 AKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGK-IGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEP--IESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVH--VHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQE---WQNFDDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPD 2162
            A +YV+++  + V+L  T++Q N N +Y +QLLK +K+  Y+++  W R+G  IG  KL  F +   +AK  F + + DKT N+++ R  F K  G+   ++I Y   + L        VK E     SKLE  +Q+L++++FD+  MN  + E   D +K+PLG+L+  QI++ Y  ++EI  +L  G ++ K L+ A N +YT IPH+FG+++P LI +  +I+   ++L++L++I++A  +I ++EDV    +PLD HY  +   +  +  ++  + +++ Y+  TH STH +Y+L+++D+F+V ++ E   ++ F    NR LLWHGSR TN+ GI+S GLRIAP EAP TG+MFGKGIYFADM +KSANY   ++  +TG +LL EV+LG   E        NKL  N HS  G G   PD
Sbjct:  526 AHVYVDSNNKYSVVLGLTDIQRNKNSYYKVQLLKADKKEKYWIFRSWGRIGTNIGNSKLEEF-DTSESAKRNFKEIYADKTGNEYEQRDNFVKRTGRMYPIEIQYDDDQKL--------VKHESHFFTSKLEISVQNLIKLIFDIDSMNKTLMEFHIDMDKMPLGKLSAHQIQSAYRVVKEIYNVLECGSNTAK-LIDATNRFYTLIPHNFGVQLPTLIETHQQIEDLRQMLDSLAEIEVAYSII-KSEDVSDACNPLDNHYAQIKTQLVALDKNSEEFSILSQYVKNTHASTHKSYDLKIVDVFKVSRQGEARRFKPFKKLHNRKLLWHGSRLTNFVGILSHGLRIAPPEAPPTGYMFGKGIYFADMVSKSANYCCTSQQNSTGLMLLSEVALGDMMECTSAK-YINKLSNNKHSCFGRGRTMPD 939          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Zebrafish
Match: parp2 (poly (ADP-ribose) polymerase 2 [Source:ZFIN;Acc:ZDB-GENE-031113-6])

HSP 1 Score: 455.677 bits (1171), Expect = 2.195e-150
Identity = 232/432 (53.70%), Postives = 304/432 (70.37%), Query Frame = 3
Query:  873 PVDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIA-SQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNFDDK-GNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPD 2162
            PVD ECK    KA +Y E ++V+DVMLNQTNLQFNNNK+Y+IQLL+D+    Y VW+RW RVGK+GQ  L     NLA AK+ F KKF+DKTKN+W+ R  FEK+ GKYD+V +DY  ++  E   +  S  + +P +  L  K+Q L+ ++ DLK M + V EMK+D  K PLG+LT  QI+AGY +L+ IE  L +   SNK L+ ACN +YTRIPHDFG+R PP+IRS  E+K ++ LLETLSDI+IA+K++  N     HPLDR Y +L+C +  +  D+  Y++I  YL  TH  THT Y + +LD+F V +E E  NF+ +  NRMLLWHGSR +N+ GI+SQGLR+APAEAPVTG+MFGKGIYFADMS+KSANY + ++  N G LLL EV+LG  NEL+  +  A++LP   HS KGLG  APD
Sbjct:  161 PVDPECKAKLGKAHVYNEGADVYDVMLNQTNLQFNNNKYYLIQLLEDDSAKAYSVWLRWGRVGKVGQNNLVSCGANLAQAKDTFKKKFFDKTKNEWEHRASFEKVAGKYDMVFMDYSTEDKGEEKAVVPSATQKKPCQ--LNSKVQSLLELICDLKAMEECVLEMKFDTKKAPLGKLTAEQIRAGYASLKRIEECLKK-KGSNKELLDACNQFYTRIPHDFGLRTPPIIRSEEELKEKITLLETLSDIQIAVKMVQSNVKSDEHPLDRQYHSLNCQLQPLDTDSNEYKVIEKYLKSTHAPTHTDYTMTLLDVFAVEREVEKDNFNSELQNRMLLWHGSRLSNWVGILSQGLRVAPAEAPVTGYMFGKGIYFADMSSKSANYCFASQKNNQGLLLLSEVALGDSNELLDADYNADQLPSGKHSTKGLGQTAPD 589          

HSP 2 Score: 51.6026 bits (122), Expect = 3.758e-6
Identity = 25/48 (52.08%), Postives = 35/48 (72.92%), Query Frame = 2
Query: 2243 DGTLVPVGIPVDTGVGEKRKGAYVLNYNEYIVYKQNQVKMRFLVKVRF 2386
            +G  VP+G  V TGVG+K  G Y L YNEYIVY   Q++M++L++V+F
Sbjct:  597 NGVTVPLGPSVKTGVGQK--GGYSLLYNEYIVYNPAQIQMKYLLRVQF 642          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Zebrafish
Match: parp2 (poly (ADP-ribose) polymerase 2 [Source:ZFIN;Acc:ZDB-GENE-031113-6])

HSP 1 Score: 455.677 bits (1171), Expect = 2.467e-150
Identity = 232/432 (53.70%), Postives = 304/432 (70.37%), Query Frame = 3
Query:  873 PVDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIA-SQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNFDDK-GNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPD 2162
            PVD ECK    KA +Y E ++V+DVMLNQTNLQFNNNK+Y+IQLL+D+    Y VW+RW RVGK+GQ  L     NLA AK+ F KKF+DKTKN+W+ R  FEK+ GKYD+V +DY  ++  E   +  S  + +P +  L  K+Q L+ ++ DLK M + V EMK+D  K PLG+LT  QI+AGY +L+ IE  L +   SNK L+ ACN +YTRIPHDFG+R PP+IRS  E+K ++ LLETLSDI+IA+K++  N     HPLDR Y +L+C +  +  D+  Y++I  YL  TH  THT Y + +LD+F V +E E  NF+ +  NRMLLWHGSR +N+ GI+SQGLR+APAEAPVTG+MFGKGIYFADMS+KSANY + ++  N G LLL EV+LG  NEL+  +  A++LP   HS KGLG  APD
Sbjct:  162 PVDPECKAKLGKAHVYNEGADVYDVMLNQTNLQFNNNKYYLIQLLEDDSAKAYSVWLRWGRVGKVGQNNLVSCGANLAQAKDTFKKKFFDKTKNEWEHRASFEKVAGKYDMVFMDYSTEDKGEEKAVVPSATQKKPCQ--LNSKVQSLLELICDLKAMEECVLEMKFDTKKAPLGKLTAEQIRAGYASLKRIEECLKK-KGSNKELLDACNQFYTRIPHDFGLRTPPIIRSEEELKEKITLLETLSDIQIAVKMVQSNVKSDEHPLDRQYHSLNCQLQPLDTDSNEYKVIEKYLKSTHAPTHTDYTMTLLDVFAVEREVEKDNFNSELQNRMLLWHGSRLSNWVGILSQGLRVAPAEAPVTGYMFGKGIYFADMSSKSANYCFASQKNNQGLLLLSEVALGDSNELLDADYNADQLPSGKHSTKGLGQTAPD 590          

HSP 2 Score: 51.6026 bits (122), Expect = 3.826e-6
Identity = 25/48 (52.08%), Postives = 35/48 (72.92%), Query Frame = 2
Query: 2243 DGTLVPVGIPVDTGVGEKRKGAYVLNYNEYIVYKQNQVKMRFLVKVRF 2386
            +G  VP+G  V TGVG+K  G Y L YNEYIVY   Q++M++L++V+F
Sbjct:  598 NGVTVPLGPSVKTGVGQK--GGYSLLYNEYIVYNPAQIQMKYLLRVQF 643          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Zebrafish
Match: parp2 (poly (ADP-ribose) polymerase 2 [Source:ZFIN;Acc:ZDB-GENE-031113-6])

HSP 1 Score: 427.172 bits (1097), Expect = 2.296e-139
Identity = 224/432 (51.85%), Postives = 295/432 (68.29%), Query Frame = 3
Query:  873 PVDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIA-SQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNFDDK-GNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPD 2162
            PVD ECK  +   K+   N      +L  TNLQFNNNK+Y+IQLL+D+    Y VW+RW RVGK+GQ  L     NLA AK+ F KKF+DKTKN+W+ R  FEK+ GKYD+V +DY  ++  E   +  S  + +P +  L  K+Q L+ ++ DLK M + V EMK+D  K PLG+LT  QI+AGY +L+ IE  L +   SNK L+ ACN +YTRIPHDFG+R PP+IRS  E+K ++ LLETLSDI+IA+K++  N     HPLDR Y +L+C +  +  D+  Y++I  YL  TH  THT Y + +LD+F V +E E  NF+ +  NRMLLWHGSR +N+ GI+SQGLR+APAEAPVTG+MFGKGIYFADMS+KSANY + ++  N G LLL EV+LG  NEL+  +  A++LP   HS KGLG  APD
Sbjct:  162 PVDPECK--AKLGKVIALNVLFGHKVLIATNLQFNNNKYYLIQLLEDDSAKAYSVWLRWGRVGKVGQNNLVSCGANLAQAKDTFKKKFFDKTKNEWEHRASFEKVAGKYDMVFMDYSTEDKGEEKAVVPSATQKKPCQ--LNSKVQSLLELICDLKAMEECVLEMKFDTKKAPLGKLTAEQIRAGYASLKRIEECLKK-KGSNKELLDACNQFYTRIPHDFGLRTPPIIRSEEELKEKITLLETLSDIQIAVKMVQSNVKSDEHPLDRQYHSLNCQLQPLDTDSNEYKVIEKYLKSTHAPTHTDYTMTLLDVFAVEREVEKDNFNSELQNRMLLWHGSRLSNWVGILSQGLRVAPAEAPVTGYMFGKGIYFADMSSKSANYCFASQKNNQGLLLLSEVALGDSNELLDADYNADQLPSGKHSTKGLGQTAPD 588          

HSP 2 Score: 51.6026 bits (122), Expect = 3.567e-6
Identity = 25/48 (52.08%), Postives = 35/48 (72.92%), Query Frame = 2
Query: 2243 DGTLVPVGIPVDTGVGEKRKGAYVLNYNEYIVYKQNQVKMRFLVKVRF 2386
            +G  VP+G  V TGVG+K  G Y L YNEYIVY   Q++M++L++V+F
Sbjct:  596 NGVTVPLGPSVKTGVGQK--GGYSLLYNEYIVYNPAQIQMKYLLRVQF 641          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Zebrafish
Match: parp1 (poly (ADP-ribose) polymerase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-3955])

HSP 1 Score: 312.383 bits (799), Expect = 2.552e-92
Identity = 180/454 (39.65%), Postives = 280/454 (61.67%), Query Frame = 3
Query:  828 KENGSITVGME---KLDIPVDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGK-IGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLV-QACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINEN-EDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQN---FDDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPD 2162
            +E GS +  M+   K    VD +    +C A +  +N +++   L   ++    N +Y +QLL+D+ +  Y+V+  W RVG  IG  KL +FY+   +A + F   + +KT N W     F K   K+  ++IDY + E      +    +    +S+LE+ +QDL+R++FD++ M  A+ E + D  K+PLG+L++ QI++ Y  L E++  +++  SS++SL+    N +YT IPHDFGM+ PPL+ ++  I++++++L+ L DI++A  L+    E+    P+D +Y+ L   I +V   +   QLI  Y+  TH +TH TY L++ ++F++ +E E+Q    F +  NR LLWHGSRTTNY GI+SQGLRIAP EAPVTG+MFGKG+YFADM +KSANY + +++   G +LL EV+LG  +EL K+ S   KLP   HSVKGLG  APD
Sbjct:  511 EEGGSKSKKMKLTVKGGAAVDPDSGLENC-AHVLEQNGKIYSATLGLVDIVRGTNSYYKLQLLEDDVQKRYWVFRSWGRVGTTIGGNKLDKFYDK-NSAMDNFCGVYEEKTGNAWASSN-FTKYPNKFYPLEIDYGQDE----EAVKKLTQSAGAKSQLEKPVQDLIRMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAYSLLSEVQQAVAD--SSSESLILDLSNRFYTLIPHDFGMKKPPLLSNVDYIQQKVQMLDNLLDIEVAYSLLRGGVENNEKDPIDINYEKLKTKIEVVDKSSHEAQLILQYVKNTHAATHNTYTLDVEEIFKIEREGEYQRYRPFKELPNRQLLWHGSRTTNYAGILSQGLRIAPPEAPVTGYMFGKGVYFADMVSKSANYCHTSQADPVGLILLGEVALGNMHEL-KKASHITKLPKGKHSVKGLGRSAPD 954          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Zebrafish
Match: parp1 (poly (ADP-ribose) polymerase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-3955])

HSP 1 Score: 312.383 bits (799), Expect = 2.797e-92
Identity = 180/454 (39.65%), Postives = 280/454 (61.67%), Query Frame = 3
Query:  828 KENGSITVGME---KLDIPVDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGK-IGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLV-QACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINEN-EDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQN---FDDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPD 2162
            +E GS +  M+   K    VD +    +C A +  +N +++   L   ++    N +Y +QLL+D+ +  Y+V+  W RVG  IG  KL +FY+   +A + F   + +KT N W     F K   K+  ++IDY + E      +    +    +S+LE+ +QDL+R++FD++ M  A+ E + D  K+PLG+L++ QI++ Y  L E++  +++  SS++SL+    N +YT IPHDFGM+ PPL+ ++  I++++++L+ L DI++A  L+    E+    P+D +Y+ L   I +V   +   QLI  Y+  TH +TH TY L++ ++F++ +E E+Q    F +  NR LLWHGSRTTNY GI+SQGLRIAP EAPVTG+MFGKG+YFADM +KSANY + +++   G +LL EV+LG  +EL K+ S   KLP   HSVKGLG  APD
Sbjct:  513 EEGGSKSKKMKLTVKGGAAVDPDSGLENC-AHVLEQNGKIYSATLGLVDIVRGTNSYYKLQLLEDDVQKRYWVFRSWGRVGTTIGGNKLDKFYDK-NSAMDNFCGVYEEKTGNAWASSN-FTKYPNKFYPLEIDYGQDE----EAVKKLTQSAGAKSQLEKPVQDLIRMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAYSLLSEVQQAVAD--SSSESLILDLSNRFYTLIPHDFGMKKPPLLSNVDYIQQKVQMLDNLLDIEVAYSLLRGGVENNEKDPIDINYEKLKTKIEVVDKSSHEAQLILQYVKNTHAATHNTYTLDVEEIFKIEREGEYQRYRPFKELPNRQLLWHGSRTTNYAGILSQGLRIAPPEAPVTGYMFGKGVYFADMVSKSANYCHTSQADPVGLILLGEVALGNMHEL-KKASHITKLPKGKHSVKGLGRSAPD 956          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Xenopus
Match: gldn (gliomedin [Source:Xenbase;Acc:XB-GENE-1004090])

HSP 1 Score: 432.565 bits (1111), Expect = 1.369e-142
Identity = 215/433 (49.65%), Postives = 294/433 (67.90%), Query Frame = 3
Query:  873 PVDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKI--ASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNF-DDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPD 2162
            PVD EC     +A ++ E  +V+DVMLNQTNLQFNNNK+Y+IQLL+D+    + VWMRW RVGK+GQ  L     +L  AK+ F KKF DKTKN W +R +FEK  GKYD++Q+DY   E  E   +   S   L  +E +L+  +Q+L++++ +LK M + V EMK+D  K PLG+LT  QI+AGY +L+ IE  + +     + L++ACN +YTRIPHDFG+R PPLIR++ ++  ++ LLE L DI+IA+KL + + +   HP+DR Y+ L+C I  +   +  +QLI+ YL  TH  TH  Y + +L +FE+++  E  +F  D  NRMLLWHGSR TN+ GI+SQGLR+AP EAPVTG+MFGKGIYFAD+S+KSANY + +R KN G LLL EV+LG  NEL+  +  A K   + HS KGLG   PD
Sbjct:   58 PVDPECSTKLGRAHVFCEGDDVYDVMLNQTNLQFNNNKYYLIQLLEDDGVRNFSVWMRWGRVGKVGQNSLVCCGGDLQKAKDIFQKKFLDKTKNLWTERAQFEKCPGKYDMLQMDYNATEQEEERAVKEESLADLPKLECQLDLSIQELIQLICNLKAMEETVLEMKFDTKKAPLGKLTVDQIRAGYCSLQRIENCIKK-QKFGRDLLEACNEFYTRIPHDFGLRTPPLIRTLEDLTVKVRLLEALGDIQIAVKLASMDLNSLEHPIDRQYRQLNCSIQPLDKTSSTFQLIDGYLQSTHAPTHNDYTMTLLQVFELQRMGEECSFRADLPNRMLLWHGSRLTNWVGILSQGLRVAPPEAPVTGYMFGKGIYFADVSSKSANYCFSSRDKNVGVLLLSEVALGESNELLAADYDAQKKLKSKHSTKGLGRSIPD 489          

HSP 2 Score: 52.373 bits (124), Expect = 2.816e-6
Identity = 24/49 (48.98%), Postives = 34/49 (69.39%), Query Frame = 2
Query: 2240 EDGTLVPVGIPVDTGVGEKRKGAYVLNYNEYIVYKQNQVKMRFLVKVRF 2386
             DG +VP+G  +DTG+       Y LNYNEYIVY  +QV+M++L++V F
Sbjct:  496 HDGAVVPLGPLIDTGM--TNDSDYTLNYNEYIVYDPHQVRMKYLLQVHF 542          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Xenopus
Match: gldn (gliomedin [Source:Xenbase;Acc:XB-GENE-1004090])

HSP 1 Score: 433.721 bits (1114), Expect = 3.427e-140
Identity = 215/433 (49.65%), Postives = 294/433 (67.90%), Query Frame = 3
Query:  873 PVDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKI--ASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNF-DDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPD 2162
            PVD EC     +A ++ E  +V+DVMLNQTNLQFNNNK+Y+IQLL+D+    + VWMRW RVGK+GQ  L     +L  AK+ F KKF DKTKN W +R +FEK  GKYD++Q+DY   E  E   +   S   L  +E +L+  +Q+L++++ +LK M + V EMK+D  K PLG+LT  QI+AGY +L+ IE  + +     + L++ACN +YTRIPHDFG+R PPLIR++ ++  ++ LLE L DI+IA+KL + + +   HP+DR Y+ L+C I  +   +  +QLI+ YL  TH  TH  Y + +L +FE+++  E  +F  D  NRMLLWHGSR TN+ GI+SQGLR+AP EAPVTG+MFGKGIYFAD+S+KSANY + +R KN G LLL EV+LG  NEL+  +  A K   + HS KGLG   PD
Sbjct:  252 PVDPECSTKLGRAHVFCEGDDVYDVMLNQTNLQFNNNKYYLIQLLEDDGVRNFSVWMRWGRVGKVGQNSLVCCGGDLQKAKDIFQKKFLDKTKNLWTERAQFEKCPGKYDMLQMDYNATEQEEERAVKEESLADLPKLECQLDLSIQELIQLICNLKAMEETVLEMKFDTKKAPLGKLTVDQIRAGYCSLQRIENCIKK-QKFGRDLLEACNEFYTRIPHDFGLRTPPLIRTLEDLTVKVRLLEALGDIQIAVKLASMDLNSLEHPIDRQYRQLNCSIQPLDKTSSTFQLIDGYLQSTHAPTHNDYTMTLLQVFELQRMGEECSFRADLPNRMLLWHGSRLTNWVGILSQGLRVAPPEAPVTGYMFGKGIYFADVSSKSANYCFSSRDKNVGVLLLSEVALGESNELLAADYDAQKKLKSKHSTKGLGRSIPD 683          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Xenopus
Match: gldn (gliomedin [Source:Xenbase;Acc:XB-GENE-1004090])

HSP 1 Score: 433.335 bits (1113), Expect = 6.825e-140
Identity = 215/433 (49.65%), Postives = 294/433 (67.90%), Query Frame = 3
Query:  873 PVDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKI--ASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNF-DDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPD 2162
            PVD EC     +A ++ E  +V+DVMLNQTNLQFNNNK+Y+IQLL+D+    + VWMRW RVGK+GQ  L     +L  AK+ F KKF DKTKN W +R +FEK  GKYD++Q+DY   E  E   +   S   L  +E +L+  +Q+L++++ +LK M + V EMK+D  K PLG+LT  QI+AGY +L+ IE  + +     + L++ACN +YTRIPHDFG+R PPLIR++ ++  ++ LLE L DI+IA+KL + + +   HP+DR Y+ L+C I  +   +  +QLI+ YL  TH  TH  Y + +L +FE+++  E  +F  D  NRMLLWHGSR TN+ GI+SQGLR+AP EAPVTG+MFGKGIYFAD+S+KSANY + +R KN G LLL EV+LG  NEL+  +  A K   + HS KGLG   PD
Sbjct:  252 PVDPECSTKLGRAHVFCEGDDVYDVMLNQTNLQFNNNKYYLIQLLEDDGVRNFSVWMRWGRVGKVGQNSLVCCGGDLQKAKDIFQKKFLDKTKNLWTERAQFEKCPGKYDMLQMDYNATEQEEERAVKEESLADLPKLECQLDLSIQELIQLICNLKAMEETVLEMKFDTKKAPLGKLTVDQIRAGYCSLQRIENCIKK-QKFGRDLLEACNEFYTRIPHDFGLRTPPLIRTLEDLTVKVRLLEALGDIQIAVKLASMDLNSLEHPIDRQYRQLNCSIQPLDKTSSTFQLIDGYLQSTHAPTHNDYTMTLLQVFELQRMGEECSFRADLPNRMLLWHGSRLTNWVGILSQGLRVAPPEAPVTGYMFGKGIYFADVSSKSANYCFSSRDKNVGVLLLSEVALGESNELLAADYDAQKKLKSKHSTKGLGRSIPD 683          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Xenopus
Match: gldn (gliomedin [Source:Xenbase;Acc:XB-GENE-1004090])

HSP 1 Score: 402.134 bits (1032), Expect = 6.147e-132
Identity = 203/407 (49.88%), Postives = 277/407 (68.06%), Query Frame = 3
Query:  951 LNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIA--SQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNF-DDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPD 2162
            L QTNLQFNNNK+Y+IQLL+D+    + VWMRW RVGK+GQ  L     +L  AK+ F KKF DKTKN W +R +FEK  GKYD++Q+DY   E  E   +   S   L  +E +L+  +Q+L++++ +LK M + V EMK+D  K PLG+LT  QI+AGY +L+ IE  + +     + L++ACN +YTRIPHDFG+R PPLIR++ ++  ++ LLE L DI+IA+KL + + +   HP+DR Y+ L+C I  +   +  +QLI+ YL  TH  TH  Y + +L +FE+++  E  +F  D  NRMLLWHGSR TN+ GI+SQGLR+AP EAPVTG+MFGKGIYFAD+S+KSANY + +R KN G LLL EV+LG  NEL+  +  A K   + HS KGLG   PD
Sbjct:   10 LLQTNLQFNNNKYYLIQLLEDDGVRNFSVWMRWGRVGKVGQNSLVCCGGDLQKAKDIFQKKFLDKTKNLWTERAQFEKCPGKYDMLQMDYNATEQEEERAVKEESLADLPKLECQLDLSIQELIQLICNLKAMEETVLEMKFDTKKAPLGKLTVDQIRAGYCSLQRIENCIKK-QKFGRDLLEACNEFYTRIPHDFGLRTPPLIRTLEDLTVKVRLLEALGDIQIAVKLASMDLNSLEHPIDRQYRQLNCSIQPLDKTSSTFQLIDGYLQSTHAPTHNDYTMTLLQVFELQRMGEECSFRADLPNRMLLWHGSRLTNWVGILSQGLRVAPPEAPVTGYMFGKGIYFADVSSKSANYCFSSRDKNVGVLLLSEVALGESNELLAADYDAQKKLKSKHSTKGLGRSIPD 415          

HSP 2 Score: 52.373 bits (124), Expect = 2.250e-6
Identity = 24/49 (48.98%), Postives = 34/49 (69.39%), Query Frame = 2
Query: 2240 EDGTLVPVGIPVDTGVGEKRKGAYVLNYNEYIVYKQNQVKMRFLVKVRF 2386
             DG +VP+G  +DTG+       Y LNYNEYIVY  +QV+M++L++V F
Sbjct:  422 HDGAVVPLGPLIDTGM--TNDSDYTLNYNEYIVYDPHQVRMKYLLQVHF 468          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Xenopus
Match: gldn (gliomedin [Source:Xenbase;Acc:XB-GENE-1004090])

HSP 1 Score: 401.749 bits (1031), Expect = 8.561e-132
Identity = 203/405 (50.12%), Postives = 276/405 (68.15%), Query Frame = 3
Query:  951 LNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNF-DDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPD 2162
            L QTNLQFNNNK+Y+IQLL+D+    + VWMRW RVGK+GQ  L     +L  AK+ F KKF DKTKN W +R +FEK  GKYD++Q+DY   E  E     S   L  +E +L+  +Q+L++++ +LK M + V EMK+D  K PLG+LT  QI+AGY +L+ IE  + +     + L++ACN +YTRIPHDFG+R PPLIR++ ++  ++ LLE L DI+IA+KL + + +   HP+DR Y+ L+C I  +   +  +QLI+ YL  TH  TH  Y + +L +FE+++  E  +F  D  NRMLLWHGSR TN+ GI+SQGLR+AP EAPVTG+MFGKGIYFAD+S+KSANY + +R KN G LLL EV+LG  NEL+  +  A K   + HS KGLG   PD
Sbjct:   13 LLQTNLQFNNNKYYLIQLLEDDGVRNFSVWMRWGRVGKVGQNSLVCCGGDLQKAKDIFQKKFLDKTKNLWTERAQFEKCPGKYDMLQMDYNATEQEE-----SLADLPKLECQLDLSIQELIQLICNLKAMEETVLEMKFDTKKAPLGKLTVDQIRAGYCSLQRIENCIKK-QKFGRDLLEACNEFYTRIPHDFGLRTPPLIRTLEDLTVKVRLLEALGDIQIAVKLASMDLNSLEHPIDRQYRQLNCSIQPLDKTSSTFQLIDGYLQSTHAPTHNDYTMTLLQVFELQRMGEECSFRADLPNRMLLWHGSRLTNWVGILSQGLRVAPPEAPVTGYMFGKGIYFADVSSKSANYCFSSRDKNVGVLLLSEVALGESNELLAADYDAQKKLKSKHSTKGLGRSIPD 411          

HSP 2 Score: 52.7582 bits (125), Expect = 2.068e-6
Identity = 24/49 (48.98%), Postives = 34/49 (69.39%), Query Frame = 2
Query: 2240 EDGTLVPVGIPVDTGVGEKRKGAYVLNYNEYIVYKQNQVKMRFLVKVRF 2386
             DG +VP+G  +DTG+       Y LNYNEYIVY  +QV+M++L++V F
Sbjct:  418 HDGAVVPLGPLIDTGM--TNDSDYTLNYNEYIVYDPHQVRMKYLLQVHF 464          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Mouse
Match: Parp2 (poly (ADP-ribose) polymerase family, member 2 [Source:MGI Symbol;Acc:MGI:1341112])

HSP 1 Score: 471.085 bits (1211), Expect = 1.627e-157
Identity = 228/441 (51.70%), Postives = 313/441 (70.98%), Query Frame = 3
Query:  840 SITVGMEKLDIPVDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNF-DDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAP 2159
            S+   + K   PVD EC     KA +Y E  +V+DVMLNQTNLQFNNNK+Y+IQLL+D+ +  + VWMRW RVGK GQ  L     +L  AKE F KKF DKTKN+W+DR+ FEK+ GKYD++Q+DY      E+ K   +  L+P ES+L+ ++Q+L++++ +++ M + + EMKYD  + PLG+LT AQIKAGY +L++IE  +  G    ++LV+ACN +YTRIPHDFG+ IPP+IR+  E+  +++LLE L DI+IALKL+        HPLD+HY+NLHC +  +  ++  +++I+ YL  TH  TH  Y + +LD+FEV KE E + F +D  NRMLLWHGSR +N+ GI+S GLR+AP EAP+TG+MFGKGIYFADMS+KSANY + +R KNTG LLL EV+LG CNEL++ N +A  L    HS KG+G +AP
Sbjct:   62 SVKTLLLKGKAPVDPECAAKLGKAHVYCEGDDVYDVMLNQTNLQFNNNKYYLIQLLEDDAQRNFSVWMRWGRVGKTGQHSLVTCSGDLNKAKEIFQKKFLDKTKNNWEDRENFEKVPGKYDMLQMDYAASTQDES-KTKEEETLKP-ESQLDLRVQELLKLICNVQTMEEMMIEMKYDTKRAPLGKLTVAQIKAGYQSLKKIEDCIRAGQHG-RALVEACNEFYTRIPHDFGLSIPPVIRTEKELSDKVKLLEALGDIEIALKLVKSERQGLEHPLDQHYRNLHCALRPLDHESNEFKVISQYLQSTHAPTHKDYTMTLLDVFEVEKEGEKEAFREDLPNRMLLWHGSRLSNWVGILSHGLRVAPPEAPITGYMFGKGIYFADMSSKSANYCFASRLKNTGLLLLSEVALGQCNELLEANPKAQGLLRGKHSTKGMGKMAP 499          

HSP 2 Score: 53.1434 bits (126), Expect = 1.244e-6
Identity = 24/48 (50.00%), Postives = 34/48 (70.83%), Query Frame = 2
Query: 2243 DGTLVPVGIPVDTGVGEKRKGAYVLNYNEYIVYKQNQVKMRFLVKVRF 2386
            +G+ VP+G   DTG+       Y LNYNE+IVY  NQV+MR+L+K++F
Sbjct:  508 NGSTVPLGPASDTGILNPE--GYTLNYNEFIVYSPNQVRMRYLLKIQF 553          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Mouse
Match: Parp1 (poly (ADP-ribose) polymerase family, member 1 [Source:MGI Symbol;Acc:MGI:1340806])

HSP 1 Score: 316.235 bits (809), Expect = 1.233e-93
Identity = 174/427 (40.75%), Postives = 264/427 (61.83%), Query Frame = 3
Query:  909 AKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGK-IGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEP-IESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLI-NENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKE---QEWQNFDDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPDQST 2171
            A +  +  +VF   L   ++    N +Y +QLL+D+KE  Y+++  W RVG  IG  KL +  +   A  E FMK + +KT N W  +  F K   K+  ++IDY + E     +   ++ ++P  +SKL + +Q+L+ ++FD++ M  A+ E + D  K+PLG+L+  QI+A Y  L E++  +S+G SS   ++   N +YT IPHDFGM+ PPL+ +   ++ ++E+L+ L DI++A  L+   ++D    P+D +Y+ L   I +V  D+   ++I  Y+  TH +TH  Y+LE++D+F++ +E   Q ++ F    NR LLWHGSRTTN+ GI+SQGLRIAP EAPVTG+MFGKGIYFADM +KSANY + ++    G +LL EV+LG   EL K  S  +KLP   HSVKGLG   PD S 
Sbjct:  543 AHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKESRYWIFRSWGRVGTVIGSNKLEQMPSKEDAV-EHFMKLYEEKTGNAWHSKN-FTKYPKKFYPLEIDYGQDE-----EAVKKLTVKPGTKSKLPKPVQELVGMIFDVESMKKALVEYEIDLQKMPLGKLSRRQIQAAYSILSEVQQAVSQG-SSESQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEVIRKYVKNTHATTHNAYDLEVIDIFKIEREGESQRYKPFRQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEVALGNMYEL-KHASHISKLPKGKHSVKGLGKTTPDPSA 960          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Mouse
Match: Parp3 (poly (ADP-ribose) polymerase family, member 3 [Source:MGI Symbol;Acc:MGI:1891258])

HSP 1 Score: 180.644 bits (457), Expect = 2.231e-48
Identity = 153/450 (34.00%), Postives = 231/450 (51.33%), Query Frame = 3
Query:  870 IPVDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDY-CKKEILETNKIASQVKLEPIES-----KLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKL------INENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNFDDK---GNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTR--SKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPDQS 2168
            I VD  C   S    I V   E +D  LNQTN+  NNNKFYIIQLL++     ++ W RW RVG++GQ K+  F   L  AK+ F KKF++KTKN W++R +F     KY L+++    + +      ++ QV   P+ +      L+   Q+L+  +F  +   +A++ M  D  K+PLG+LT+ QI  G+ AL  +E  +       +SL +  + +YT IPH+FG   PP I S   ++ + ++L  L+DI++A  L        E  +   HPLDR YQ L C + L+      Y+ I  YL  T G+++   +L    +++V +E E   F      GNR LLWHG+       I++ GLRI P     +G   GKGIYFA  ++KSA Y+          G++ L EV+LG  + +  ++      P    SV   G   PD +
Sbjct:   44 IRVDPSCP-FSRNPGIQVH--EDYDCTLNQTNIGNNNNKFYIIQLLEEGSR--FFCWNRWGRVGEVGQSKMNHF-TCLEDAKKDFKKKFWEKTKNKWEERDRFVAQPNKYTLIEVQGEAESQEAVVKALSPQVYSGPVRTVVKPCSLDPATQNLITNIFSKEMFKNAMTLMNLDVKKMPLGKLTKQQIARGFEALEALEEAMKNPTGDGQSLEELSSCFYTVIPHNFGRSRPPPINSPDVLQAKKDMLLVLADIELAQTLQAAPGEEEEKVEEVPHPLDRDYQLLRCQLQLLDSGESEYKAIQTYLKQT-GNSYRCPDLR--HVWKVNREGEGDRFQAHSKLGNRRLLWHGTNVAVVAAILTSGLRIMPH----SGGRVGKGIYFASENSKSAGYVTTMHCGGHQVGYMFLGEVALGKEHHITIDDPSLKSPPSGFDSVIARGQTEPDPA 480          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Mouse
Match: Parp3 (poly (ADP-ribose) polymerase family, member 3 [Source:MGI Symbol;Acc:MGI:1891258])

HSP 1 Score: 179.874 bits (455), Expect = 3.869e-48
Identity = 153/449 (34.08%), Postives = 231/449 (51.45%), Query Frame = 3
Query:  870 IPVDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIES-----KLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKL------INENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNFDDK---GNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTR--SKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPDQS 2168
            I VD  C   S    I V   E +D  LNQTN+  NNNKFYIIQLL++     ++ W RW RVG++GQ K+  F   L  AK+ F KKF++KTKN W++R +F     KY L+++    +   E+ +   +V   P+ +      L+   Q+L+  +F  +   +A++ M  D  K+PLG+LT+ QI  G+ AL  +E  +       +SL +  + +YT IPH+FG   PP I S   ++ + ++L  L+DI++A  L        E  +   HPLDR YQ L C + L+      Y+ I  YL  T G+++   +L    +++V +E E   F      GNR LLWHG+       I++ GLRI P     +G   GKGIYFA  ++KSA Y+          G++ L EV+LG  + +  ++      P    SV   G   PD +
Sbjct:   44 IRVDPSCP-FSRNPGIQVH--EDYDCTLNQTNIGNNNNKFYIIQLLEEGSR--FFCWNRWGRVGEVGQSKMNHF-TCLEDAKKDFKKKFWEKTKNKWEERDRFVAQPNKYTLIEV----QGEAESQEAVVKVYSGPVRTVVKPCSLDPATQNLITNIFSKEMFKNAMTLMNLDVKKMPLGKLTKQQIARGFEALEALEEAMKNPTGDGQSLEELSSCFYTVIPHNFGRSRPPPINSPDVLQAKKDMLLVLADIELAQTLQAAPGEEEEKVEEVPHPLDRDYQLLRCQLQLLDSGESEYKAIQTYLKQT-GNSYRCPDLR--HVWKVNREGEGDRFQAHSKLGNRRLLWHGTNVAVVAAILTSGLRIMPH----SGGRVGKGIYFASENSKSAGYVTTMHCGGHQVGYMFLGEVALGKEHHITIDDPSLKSPPSGFDSVIARGQTEPDPA 475          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Mouse
Match: Parp3 (poly (ADP-ribose) polymerase family, member 3 [Source:MGI Symbol;Acc:MGI:1891258])

HSP 1 Score: 179.874 bits (455), Expect = 3.869e-48
Identity = 153/449 (34.08%), Postives = 231/449 (51.45%), Query Frame = 3
Query:  870 IPVDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIES-----KLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKL------INENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNFDDK---GNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTR--SKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPDQS 2168
            I VD  C   S    I V   E +D  LNQTN+  NNNKFYIIQLL++     ++ W RW RVG++GQ K+  F   L  AK+ F KKF++KTKN W++R +F     KY L+++    +   E+ +   +V   P+ +      L+   Q+L+  +F  +   +A++ M  D  K+PLG+LT+ QI  G+ AL  +E  +       +SL +  + +YT IPH+FG   PP I S   ++ + ++L  L+DI++A  L        E  +   HPLDR YQ L C + L+      Y+ I  YL  T G+++   +L    +++V +E E   F      GNR LLWHG+       I++ GLRI P     +G   GKGIYFA  ++KSA Y+          G++ L EV+LG  + +  ++      P    SV   G   PD +
Sbjct:   44 IRVDPSCP-FSRNPGIQVH--EDYDCTLNQTNIGNNNNKFYIIQLLEEGSR--FFCWNRWGRVGEVGQSKMNHF-TCLEDAKKDFKKKFWEKTKNKWEERDRFVAQPNKYTLIEV----QGEAESQEAVVKVYSGPVRTVVKPCSLDPATQNLITNIFSKEMFKNAMTLMNLDVKKMPLGKLTKQQIARGFEALEALEEAMKNPTGDGQSLEELSSCFYTVIPHNFGRSRPPPINSPDVLQAKKDMLLVLADIELAQTLQAAPGEEEEKVEEVPHPLDRDYQLLRCQLQLLDSGESEYKAIQTYLKQT-GNSYRCPDLR--HVWKVNREGEGDRFQAHSKLGNRRLLWHGTNVAVVAAILTSGLRIMPH----SGGRVGKGIYFASENSKSAGYVTTMHCGGHQVGYMFLGEVALGKEHHITIDDPSLKSPPSGFDSVIARGQTEPDPA 475          
BLAST of Poly [ADP-ribose] polymerase vs. UniProt/SwissProt
Match: sp|O88554|PARP2_MOUSE (Poly [ADP-ribose] polymerase 2 OS=Mus musculus OX=10090 GN=Parp2 PE=1 SV=3)

HSP 1 Score: 471.085 bits (1211), Expect = 1.138e-156
Identity = 228/441 (51.70%), Postives = 313/441 (70.98%), Query Frame = 3
Query:  840 SITVGMEKLDIPVDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNF-DDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAP 2159
            S+   + K   PVD EC     KA +Y E  +V+DVMLNQTNLQFNNNK+Y+IQLL+D+ +  + VWMRW RVGK GQ  L     +L  AKE F KKF DKTKN+W+DR+ FEK+ GKYD++Q+DY      E+ K   +  L+P ES+L+ ++Q+L++++ +++ M + + EMKYD  + PLG+LT AQIKAGY +L++IE  +  G    ++LV+ACN +YTRIPHDFG+ IPP+IR+  E+  +++LLE L DI+IALKL+        HPLD+HY+NLHC +  +  ++  +++I+ YL  TH  TH  Y + +LD+FEV KE E + F +D  NRMLLWHGSR +N+ GI+S GLR+AP EAP+TG+MFGKGIYFADMS+KSANY + +R KNTG LLL EV+LG CNEL++ N +A  L    HS KG+G +AP
Sbjct:   62 SVKTLLLKGKAPVDPECAAKLGKAHVYCEGDDVYDVMLNQTNLQFNNNKYYLIQLLEDDAQRNFSVWMRWGRVGKTGQHSLVTCSGDLNKAKEIFQKKFLDKTKNNWEDRENFEKVPGKYDMLQMDYAASTQDES-KTKEEETLKP-ESQLDLRVQELLKLICNVQTMEEMMIEMKYDTKRAPLGKLTVAQIKAGYQSLKKIEDCIRAGQHG-RALVEACNEFYTRIPHDFGLSIPPVIRTEKELSDKVKLLEALGDIEIALKLVKSERQGLEHPLDQHYRNLHCALRPLDHESNEFKVISQYLQSTHAPTHKDYTMTLLDVFEVEKEGEKEAFREDLPNRMLLWHGSRLSNWVGILSHGLRVAPPEAPITGYMFGKGIYFADMSSKSANYCFASRLKNTGLLLLSEVALGQCNELLEANPKAQGLLRGKHSTKGMGKMAP 499          

HSP 2 Score: 53.1434 bits (126), Expect = 8.700e-6
Identity = 24/48 (50.00%), Postives = 34/48 (70.83%), Query Frame = 2
Query: 2243 DGTLVPVGIPVDTGVGEKRKGAYVLNYNEYIVYKQNQVKMRFLVKVRF 2386
            +G+ VP+G   DTG+       Y LNYNE+IVY  NQV+MR+L+K++F
Sbjct:  508 NGSTVPLGPASDTGILNPE--GYTLNYNEFIVYSPNQVRMRYLLKIQF 553          
BLAST of Poly [ADP-ribose] polymerase vs. UniProt/SwissProt
Match: sp|Q9UGN5|PARP2_HUMAN (Poly [ADP-ribose] polymerase 2 OS=Homo sapiens OX=9606 GN=PARP2 PE=1 SV=2)

HSP 1 Score: 468.003 bits (1203), Expect = 3.660e-155
Identity = 233/447 (52.13%), Postives = 321/447 (71.81%), Query Frame = 3
Query:  840 SITVGMEKLDIPVDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYC--KKEILETNKIAS-QVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNF-DDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPDQS 2168
            S+   + K   PVD EC     KA +Y E ++V+DVMLNQTNLQFNNNK+Y+IQLL+D+ +  + VWMRW RVGK+GQ  L     NL  AKE F KKF DKTKN+W+DR+KFEK+ GKYD++Q+DY    ++  ET K  S +  L+P ES+L+ ++Q+L++++ +++ M + + EMKY+  K PLG+LT AQIKAGY +L++IE  +  G    ++L++ACN +YTRIPHDFG+R PPLIR+  E+  +++LLE L DI+IA+KL+        HPLD+HY+NLHC +  +  ++  +++I+ YL  TH  TH+ Y + +LDLFEV K+ E + F +D  NRMLLWHGSR +N+ GI+S GLRIAP EAP+TG+MFGKGIYFADMS+KSANY + +R KNTG LLL EV+LG CNEL++ N +A  L    HS KGLG +AP  +
Sbjct:   82 SVKALLLKGKAPVDPECTAKVGKAHVYCEGNDVYDVMLNQTNLQFNNNKYYLIQLLEDDAQRNFSVWMRWGRVGKMGQHSLVACSGNLNKAKEIFQKKFLDKTKNNWEDREKFEKVPGKYDMLQMDYATNTQDEEETKKEESLKSPLKP-ESQLDLRVQELIKLICNVQAMEEMMMEMKYNTKKAPLGKLTVAQIKAGYQSLKKIEDCIRAGQHG-RALMEACNEFYTRIPHDFGLRTPPLIRTQKELSEKIQLLEALGDIEIAIKLVKTELQSPEHPLDQHYRNLHCALRPLDHESYEFKVISQYLQSTHAPTHSDYTMTLLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAPPEAPITGYMFGKGIYFADMSSKSANYCFASRLKNTGLLLLSEVALGQCNELLEANPKAEGLLQGKHSTKGLGKMAPSSA 526          

HSP 2 Score: 54.6842 bits (130), Expect = 2.815e-6
Identity = 26/48 (54.17%), Postives = 34/48 (70.83%), Query Frame = 2
Query: 2243 DGTLVPVGIPVDTGVGEKRKGAYVLNYNEYIVYKQNQVKMRFLVKVRF 2386
            +G+ VP+G   DTG+       Y LNYNEYIVY  NQV+MR+L+KV+F
Sbjct:  532 NGSTVPLGPASDTGI--LNPDGYTLNYNEYIVYNPNQVRMRYLLKVQF 577          
BLAST of Poly [ADP-ribose] polymerase vs. UniProt/SwissProt
Match: sp|Q11207|PARP2_ARATH (Poly [ADP-ribose] polymerase 2 OS=Arabidopsis thaliana OX=3702 GN=PARP2 PE=2 SV=1)

HSP 1 Score: 332.413 bits (851), Expect = 2.790e-102
Identity = 172/438 (39.27%), Postives = 267/438 (60.96%), Query Frame = 3
Query:  894 ELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKE---ILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPP--LIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQE---WQNFDDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPDQSTWKHL 2183
            E+  +  +     +V+D +LNQTN++ NNNKF+++Q+L+ + +  Y V+ RW RVG  GQ KL   Y++   A E F  KF DKTKN W DR++F      Y  +++DY K+E    +  +  +S  +++P +SKL+ ++   + ++ ++  M   + E+ Y+ NK+PLG+++++ I  GY  L+ I  ++         L +    +YT IPHDFG +     +I +  ++K+++E++E L +I++A KL++ +  +   PL  HYQ L+C +  V  D+  + ++ +Y+  TH  TH+ Y +E+  LF   +  E   +Q F    NRMLLWHGSR TN+ GI+SQGLRIAP EAPVTG+MFGKG+YFADM +KSANY Y     N G LLLCEV+LG  NEL+  +  A+ LPP   S KG+G  AP+ S  + L
Sbjct:  154 EIKSQYHVLQRGDDVYDAILNQTNVRDNNNKFFVLQVLESDSKKTYMVYTRWGRVGVKGQSKLDGPYDSWDRAIEIFTNKFNDKTKNYWSDRKEFIPHPKSYTWLEMDYGKEENDSPVNNDIPSSSSEVKPEQSKLDTRVAKFISLICNVSMMAQHMMEIGYNANKLPLGKISKSTISKGYEVLKRISEVID--RYDRTRLEELSGEFYTVIPHDFGFKKMSQFVIDTPQKLKQKIEMVEALGEIELATKLLSVDPGLQDDPLYYHYQQLNCGLTPVGNDSEEFSMVANYMENTHAKTHSGYTVEIAQLFRASRAVEADRFQQFSSSKNRMLLWHGSRLTNWAGILSQGLRIAPPEAPVTGYMFGKGVYFADMFSKSANYCYANTGANDGVLLLCEVALGDMNELLYSDYNADNLPPGKLSTKGVGKTAPNPSEAQTL 589          
BLAST of Poly [ADP-ribose] polymerase vs. UniProt/SwissProt
Match: sp|Q5Z8Q9|PRP2A_ORYSJ (Poly [ADP-ribose] polymerase 2-A OS=Oryza sativa subsp. japonica OX=39947 GN=PARP2-A PE=3 SV=2)

HSP 1 Score: 331.257 bits (848), Expect = 1.517e-101
Identity = 174/424 (41.04%), Postives = 260/424 (61.32%), Query Frame = 3
Query:  921 VENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRI--PPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQE---WQNFDDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPDQSTWK 2177
            ++  E++D  +NQTN+  NNNKFYIIQ L+ +    + V+ RW RVG  GQ KL   +++   A   F  KF+ KT N W DR+ FE    KY  +++DY + +  ETNK  S    +  E+KLE ++   + ++ ++  M   + E+ Y+++K+PLG+L+++ I  GY  L+ I  ++S   +  + L Q    +YT IPHDFG +     +I +  ++K +LE++E L +I+IA KL+ ++      PL   Y+ L C    + + +  Y +I  YL  THG THT+Y ++++ +F+V +  E   +Q F   GNRMLLWHGSR TN+ GI+SQGLRIAP EAPVTG+MFGKG+YFADM +KSANY Y + +  +G LLLCEV+LG  NEL+  +  AN LP    S KG+G   P+ +  K
Sbjct:  189 LKGDEIYDATMNQTNVGDNNNKFYIIQALESDAGGSFMVYNRWGRVGARGQDKLHGPFSSREQAIYEFEGKFHGKTNNHWSDRKSFECYARKYTWLEMDYGEAD-RETNKKVSPSTDQIKETKLETRIASFISLICNISMMKQQMVEIGYNSDKLPLGKLSKSTIFKGYDVLKRISNVIS--RADRRQLEQLTGEFYTVIPHDFGFKKMREFIIDTPQKLKAKLEMVEALGEIEIATKLLEDDSTDQDDPLYARYKQLSCDFTPLEVGSEEYSMIKTYLANTHGKTHTSYTVDVVQIFKVSRHGEMERFQKFATAGNRMLLWHGSRLTNWAGILSQGLRIAPPEAPVTGYMFGKGVYFADMFSKSANYCYASEACRSGVLLLCEVALGEMNELLNADYDANNLPKGKLSTKGVGQTEPNTAESK 609          
BLAST of Poly [ADP-ribose] polymerase vs. UniProt/SwissProt
Match: sp|O50017|PARP2_MAIZE (Poly [ADP-ribose] polymerase 2 OS=Zea mays OX=4577 GN=PARP2 PE=2 SV=1)

HSP 1 Score: 323.939 bits (829), Expect = 7.697e-99
Identity = 174/418 (41.63%), Postives = 252/418 (60.29%), Query Frame = 3
Query:  927 NSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEI-LETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPP--LIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQE---WQNFDDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPD 2162
              E++D  LNQTN+  NNNKFYIIQ+L+ +    + V+ RW RVG  GQ KL         A   F  KF++KT N W DR+ F+    KY  +++DY + E  +E   I  Q+K    E+KLE ++   + ++ ++  M   + E+ Y+  K+PLG+L +A I  GY  L+ I  ++S+  +  + L Q    +YT IPHDFG R     +I +  ++K +LE++E L +I+IA KL+ ++      PL   Y+ LHC    +  D+  Y +I  YL  THG TH+ Y ++++ +F+V +  E   +Q F    NRMLLWHGSR +N+ GI+SQGLRIAP EAPVTG+MFGKG+YFADM +KSANY Y + +  +G LLLCEV+LG  NEL+  +  AN LP      KG+G  AP+
Sbjct:  186 GDEIYDATLNQTNVGDNNNKFYIIQVLESDAGGSFMVYNRWGRVGVRGQDKLHGPSPTRDQAIYEFEGKFHNKTNNHWSDRKNFKCYAKKYTWLEMDYGETEKEIEKGSITDQIK----ETKLETRIAQFISLICNISMMKQRMVEIGYNAEKLPLGKLRKATILKGYHVLKRISDVISK--ADRRHLEQLTGEFYTVIPHDFGFRKMREFIIDTPQKLKAKLEMVEALGEIEIATKLLEDDSSDQDDPLYARYKQLHCDFTPLEADSDEYSMIKSYLRNTHGKTHSGYTVDIVQIFKVSRHGETERFQKFASTRNRMLLWHGSRLSNWAGILSQGLRIAPPEAPVTGYMFGKGVYFADMFSKSANYCYASEACRSGVLLLCEVALGDMNELLNADYDANNLPKGKLRSKGVGQTAPN 597          
BLAST of Poly [ADP-ribose] polymerase vs. TrEMBL
Match: A0A2K5SJM7 (Poly [ADP-ribose] polymerase OS=Cebus capucinus imitator OX=1737458 GN=PARP2 PE=4 SV=1)

HSP 1 Score: 481.1 bits (1237), Expect = 5.886e-158
Identity = 237/448 (52.90%), Postives = 323/448 (72.10%), Query Frame = 3
Query:  828 KENGSITVGMEKLDIPVDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYC--KKEILETNKIAS-QVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNF-DDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAP 2159
            K++ S+   + K   PVD EC     KA +Y E ++V+DVMLNQTNLQFNNNK+Y+IQLL+D+ E  + VWMRW RVGK+GQ  L     NL  AKE F KKF DKTKN+W+DR+KFEK+ GKYD++Q+DY    ++  ET K  S +  L+P ES+L+ ++Q+L++++ +++ M + + EMKY+  K PLG+LT AQIKAGY +L++IE  +  G    ++LV+ACN +YTRIPHDFG+R PPLIR+  E+  +++LLE L DI+IA+KL+        HPLD+HY+NLHC +  +  ++  +++I+ YL  TH  TH+ Y + +LDLFEV K+ E + F +D  NRMLLWHGSR +N+ GI+S GLRIAP EAP+TG+MFGKGIYFADMS+KSANY + +R KNTG LLL EV+LG CNEL++ N +A  L    HS KGLG IAP
Sbjct:   65 KQDESVKALLLKGKAPVDPECTAKVGKAHVYCEGNDVYDVMLNQTNLQFNNNKYYLIQLLEDDSERNFSVWMRWGRVGKMGQHSLVACSGNLNKAKEIFQKKFLDKTKNNWEDREKFEKVPGKYDMLQMDYATNTQDEEETKKEESLKSPLKP-ESQLDLRVQELIKLICNVQAMEEMMIEMKYNTKKAPLGKLTVAQIKAGYQSLKKIEDCIRAGQHG-RALVEACNEFYTRIPHDFGLRTPPLIRTQKELSEKIQLLEALGDIEIAIKLVKTELQSPEHPLDQHYRNLHCALRPLDHESYEFKVISQYLQSTHAPTHSDYTMTLLDLFEVEKKGEKEAFREDLHNRMLLWHGSRLSNWVGILSHGLRIAPPEAPITGYMFGKGIYFADMSSKSANYCFASRLKNTGLLLLSEVALGQCNELLEANPKAEGLLQGKHSTKGLGKIAP 510          
BLAST of Poly [ADP-ribose] polymerase vs. TrEMBL
Match: G1U392 (Poly [ADP-ribose] polymerase OS=Oryctolagus cuniculus OX=9986 GN=PARP2 PE=4 SV=2)

HSP 1 Score: 480.33 bits (1235), Expect = 1.147e-157
Identity = 234/451 (51.88%), Postives = 324/451 (71.84%), Query Frame = 3
Query:  828 KENGSITVGMEKLDIPVDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCK--KEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNF-DDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPDQST 2171
            K+  S+   + K   PVD EC     KA +Y E +EV+DVMLNQTNLQFNNNK+Y+IQLL+D+ +  + VWMRW RVGK+GQ  L     +L+ AKE F KKF+DKTKN+W+DR+KFEK+ GKYD++Q+DY    +   ET K  +   L+P ES+L+ ++Q+L++++ +++ M + + EMKYD  K PLG+LT AQIKAGY +L++IE  +  G    + L++ACN +YTRIPHDFG+R PPLIR+  E+  +++LLETL DI+IA+KL+        HPLD+HY+NLHC ++ +  ++  +++I+ YL  TH  TH  Y + +LD+FEV KE E + F +D  NRMLLWHGSR +N+ GI+S GLRIAP EAP+TG+MFGKGIYFADMS+KSANY + +R KN G LLL EV+LG CNEL++ N +A  L    HS KGLG +AP+ ++
Sbjct:   62 KQGESVKALLIKGKAPVDPECTAKVGKAHVYSEGNEVYDVMLNQTNLQFNNNKYYLIQLLEDDAQRNFSVWMRWGRVGKMGQHSLVACSGDLSKAKEIFQKKFFDKTKNNWEDREKFEKVPGKYDMLQMDYAANTQGEDETKKEEALKSLKP-ESRLDIRVQELIQLICNVQAMEETMIEMKYDTKKAPLGKLTMAQIKAGYQSLKKIEDCIRAGQHG-RVLLEACNEFYTRIPHDFGLRTPPLIRTEKELSDKVQLLETLGDIEIAIKLVKTELQSPEHPLDQHYRNLHCSLHPLDHESHEFKVISQYLQSTHAPTHNDYTMTLLDVFEVEKEGEKEAFREDLHNRMLLWHGSRLSNWVGILSHGLRIAPPEAPITGYMFGKGIYFADMSSKSANYCFASRLKNIGLLLLSEVALGHCNELLEANPKAEGLLQGKHSTKGLGKMAPNPTS 510          
BLAST of Poly [ADP-ribose] polymerase vs. TrEMBL
Match: A0A2F0BK68 (Poly [ADP-ribose] polymerase (Fragment) OS=Eschrichtius robustus OX=9764 GN=ESR_02519 PE=4 SV=1)

HSP 1 Score: 476.093 bits (1224), Expect = 4.883e-157
Identity = 235/444 (52.93%), Postives = 320/444 (72.07%), Query Frame = 3
Query:  840 SITVGMEKLDIPVDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYC--KKEILETNKIAS-QVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNF-DDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAP 2159
            S+   + K   PVD EC     KA +Y E ++V+DVMLNQTNLQFNNNK+Y+IQLL+D+ +  + VWMRW RVGK+GQ  L     +L+ AKE F KKF DKTKN+W+DR+KFEK+ GKYD++Q+DY    +   ETNK  S +  L+P ES+L+ ++Q+L++++ +++ M + + EMKYD  K PLG+LT AQIKAGY +L++IE  +  G    ++LV+ACN +YTRIPHDFG+R PPLIR+  E+  +++LLE L DI+IA+KL+        HPLD+HY+ LHC ++ +  ++  +++I+ YL  TH STH+ Y + +LD+FEV KE E + F +D  NRMLLWHGSR +N+ GI+S GLRIAP EAP+TG+MFGKGIYFADMS+KSANY + TR K+TG LLL EV+LG CNEL+  N  A  L    HS KGLG +AP
Sbjct:    1 SVKTLLLKGKAPVDPECTAKVGKAHVYCEGNDVYDVMLNQTNLQFNNNKYYLIQLLEDDAQRNFSVWMRWGRVGKMGQHSLVACSGDLSKAKEIFQKKFLDKTKNNWEDREKFEKVPGKYDMLQMDYTTNTQSEEETNKGESLKSPLKP-ESQLDLRVQELIKLICNVQAMEEMMVEMKYDTKKAPLGKLTVAQIKAGYQSLKKIEDCIRAGQHG-RALVEACNEFYTRIPHDFGLRTPPLIRTEKELSDKVQLLEALGDIEIAIKLVKTELQSPEHPLDQHYRKLHCALHPLDHESYEFKVISQYLQSTHASTHSDYTMTLLDVFEVEKEGEKEAFREDLHNRMLLWHGSRLSNWVGILSHGLRIAPPEAPITGYMFGKGIYFADMSSKSANYCFATRLKDTGLLLLSEVALGQCNELLGANPEAEGLLQGKHSTKGLGKMAP 442          
BLAST of Poly [ADP-ribose] polymerase vs. TrEMBL
Match: W5K9Z7 (Poly [ADP-ribose] polymerase OS=Astyanax mexicanus OX=7994 PE=4 SV=2)

HSP 1 Score: 479.945 bits (1234), Expect = 1.684e-156
Identity = 232/432 (53.70%), Postives = 306/432 (70.83%), Query Frame = 3
Query:  873 PVDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKE-ILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNF-DDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPD 2162
            PVD ECK    KA +Y E S+++DVMLNQTNLQFNNNK+Y+IQLL+D+    Y VWMRW RVGK+GQ  L     NLA AKE F KKF DKTKN+W+DR  FEK+ GKYDLV +DY   +   E+  +++ V+ +P  S+L+ KLQ L+ ++ D+K M + V EMK+D  K PLG+LT  QI+AGY +L+ IE  L +   SN+ L++ACN +YTRIPHDFG+R+PP IR+  E+K ++ LLE LSDI+IA+K++  +     HPLDR Y +L C +  VT ++  +Q+I  YL  TH  TH+ Y + +LD+F V +E E  +F  +  NRMLLWHGSR +N+ GI+SQGLR+AP EAPVTG+MFGKGIYFADMS+KSANY +  +  N G LLLCEV+LG CNE++  N  A++LP   HS KGLG   PD
Sbjct:  155 PVDLECKAKLGKAHVYSEGSDIYDVMLNQTNLQFNNNKYYLIQLLQDDHAKAYSVWMRWGRVGKVGQNNLVSCGGNLAEAKEIFKKKFLDKTKNEWEDRANFEKVPGKYDLVFMDYTGNDNEEESCDVSTSVQKKP--SQLDLKLQSLLELICDIKAMEECVLEMKFDTKKAPLGKLTVEQIRAGYASLKRIEECLKK-KGSNRELLEACNQFYTRIPHDFGLRVPPTIRTEEELKEKMALLEALSDIQIAVKMVESSSHSDEHPLDRQYHSLKCQLQPVTPNSHEFQVIEKYLQSTHAPTHSDYTMTVLDIFLVDREGERDSFLTEMHNRMLLWHGSRLSNWVGILSQGLRVAPPEAPVTGYMFGKGIYFADMSSKSANYCFTNQKNNIGLLLLCEVALGDCNEMLDANYDADRLPSGKHSTKGLGQTGPD 583          
BLAST of Poly [ADP-ribose] polymerase vs. TrEMBL
Match: A0A341CQK9 (Poly [ADP-ribose] polymerase OS=Neophocaena asiaeorientalis asiaeorientalis OX=1706337 GN=PARP2 PE=4 SV=1)

HSP 1 Score: 475.322 bits (1222), Expect = 2.521e-156
Identity = 234/444 (52.70%), Postives = 319/444 (71.85%), Query Frame = 3
Query:  840 SITVGMEKLDIPVDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYC--KKEILETNKIAS-QVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNF-DDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAP 2159
            S+   + K   PVD EC     KA +Y E ++V+DVMLNQT+LQFNNNK+Y+IQLL+D+ +  + VWMRW RVGK+GQ  L     +L  AKE F KKF DKTKN+W+DR+KFEK+ GKYD++Q+DY    +   ETNK  S + +L+P ES+L+ ++Q+LM+++ +++ M + + EMKYD  K PLG+LT AQIKAGY +L++IE  +  G    ++LV+ACN +YTRIPHDFG+R PPLIR+  E+  +++LLE L DI+IA+KL+        HPLD+HY+ LHC ++ +  ++  +++I+ YL  TH  TH+ Y + +LD+FEV KE E + F +D  NRMLLWHGSR +N+ GI+S GLRIAP EAP+TG+MFGKGIYFADMS+KSANY + TR K+TG LLL EV+LG CNEL+  N  A  L    HS KGLG +AP
Sbjct:   22 SVKTLLLKGKAPVDPECTAKVGKAHVYCEGNDVYDVMLNQTSLQFNNNKYYLIQLLEDDAQRNFSVWMRWGRVGKMGQHSLAACSGDLNKAKEIFQKKFLDKTKNNWEDREKFEKVPGKYDMLQMDYTTNTQSEEETNKGESLKSRLKP-ESQLDLRVQELMKLICNVQAMEEMMVEMKYDTKKAPLGKLTVAQIKAGYQSLKKIEDCIRAGQHG-RALVEACNEFYTRIPHDFGLRTPPLIRTEKELSDKVQLLEALGDIEIAIKLVRTELQSPEHPLDQHYRKLHCALHPLDHESYEFKVISQYLQSTHAPTHSDYTMTLLDVFEVEKEGEKEAFREDLHNRMLLWHGSRLSNWVGILSHGLRIAPPEAPITGYMFGKGIYFADMSSKSANYCFATRLKDTGLLLLSEVALGQCNELLGANPEAEGLLQGKHSTKGLGKMAP 463          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Cavefish
Match: parp2 (poly(ADP-ribose) polymerase 2 [Source:NCBI gene;Acc:103030103])

HSP 1 Score: 479.945 bits (1234), Expect = 6.380e-160
Identity = 232/432 (53.70%), Postives = 306/432 (70.83%), Query Frame = 3
Query:  873 PVDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKE-ILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNF-DDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPD 2162
            PVD ECK    KA +Y E S+++DVMLNQTNLQFNNNK+Y+IQLL+D+    Y VWMRW RVGK+GQ  L     NLA AKE F KKF DKTKN+W+DR  FEK+ GKYDLV +DY   +   E+  +++ V+ +P  S+L+ KLQ L+ ++ D+K M + V EMK+D  K PLG+LT  QI+AGY +L+ IE  L +   SN+ L++ACN +YTRIPHDFG+R+PP IR+  E+K ++ LLE LSDI+IA+K++  +     HPLDR Y +L C +  VT ++  +Q+I  YL  TH  TH+ Y + +LD+F V +E E  +F  +  NRMLLWHGSR +N+ GI+SQGLR+AP EAPVTG+MFGKGIYFADMS+KSANY +  +  N G LLLCEV+LG CNE++  N  A++LP   HS KGLG   PD
Sbjct:  155 PVDLECKAKLGKAHVYSEGSDIYDVMLNQTNLQFNNNKYYLIQLLQDDHAKAYSVWMRWGRVGKVGQNNLVSCGGNLAEAKEIFKKKFLDKTKNEWEDRANFEKVPGKYDLVFMDYTGNDNEEESCDVSTSVQKKP--SQLDLKLQSLLELICDIKAMEECVLEMKFDTKKAPLGKLTVEQIRAGYASLKRIEECLKK-KGSNRELLEACNQFYTRIPHDFGLRVPPTIRTEEELKEKMALLEALSDIQIAVKMVESSSHSDEHPLDRQYHSLKCQLQPVTPNSHEFQVIEKYLQSTHAPTHSDYTMTVLDIFLVDREGERDSFLTEMHNRMLLWHGSRLSNWVGILSQGLRVAPPEAPVTGYMFGKGIYFADMSSKSANYCFTNQKNNIGLLLLCEVALGDCNEMLDANYDADRLPSGKHSTKGLGQTGPD 583          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Cavefish
Match: parp2 (poly(ADP-ribose) polymerase 2 [Source:NCBI gene;Acc:103030103])

HSP 1 Score: 448.743 bits (1153), Expect = 3.859e-148
Identity = 224/432 (51.85%), Postives = 295/432 (68.29%), Query Frame = 3
Query:  873 PVDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKE-ILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNF-DDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPD 2162
            PVD     L CKAK            L +TNLQFNNNK+Y+IQLL+D+    Y VWMRW RVGK+GQ  L     NLA AKE F KKF DKTKN+W+DR  FEK+ GKYDLV +DY   +   E+  +++ V+ +P  S+L+ KLQ L+ ++ D+K M + V EMK+D  K PLG+LT  QI+AGY +L+ IE  L +   SN+ L++ACN +YTRIPHDFG+R+PP IR+  E+K ++ LLE LSDI+IA+K++  +     HPLDR Y +L C +  VT ++  +Q+I  YL  TH  TH+ Y + +LD+F V +E E  +F  +  NRMLLWHGSR +N+ GI+SQGLR+AP EAPVTG+MFGKGIYFADMS+KSANY +  +  N G LLLCEV+LG CNE++  N  A++LP   HS KGLG   PD
Sbjct:  155 PVD-----LECKAK------------LGKTNLQFNNNKYYLIQLLQDDHAKAYSVWMRWGRVGKVGQNNLVSCGGNLAEAKEIFKKKFLDKTKNEWEDRANFEKVPGKYDLVFMDYTGNDNEEESCDVSTSVQKKP--SQLDLKLQSLLELICDIKAMEECVLEMKFDTKKAPLGKLTVEQIRAGYASLKRIEECLKK-KGSNRELLEACNQFYTRIPHDFGLRVPPTIRTEEELKEKMALLEALSDIQIAVKMVESSSHSDEHPLDRQYHSLKCQLQPVTPNSHEFQVIEKYLQSTHAPTHSDYTMTVLDIFLVDREGERDSFLTEMHNRMLLWHGSRLSNWVGILSQGLRVAPPEAPVTGYMFGKGIYFADMSSKSANYCFTNQKNNIGLLLLCEVALGDCNEMLDANYDADRLPSGKHSTKGLGQTGPD 566          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Cavefish
Match: parp1 (poly(ADP-ribose) polymerase 1 [Source:NCBI gene;Acc:103023001])

HSP 1 Score: 311.612 bits (797), Expect = 4.348e-92
Identity = 175/437 (40.05%), Postives = 268/437 (61.33%), Query Frame = 3
Query:  876 VDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGK-IGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINEN-EDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQN---FDDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPDQST 2171
            VD +    +C A +  +N ++    L   ++    N +Y +QLL+D+ +  Y+V+  W RVG  IG  KL +FY+   +A + F   + +KT N W     F K   K+  ++IDY + E       AS       +S+L + +Q+L+R++FD++ M  A+ E + D  K+PLG+L++ QI++ Y  L E++  +S+ ++    ++   N +YT IPHDFGM+ PPL+ ++  I+ ++++L+ L DI++A  L+    ED    P+D +Y+ L   I ++   +   QLI+ Y+  TH STH TY LE+ ++F++ +E E+Q    F +  NR LLWHGSRTTNY GI+SQGLRIAP EAPVTG+MFGKG+YFADM +KSANY + +++   G +LL EV+LG  +EL K+ S   KLP   HSVKGLG  APDQ  
Sbjct:  540 VDPDSGLGNC-AHVLDQNGKIHSATLGLVDIVRGTNSYYKLQLLEDDVQKRYWVFRSWGRVGTTIGGNKLDKFYDK-NSAMDNFRSVYEEKTGNSWTS-SSFTKYPNKFYPLEIDYGQDEEAVKKLAASS----GTKSQLAKPIQELIRMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAYSLLSEVQQAVSD-NAPEPMILDLSNRFYTLIPHDFGMKKPPLLSNLDYIQTKVQMLDNLLDIEVAYSLLRGGAEDNKKDPIDINYEKLKTKIEVLDNSSEEAQLIHQYVKNTHASTHNTYTLEVEEIFKIDREGEYQRYRPFKELPNRQLLWHGSRTTNYAGILSQGLRIAPPEAPVTGYMFGKGVYFADMVSKSANYCHTSQADPVGLILLGEVALGNMHEL-KKASHITKLPKGKHSVKGLGRTAPDQGA 967          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Cavefish
Match: parp1 (poly(ADP-ribose) polymerase 1 [Source:NCBI gene;Acc:103023001])

HSP 1 Score: 299.671 bits (766), Expect = 6.623e-88
Identity = 170/431 (39.44%), Postives = 263/431 (61.02%), Query Frame = 3
Query:  876 VDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGK-IGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINEN-EDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQN---FDDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGII 2153
            VD +    +C A +  +N ++    L   ++    N +Y +QLL+D+ +  Y+V+  W RVG  IG  KL +FY+   +A + F   + +KT N W     F K   K+  ++IDY + E       AS       +S+L + +Q+L+R++FD++ M  A+ E + D  K+PLG+L++ QI++ Y  L E++  +S+ ++    ++   N +YT IPHDFGM+ PPL+ ++  I+ ++++L+ L DI++A  L+    ED    P+D +Y+ L   I ++   +   QLI+ Y+  TH STH TY LE+ ++F++ +E E+Q    F +  NR LLWHGSRTTNY GI+SQGLRIAP EAPVTG+MFGKG+YFADM +KSANY + +++   G +LL EV+LG  +EL K+ S   KLP   HSVKG   I
Sbjct:  540 VDPDSGLGNC-AHVLDQNGKIHSATLGLVDIVRGTNSYYKLQLLEDDVQKRYWVFRSWGRVGTTIGGNKLDKFYDK-NSAMDNFRSVYEEKTGNSWTS-SSFTKYPNKFYPLEIDYGQDEEAVKKLAASS----GTKSQLAKPIQELIRMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAYSLLSEVQQAVSD-NAPEPMILDLSNRFYTLIPHDFGMKKPPLLSNLDYIQTKVQMLDNLLDIEVAYSLLRGGAEDNKKDPIDINYEKLKTKIEVLDNSSEEAQLIHQYVKNTHASTHNTYTLEVEEIFKIDREGEYQRYRPFKELPNRQLLWHGSRTTNYAGILSQGLRIAPPEAPVTGYMFGKGVYFADMVSKSANYCHTSQADPVGLILLGEVALGNMHEL-KKASHITKLPKGKHSVKGKATI 961          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Cavefish
Match: parp3 (poly(ADP-ribose) polymerase family member 3 [Source:NCBI gene;Acc:103034813])

HSP 1 Score: 219.164 bits (557), Expect = 3.403e-62
Identity = 154/433 (35.57%), Postives = 236/433 (54.50%), Query Frame = 3
Query:  918 YVENSEV---FDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKI---ASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVH-------VHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNFDDKG---NRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPDQS 2168
            Y+ N+EV   +D MLNQTN+  NNNKFY+IQ+L D     YY W RW RVG+ GQ  L    N  AA K  F KKF DKTKN+W DR+ F   +GKY L+++D  +   ++ + +   A++VK   +   L++  Q L++ +F+     +A+  M  D  K+PLG+L++ QI  G+ AL EIE    +  S   +L +  + ++T IPH+FG   PP+I +   I  + E+L  L+DI+IA  L  E+E           HP+D+ YQ+L C ++++   +  +++I  YL        T + L ++D+++V +E+E + F +     NR LLWHG+       I+  GLRI P     +G   G+GIYFA  + KSA Y+    S   G + L EV+LG    + +++    K P    SV   G   PD +
Sbjct:   55 YLSNAEVHEDYDCMLNQTNIGNNNNKFYVIQVLVDGG--TYYCWTRWGRVGESGQNNLAGPTNADAAIKN-FEKKFKDKTKNNWSDRENFVSHSGKYTLIEVDGDQDAEVKVDAVDGRAAEVKKNILPCTLDDPTQRLIKFIFNNDMFKEAMENMNLDIKKMPLGKLSKQQIAKGFEALEEIE-EAIKNKSRESTLSELSSKFFTIIPHNFGRNRPPVINTDEIIHSKKEMLLVLADIEIAQSLKAESEKAKEEMVETVPHPIDQDYQSLKCNLSILKKKSKEFKIIEKYL------KATGHGLTIVDVWQVDREKEAERFKENNALENRKLLWHGTNVAVVAAILKSGLRIMPH----SGGRVGQGIYFASENEKSAGYV--RLSNRIGIMFLNEVALGREYTITQDDHTLRKAPAGYDSVVARGRQEPDSA 471          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003213.1 (pep scaffold:Pmarinus_7.0:GL484848:6623:9574:1 gene:ENSPMAG00000002936.1 transcript:ENSPMAT00000003213.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.5666 bits (192), Expect = 1.742e-17
Identity = 36/61 (59.02%), Postives = 43/61 (70.49%), Query Frame = 3
Query:  873 PVDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWAR 1055
            PVD ECK    KA +Y E + V+DVMLNQTN+  NNNKFY+IQLL+D     + VWMRW R
Sbjct:   78 PVDPECKAKLGKAHVYSEGNNVYDVMLNQTNVGLNNNKFYLIQLLRDNDIKSFSVWMRWGR 138          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009608.1 (pep scaffold:Pmarinus_7.0:GL477242:23155:61557:-1 gene:ENSPMAG00000008655.1 transcript:ENSPMAT00000009608.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.9062 bits (115), Expect = 4.656e-6
Identity = 42/122 (34.43%), Postives = 55/122 (45.08%), Query Frame = 3
Query: 1815 RKEQEWQNFDDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIY--------PTRSKNTGF-----LLLCEVSLGTCNELIKENSRANKLPPNCHSVKG 2141
            RKE   +N +    RML +HGS   N   II++G     A     G MFG GIYFA+ S+KS  Y+Y        P     + +     +L C V+LG           A+  PP  HSV G
Sbjct: 1148 RKEVTEENHNHHNERML-FHGSPFIN--AIINKGFDERHA---YIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICQRQMLFCRVTLGKSFLQFSAMKMAHS-PPGHHSVIG 1262          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Nematostella
Match: EDO46480 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ13])

HSP 1 Score: 385.956 bits (990), Expect = 5.268e-126
Identity = 203/432 (46.99%), Postives = 279/432 (64.58%), Query Frame = 3
Query:  873 PVDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNFDDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPDQS 2168
            PVD  C  +  K  ++ E S ++D MLNQTN+  NNNK+Y+IQLL+D     YY WMRW RVG  GQ  L  F  NL AAK  F KKF DKTKNDW+DR  F K+ GKYDL+ +DY  +E  E +    + K    ESKL+ ++++L+ ++ +++ M +A+ EMKYD  K PLG  +E  +    + LR    ++        S+   C+++ TR+     M+ PPL+R+  E+K +LELLE L DI++A+ ++ E  D  +HP D+HY++LHC +  +   +  ++++  Y+  TH  TH  Y +E+ D+F VR ++E  +F D GNRMLLWHGSR TN+ GI+ QGLRIAP EAPVTG+MFGKGIYFADMS+KSANY + TRSKNTG +LL EVSLG  N L+  +  A KLP    SVK LG  APD +
Sbjct:   11 PVDSFC-SIKDKVHVFCEGSTIWDAMLNQTNVMNNNNKYYLIQLLEDNTAKKYYTWMRWGRVGFDGQKNLQAFGANLDAAKRTFEKKFSDKTKNDWEDRASFTKVQGKYDLLIMDYKAEENDEVDAPVKEEKPAKPESKLDCRVRELVELICNVQAMEEALKEMKYDTKKAPLGSFSEYHVCHYTIQLRMTGRIVPVSPRCKGSMT--CSSWITRLKRTMKMKRPPLLRTNEEVKEKLELLEALGDIQVAITMLKEKVDDKMHPADKHYESLHCDLEPLDHAHDDFKMVKMYVENTHAQTHNQYKMEVEDVFVVRHQKE--DFLDVGNRMLLWHGSRLTNWAGILKQGLRIAPPEAPVTGYMFGKGIYFADMSSKSANYCFATRSKNTGLVLLSEVSLGKSNVLLTADYNAAKLPAGHQSVKALGKFAPDPT 437          

HSP 2 Score: 49.6766 bits (117), Expect = 3.531e-6
Identity = 25/50 (50.00%), Postives = 31/50 (62.00%), Query Frame = 2
Query: 2237 REDGTLVPVGIPVDTGVGEKRKGAYVLNYNEYIVYKQNQVKMRFLVKVRF 2386
            R DG  +P G  + TGV       Y L YNEYIVY   QV+MR+LVK++F
Sbjct:  442 RPDGLTIPCGKGIATGVTSP--NGYTLMYNEYIVYDTRQVRMRYLVKMKF 489          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Nematostella
Match: EDO46812 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNW1])

HSP 1 Score: 315.849 bits (808), Expect = 2.281e-94
Identity = 173/418 (41.39%), Postives = 262/418 (62.68%), Query Frame = 3
Query:  936 VFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGK-IGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLI--NENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQE---WQNFDDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPDQST 2171
            V+   L   ++    N +Y +Q+LK +K    Y++  W RVG  IG  KL    N+  +A + F + + +KT N+W +R  F K   ++  ++IDY +      + + +++++   +SKL  ++Q+L++++FD++ M   + E + D  K+PLG+LT+ QI+  Y  L E + +LSE  +S  +++   N +YT IPHDFGMR PPL+ +   IK ++E+L+ L DI++A  L+  ++ ED    P+D +Y+ L   I ++   +  + LI++Y+  TH  TH  Y LE+LD+F++++E E   ++ F    NR LLWHGSRTTNY GI+SQGLRIAP EAPVTG+MFGKG+YFADM +KSANY   + S N G LLLCEV+LG  +EL K  S   K+P   HSVKGLG  APD S 
Sbjct:  504 VYSATLGMVDISRGTNSYYKLQVLKKDKSSRCYLFRSWGRVGTTIGGSKLEDCGNSHNSAVQSFEELYREKTGNEWSERDNFVKHPNRFYPLEIDYGQAH---EDVVKAKIEMGS-KSKLPSQIQELIKMIFDVESMKKTLIEFEIDLKKMPLGKLTKRQIEKAYSVLGEAQQILSEA-ASKTAVLDVSNRFYTLIPHDFGMRKPPLLDNQELIKTKIEMLDNLIDIEVAFSLLQSSDGEDAE-DPIDINYKKLKTDIEVLDHKSAEFGLISEYVSNTHADTHRQYELELLDVFKIKREGEEALFKPFKQLHNRQLLWHGSRTTNYAGILSQGLRIAPPEAPVTGYMFGKGVYFADMVSKSANYCCTSPSNNIGLLLLCEVALGNMHEL-KHASFIKKVPKGKHSVKGLGKTAPDPSA 914          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Nematostella
Match: EDO26345 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TC91])

HSP 1 Score: 234.958 bits (598), Expect = 7.495e-72
Identity = 133/308 (43.18%), Postives = 175/308 (56.82%), Query Frame = 3
Query: 1134 FYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNFDDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCE 2057
            F DKTKNDW+DR  F K+ GKYDL+ +DY  +E  E +    + K    ESKL+ ++++L+ ++ +++ M +A+ EMKYD  K PLG+LT  QIKAGY AL++IE  +S+G   NK LV+AC+ +YTRIPH FGM+ PPL+R+  E+K +LELLE                           +N H      TI   +Y      +LL H                                     GSR TN+ GI+ QGLRIAP EAPVTG+MFGKGIYFADMS+KSANY + TRSKNTG +LL E
Sbjct:    1 FSDKTKNDWEDRASFTKVQGKYDLLIMDYKAEENDEVDAPVKEEKPAKPESKLDCRVRELVELICNVQAMEEALKEMKYDTKKAPLGKLTTDQIKAGYEALKKIESCISKGDYGNK-LVKACDEFYTRIPHCFGMKRPPLLRTNEEVKEKLELLEV-------------------------RKNAHWFFGSYTIQPLLYS----QMLLWH-------------------------------------GSRLTNWAGILKQGLRIAPPEAPVTGYMFGKGIYFADMSSKSANYCFATRSKNTGLVLLSE 241          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Nematostella
Match: EDO29976 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T240])

HSP 1 Score: 71.2478 bits (173), Expect = 2.478e-13
Identity = 58/205 (28.29%), Postives = 103/205 (50.24%), Query Frame = 3
Query:  873 PVDKECKELSCKAKIYVENSE--VFDVMLNQTNLQ---FNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLV------QIDYCK-KEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVS--EMKYDNNKVPLGRLTEAQIKAGYLALREI 1445
            PVD    +    +K++++ +    +D+++ + +++   F  N FY +Q++ ++ + ++ +  RW R+G  GQ +LT F +  AA  E F K F  KT N W ++  F K   KY LV      Q  + K K+IL+   + +        SKL + LQ LM+ + D + +  +VS   ++ D   +P GRL+   I      L +I
Sbjct:   65 PVDPVTNKQKTGSKVFMKPATGIPYDILMTKVDVKYGYFGLNNFYKMQVIFEKGKNLWVLLTRWGRIGDRGQHQLTPFSDAKAATDE-FKKIFRSKTGNLWDEKGSFVKHPKKYSLVLPERNPQFHHRKPKDILKPFDLEACP-----PSKLPKPLQTLMKAITDQEWLRKSVSHHSLQVDPEFMPFGRLSLETINRARGVLEKI 263          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Nematostella
Match: EDO29977 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T241])

HSP 1 Score: 56.225 bits (134), Expect = 2.418e-10
Identity = 24/41 (58.54%), Postives = 29/41 (70.73%), Query Frame = 3
Query: 1851 GNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGI 1973
            GN  LLWHG+RT N  GI+ +GLRIAPA   ++GH  GK I
Sbjct:   19 GNHRLLWHGTRTYNVLGILKEGLRIAPAHVDISGHSLGKVI 59          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Medaka
Match: parp2 (poly(ADP-ribose) polymerase 2 [Source:NCBI gene;Acc:101165670])

HSP 1 Score: 467.618 bits (1202), Expect = 3.589e-155
Identity = 225/431 (52.20%), Postives = 295/431 (68.45%), Query Frame = 3
Query:  873 PVDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNF-DDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPD 2162
            PVD EC     KA +Y E S V+DVMLNQTNLQFNNNKFY+IQLL+D+    + VWMRW RVGK+GQ  LT    +L  AK+ F KKF+DKT+N+W+ R  F K+ GKYD+V +DY   E  E N             KL+ K+Q L+ ++ DLK M + V EMK+D  K PLG+LT  QI+AGY AL++IE  L    SS + L++ACN +YTRIPHDFG+R PP+I + +E+K ++ LLE LSDI+IA+K++  + D   HPLDRHY +L C +  +   +  +++I  YL  TH  TH  Y + +LD+F V ++ E ++F  D  NR LLWHGSR +N+ GI+S+GLR+AP EAPVTG+MFGKGIYFADMS+KSANY +  +S + G LLLCEV+LG CNEL+  +  AN LP   HS KGLG  APD
Sbjct:  151 PVDPECNAKLGKAHVYSEGSIVYDVMLNQTNLQFNNNKFYLIQLLQDDSSKSFSVWMRWGRVGKVGQNSLTACGGDLLKAKDIFKKKFFDKTRNEWEQRGSFVKVAGKYDMVFMDYSTNE-KEENTTVVDAATNKRSCKLDPKVQSLLELICDLKAMEECVLEMKFDTRKAPLGKLTSEQIRAGYAALKKIEECLKRKGSS-RDLLEACNQFYTRIPHDFGLRPPPVIHTDAELKEKISLLEALSDIQIAVKMVQSSADSEEHPLDRHYHSLKCNLQPLDSTSSEFKVIEKYLQSTHAPTHRDYGMTVLDIFSVDRDGESESFLSDLHNRTLLWHGSRLSNWVGILSKGLRVAPPEAPVTGYMFGKGIYFADMSSKSANYCFANQSNHVGLLLLCEVALGDCNELLDADYEANNLPAGKHSTKGLGQTAPD 579          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Medaka
Match: parp2 (poly(ADP-ribose) polymerase 2 [Source:NCBI gene;Acc:101165670])

HSP 1 Score: 446.047 bits (1146), Expect = 1.891e-148
Identity = 219/431 (50.81%), Postives = 292/431 (67.75%), Query Frame = 3
Query:  873 PVDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNF-DDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPD 2162
            PVD EC      AK+       F V+L  TNLQFNNNKFY+IQLL+D+    + VWMRW RVGK+GQ  LT    +L  AK+ F KKF+DKT+N+W+ R  F K+ GKYD+V +DY   E +ET      +K   + S L+ K+Q L+ ++ DLK M + V EMK+D  K PLG+LT  QI+AGY AL++IE  L    SS + L++ACN +YTRIPHDFG+R PP+I + +E+K ++ LLE LSDI+IA+K++  + D   HPLDRHY +L C +  +   +  +++I  YL  TH  TH  Y + +LD+F V ++ E ++F  D  NR LLWHGSR +N+ GI+S+GLR+AP EAPVTG+MFGKGIYFADMS+KSANY +  +S + G LLLCEV+LG CNEL+  +  AN LP   HS KGLG  APD
Sbjct:   50 PVDPECN-----AKL---GKVFFCVLLTSTNLQFNNNKFYLIQLLQDDSSKSFSVWMRWGRVGKVGQNSLTACGGDLLKAKDIFKKKFFDKTRNEWEQRGSFVKVAGKYDMVFMDYSTNEKVETKTRVLSLK---VFSSLDPKVQSLLELICDLKAMEECVLEMKFDTRKAPLGKLTSEQIRAGYAALKKIEECLKRKGSS-RDLLEACNQFYTRIPHDFGLRPPPVIHTDAELKEKISLLEALSDIQIAVKMVQSSADSEEHPLDRHYHSLKCNLQPLDSTSSEFKVIEKYLQSTHAPTHRDYGMTVLDIFSVDRDGESESFLSDLHNRTLLWHGSRLSNWVGILSKGLRVAPPEAPVTGYMFGKGIYFADMSSKSANYCFANQSNHVGLLLLCEVALGDCNELLDADYEANNLPAGKHSTKGLGQTAPD 468          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Medaka
Match: parp2 (poly(ADP-ribose) polymerase 2 [Source:NCBI gene;Acc:101165670])

HSP 1 Score: 446.432 bits (1147), Expect = 7.309e-147
Identity = 225/475 (47.37%), Postives = 295/475 (62.11%), Query Frame = 3
Query:  873 PVDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNF-DDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHM--------------------------------------------FGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPD 2162
            PVD EC     KA +Y E S V+DVMLNQTNLQFNNNKFY+IQLL+D+    + VWMRW RVGK+GQ  LT    +L  AK+ F KKF+DKT+N+W+ R  F K+ GKYD+V +DY   E  E N             KL+ K+Q L+ ++ DLK M + V EMK+D  K PLG+LT  QI+AGY AL++IE  L    SS + L++ACN +YTRIPHDFG+R PP+I + +E+K ++ LLE LSDI+IA+K++  + D   HPLDRHY +L C +  +   +  +++I  YL  TH  TH  Y + +LD+F V ++ E ++F  D  NR LLWHGSR +N+ GI+S+GLR+AP EAPVTG+M                                            FGKGIYFADMS+KSANY +  +S + G LLLCEV+LG CNEL+  +  AN LP   HS KGLG  APD
Sbjct:  151 PVDPECNAKLGKAHVYSEGSIVYDVMLNQTNLQFNNNKFYLIQLLQDDSSKSFSVWMRWGRVGKVGQNSLTACGGDLLKAKDIFKKKFFDKTRNEWEQRGSFVKVAGKYDMVFMDYSTNEK-EENTTVVDAATNKRSCKLDPKVQSLLELICDLKAMEECVLEMKFDTRKAPLGKLTSEQIRAGYAALKKIEECLKRKGSS-RDLLEACNQFYTRIPHDFGLRPPPVIHTDAELKEKISLLEALSDIQIAVKMVQSSADSEEHPLDRHYHSLKCNLQPLDSTSSEFKVIEKYLQSTHAPTHRDYGMTVLDIFSVDRDGESESFLSDLHNRTLLWHGSRLSNWVGILSKGLRVAPPEAPVTGYMVCQEEASRCCTFVLFLFPILREFSRFGLNHFDPLKPTILSFSMQFGKGIYFADMSSKSANYCFANQSNHVGLLLLCEVALGDCNELLDADYEANNLPAGKHSTKGLGQTAPD 623          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Medaka
Match: parp1 (poly(ADP-ribose) polymerase 1 [Source:NCBI gene;Acc:101157338])

HSP 1 Score: 305.064 bits (780), Expect = 1.065e-89
Identity = 169/426 (39.67%), Postives = 261/426 (61.27%), Query Frame = 3
Query:  909 AKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGK-IGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVH-PLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNF---DDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPDQST 2171
            A +  ++ +++   L   ++    N +Y +QLL+D+ +  Y+V+  W RVG  IG  KL +F++   +A + F+  + +KT N+W     F K   K+  ++IDY + E       AS       +SKL + +Q+L++++FD++ M  A+ E + D  K+PLG+L++ QI++ Y  L E++  +S+       ++   N +YT IPHDFGM+ PPL+ S+  I+ ++E+L+ L DI++A  L+      + H P+D +Y+ L   I +V       ++I  Y+  TH +TH TY LE+ ++F++ +E E Q F   ++  NR LLWHGSR TNY GI+SQGLRIAP EAPVTG+MFGKG+YFADM +KSANY + ++S   G +LL EV+LG  +EL K+ S   KLP   HSVKGLG  APD S 
Sbjct:  544 AHVLEQSGKMYSATLGLVDIVRGTNSYYKLQLLEDDLQKRYWVFRSWGRVGTTIGGNKLDKFHDK-NSALDNFLSVYKEKTGNEW-GSSNFIKYPTKFYPLEIDYGQDEEAVKRLTASA----GTKSKLPKPVQELIKMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAYALLTEVQQAVSD-CVPEAQILDLSNRFYTLIPHDFGMKKPPLLNSLDYIQAKVEMLDNLLDIEVAYSLLRGGAQDNEHDPIDINYEKLKTKIEVVDKSTQEAEVITQYVKNTHAATHNTYTLEVQEIFKIGREGERQRFRPFEELHNRQLLWHGSRATNYAGIMSQGLRIAPPEAPVTGYMFGKGVYFADMVSKSANYCHTSQSDPVGLILLAEVALGNMHEL-KKASHITKLPKGKHSVKGLGRTAPDPSA 961          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Medaka
Match: parp3 (poly(ADP-ribose) polymerase family member 3 [Source:NCBI gene;Acc:101172069])

HSP 1 Score: 224.172 bits (570), Expect = 4.448e-64
Identity = 152/444 (34.23%), Postives = 239/444 (53.83%), Query Frame = 3
Query:  876 VDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKI---ASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVH-------VHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNF---DDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPDQS 2168
            VD++C  L+   ++Y    E +  MLNQTN+  NNNKFY+IQ++++ K   +Y W RW RVG++GQ KL  F +    A + F KKF DKTKNDW +R  F    GKY L++++  +   ++ + +   A +V    +   L+E  Q L+ ++F      +A+  M  D  K+PLG+L++ QI  G+  L EIE  L++ +  +  L +  + ++T IPH+FG   PP I +   I+ + ++L  L+DI++A  L +E E           H LD+ Y +L C ++L+   +  +++I  YL  T   +   YN  +++++EV +E E Q F   D   NR LLWHG+       I+  GLRI P     +G   G+GIYFA  ++KS  Y+    S  TG + L EV+LG    + K+     + P    SV   G + PD S
Sbjct:   46 VDEQCP-LASTGEVY----EDYGCMLNQTNIGHNNNKFYVIQVVQENKR--FYSWNRWGRVGEVGQNKLNSF-DTPEKAVKDFEKKFKDKTKNDWSNRSNFVTHPGKYTLIEVEGEQDAEVKVDSVDGKAVKVPKNTLPCTLDEATQKLITLIFSNDMFKEAMECMDLDIKKMPLGKLSKVQIAKGFEVLEEIEAALNKPNQRH-LLEELSSKFFTTIPHNFGRNRPPTINTKEIIEHKKQMLMVLADIELAQTLKSETEKAQEEMIETVPHHLDQDYMSLKCKLSLLDKKSKTFKIIETYLKAT---SDKFYNPTIVNVWEVDREMEGQRFAENDKLENRRLLWHGTNIAVVAAILKSGLRIMPQ----SGGRVGRGIYFASENSKSICYV--RTSNKTGVMFLSEVALGREYTITKDEPSLKEAPSGFDSVVARGRVEPDPS 471          
BLAST of Poly [ADP-ribose] polymerase vs. Planmine SMEST
Match: SMESG000067451.1 (SMESG000067451.1)

HSP 1 Score: 1277.69 bits (3305), Expect = 0.000e+0
Identity = 698/702 (99.43%), Postives = 699/702 (99.57%), Query Frame = 3
Query:   78 EKSTICNNSNKRPKIIVKLDNLSMDSQEDTYKSFIIKRSEHVKDESCVDSPDLNSDCKSSKRETRKIKKLISSESSDVISNKRKRKFTEPPKENFSTKNLKQRLTERKNILKCNNXXXXXXXXXXXXXXXXXXXXXXXNLLSNDLSVALSPVITEHGRYPTRRKIVQEVELNISNKVHKNRVIKKNLKIVKSPVKTSKRLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENQTIKENGSITVGMEKLDIPVDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNFDDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPDQSTWKHL 2183
            EKSTICNNSNKRPKIIVKLDNLSMDSQEDTYKSFIIKRSEHVKDESCVDSP LNSDCKSSKRETRKIKK+ISSESSDVISNKRKRKFTEPPKENFSTKNLKQRLTERKNILKCN KIHAIAI EEKKKAKTISSKNKENLLSNDLSVALSPVITEHGRYPTRRKIVQEVELNISNKVHKNRVIKKNLKIVKSPVKTSKRLVNSVNSNPNQSNDSDSSIKAKKSKIIVSKDDKKSKSAKLNKKVKIENQTIKENGSITVGMEKLDIPVDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNFDDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPDQSTWKHL
Sbjct:    4 EKSTICNNSNKRPKIIVKLDNLSMDSQEDTYKSFIIKRSEHVKDESCVDSPGLNSDCKSSKRETRKIKKVISSESSDVISNKRKRKFTEPPKENFSTKNLKQRLTERKNILKCN-KIHAIAIGEEKKKAKTISSKNKENLLSNDLSVALSPVITEHGRYPTRRKIVQEVELNISNKVHKNRVIKKNLKIVKSPVKTSKRLVNSVNSNPNQSNDSDSSIKAKKSKIIVSKDDKKSKSAKLNKKVKIENQTIKENGSITVGMEKLDIPVDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNFDDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPDQSTWKHL 704          
BLAST of Poly [ADP-ribose] polymerase vs. Planmine SMEST
Match: SMESG000060010.1 (SMESG000060010.1)

HSP 1 Score: 1264.98 bits (3272), Expect = 0.000e+0
Identity = 694/718 (96.66%), Postives = 697/718 (97.08%), Query Frame = 3
Query:   78 EKSTICNNSNKRPKIIVKLDNLSMDSQEDTYKSFIIKRSEHVKDESCVDSPDLNSDCKSSKRETRKIKKLISSESSDVISNKRKRKFTEPPKENFSTKNLKQRLTERKNILKCNNXXXXXXXXXXXXXXXXXXXXXXXNLLSNDLSVALSPVITEHGRYPTRRKIVQEVELNISNKVHKNRVIKKNLKIVKSPVKTSKRLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENQTIKENGSITVGMEKLDIPVDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQ----------------LINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNFDDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPDQSTWKHL 2183
            EKSTICNNSNKRPKIIVKLDNLSMDSQEDTYKSFIIKRSEHVKDESCV+SPDLNSDCKSSKRETRKIKK+ISSESSDVISNKRKRKF E PKENFSTKNLKQRLTERKNILKCNNKIHAIAIDEEKK AKTISSKNKENLLSNDLSVALSPVITEHGRYPTRRKIVQEVELNISNKVHKNRVIKKNLKIVKSPVKTSKRL+NSVNSNPNQSNDSDSSIKAKKSKIIVSKDDKKSKSAKLN KVKIENQTIKENGSITVGMEKLDIPVDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQ                LINDYLLLTHGSTHTTYNLEMLDLFEVRKE EWQNFDDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPDQSTWKHL
Sbjct:    4 EKSTICNNSNKRPKIIVKLDNLSMDSQEDTYKSFIIKRSEHVKDESCVNSPDLNSDCKSSKRETRKIKKVISSESSDVISNKRKRKFIELPKENFSTKNLKQRLTERKNILKCNNKIHAIAIDEEKKIAKTISSKNKENLLSNDLSVALSPVITEHGRYPTRRKIVQEVELNISNKVHKNRVIKKNLKIVKSPVKTSKRLLNSVNSNPNQSNDSDSSIKAKKSKIIVSKDDKKSKSAKLNNKVKIENQTIKENGSITVGMEKLDIPVDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQRGRLVANRSMVTKCGALINDYLLLTHGSTHTTYNLEMLDLFEVRKEHEWQNFDDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPDQSTWKHL 721          
BLAST of Poly [ADP-ribose] polymerase vs. Planmine SMEST
Match: SMESG000067451.1 (SMESG000067451.1)

HSP 1 Score: 1233.78 bits (3191), Expect = 0.000e+0
Identity = 675/679 (99.41%), Postives = 676/679 (99.56%), Query Frame = 3
Query:  147 MDSQEDTYKSFIIKRSEHVKDESCVDSPDLNSDCKSSKRETRKIKKLISSESSDVISNKRKRKFTEPPKENFSTKNLKQRLTERKNILKCNNXXXXXXXXXXXXXXXXXXXXXXXNLLSNDLSVALSPVITEHGRYPTRRKIVQEVELNISNKVHKNRVIKKNLKIVKSPVKTSKRLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENQTIKENGSITVGMEKLDIPVDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNFDDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPDQSTWKHL 2183
            MDSQEDTYKSFIIKRSEHVKDESCVDSP LNSDCKSSKRETRKIKK+ISSESSDVISNKRKRKFTEPPKENFSTKNLKQRLTERKNILKCN KIHAIAI EEKKKAKTISSKNKENLLSNDLSVALSPVITEHGRYPTRRKIVQEVELNISNKVHKNRVIKKNLKIVKSPVKTSKRLVNSVNSNPNQSNDSDSSIKAKKSKIIVSKDDKKSKSAKLNKKVKIENQTIKENGSITVGMEKLDIPVDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNFDDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPDQSTWKHL
Sbjct:    1 MDSQEDTYKSFIIKRSEHVKDESCVDSPGLNSDCKSSKRETRKIKKVISSESSDVISNKRKRKFTEPPKENFSTKNLKQRLTERKNILKCN-KIHAIAIGEEKKKAKTISSKNKENLLSNDLSVALSPVITEHGRYPTRRKIVQEVELNISNKVHKNRVIKKNLKIVKSPVKTSKRLVNSVNSNPNQSNDSDSSIKAKKSKIIVSKDDKKSKSAKLNKKVKIENQTIKENGSITVGMEKLDIPVDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNFDDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPDQSTWKHL 678          
BLAST of Poly [ADP-ribose] polymerase vs. Planmine SMEST
Match: SMESG000060010.1 (SMESG000060010.1)

HSP 1 Score: 1221.07 bits (3158), Expect = 0.000e+0
Identity = 671/695 (96.55%), Postives = 674/695 (96.98%), Query Frame = 3
Query:  147 MDSQEDTYKSFIIKRSEHVKDESCVDSPDLNSDCKSSKRETRKIKKLISSESSDVISNKRKRKFTEPPKENFSTKNLKQRLTERKNILKCNNXXXXXXXXXXXXXXXXXXXXXXXNLLSNDLSVALSPVITEHGRYPTRRKIVQEVELNISNKVHKNRVIKKNLKIVKSPVKTSKRLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENQTIKENGSITVGMEKLDIPVDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQ----------------LINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNFDDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPDQSTWKHL 2183
            MDSQEDTYKSFIIKRSEHVKDESCV+SPDLNSDCKSSKRETRKIKK+ISSESSDVISNKRKRKF E PKENFSTKNLKQRLTERKNILKCNNKIHAIAIDEEKK AKTISSKNKENLLSNDLSVALSPVITEHGRYPTRRKIVQEVELNISNKVHKNRVIKKNLKIVKSPVKTSKRL+NSVNSNPNQSNDSDSSIKAKKSKIIVSKDDKKSKSAKLN KVKIENQTIKENGSITVGMEKLDIPVDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQ                LINDYLLLTHGSTHTTYNLEMLDLFEVRKE EWQNFDDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPDQSTWKHL
Sbjct:    1 MDSQEDTYKSFIIKRSEHVKDESCVNSPDLNSDCKSSKRETRKIKKVISSESSDVISNKRKRKFIELPKENFSTKNLKQRLTERKNILKCNNKIHAIAIDEEKKIAKTISSKNKENLLSNDLSVALSPVITEHGRYPTRRKIVQEVELNISNKVHKNRVIKKNLKIVKSPVKTSKRLLNSVNSNPNQSNDSDSSIKAKKSKIIVSKDDKKSKSAKLNNKVKIENQTIKENGSITVGMEKLDIPVDKECKELSCKAKIYVENSEVFDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQRGRLVANRSMVTKCGALINDYLLLTHGSTHTTYNLEMLDLFEVRKEHEWQNFDDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPDQSTWKHL 695          
BLAST of Poly [ADP-ribose] polymerase vs. Planmine SMEST
Match: SMESG000060010.1 (SMESG000060010.1)

HSP 1 Score: 350.132 bits (897), Expect = 6.024e-115
Identity = 257/264 (97.35%), Postives = 260/264 (98.48%), Query Frame = 3
Query:   78 EKSTICNNSNKRPKIIVKLDNLSMDSQEDTYKSFIIKRSEHVKDESCVDSPDLNSDCKSSKRETRKIKKLISSESSDVISNKRKRKFTEPPKENFSTKNLKQRLTERKNILKCNNXXXXXXXXXXXXXXXXXXXXXXXNLLSNDLSVALSPVITEHGRYPTRRKIVQEVELNISNKVHKNRVIKKNLKIVKSPVKTSKRLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENQTIKENGSITVGMEKLD 869
            EKSTICNNSNKRPKIIVKLDNLSMDSQEDTYKSFIIKRSEHVKDESCV+SPDLNSDCKSSKRETRKIKK+ISSESSDVISNKRKRKF E PKENFSTKNLKQRLTERKNILKCNNKIHAIAIDEEKK AKTISSKNKENLLSNDLSVALSPVITEHGRYPTRRKIVQEVELNISNKVHKNRVIKKNLKIVKSPVKTSKRL+NSVNSNPNQSNDSDSSIKAKKSKIIVSKDDKKSKSAKLN KVKIENQTIKENGSITVGMEKLD
Sbjct:    4 EKSTICNNSNKRPKIIVKLDNLSMDSQEDTYKSFIIKRSEHVKDESCVNSPDLNSDCKSSKRETRKIKKVISSESSDVISNKRKRKFIELPKENFSTKNLKQRLTERKNILKCNNKIHAIAIDEEKKIAKTISSKNKENLLSNDLSVALSPVITEHGRYPTRRKIVQEVELNISNKVHKNRVIKKNLKIVKSPVKTSKRLLNSVNSNPNQSNDSDSSIKAKKSKIIVSKDDKKSKSAKLNNKVKIENQTIKENGSITVGMEKLD 267          
The following BLAST results are available for this feature:
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PARP23.127e-15752.13poly(ADP-ribose) polymerase 2 [Source:HGNC Symbol;... [more]
PARP21.109e-15651.88poly(ADP-ribose) polymerase 2 [Source:HGNC Symbol;... [more]
PARP27.621e-15652.13poly(ADP-ribose) polymerase 2 [Source:HGNC Symbol;... [more]
PARP11.585e-9441.07poly(ADP-ribose) polymerase 1 [Source:HGNC Symbol;... [more]
PARP32.723e-5634.95poly(ADP-ribose) polymerase family member 3 [Sourc... [more]
back to top
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
parp-15.316e-7636.99Poly [ADP-ribose] polymerase 1 [Source:UniProtKB/... [more]
parp-16.252e-5939.86Poly [ADP-ribose] polymerase 1 [Source:UniProtKB/... [more]
parp-13.113e-3841.12Poly [ADP-ribose] polymerase 1 [Source:UniProtKB/... [more]
parp-22.226e-3429.31Poly [ADP-ribose] polymerase 2 [Source:UniProtKB/... [more]
parp-22.226e-3429.31Poly [ADP-ribose] polymerase 2 [Source:UniProtKB/... [more]
back to top
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Parp1.637e-8538.97gene:FBgn0010247 transcript:FBtr0113885[more]
back to top
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
parp22.195e-15053.70poly (ADP-ribose) polymerase 2 [Source:ZFIN;Acc:ZD... [more]
parp22.467e-15053.70poly (ADP-ribose) polymerase 2 [Source:ZFIN;Acc:ZD... [more]
parp22.296e-13951.85poly (ADP-ribose) polymerase 2 [Source:ZFIN;Acc:ZD... [more]
parp12.552e-9239.65poly (ADP-ribose) polymerase 1 [Source:ZFIN;Acc:ZD... [more]
parp12.797e-9239.65poly (ADP-ribose) polymerase 1 [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gldn1.369e-14249.65gliomedin [Source:Xenbase;Acc:XB-GENE-1004090][more]
gldn3.427e-14049.65gliomedin [Source:Xenbase;Acc:XB-GENE-1004090][more]
gldn6.825e-14049.65gliomedin [Source:Xenbase;Acc:XB-GENE-1004090][more]
gldn6.147e-13249.88gliomedin [Source:Xenbase;Acc:XB-GENE-1004090][more]
gldn8.561e-13250.12gliomedin [Source:Xenbase;Acc:XB-GENE-1004090][more]
back to top
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Parp21.627e-15751.70poly (ADP-ribose) polymerase family, member 2 [Sou... [more]
Parp11.233e-9340.75poly (ADP-ribose) polymerase family, member 1 [Sou... [more]
Parp32.231e-4834.00poly (ADP-ribose) polymerase family, member 3 [Sou... [more]
Parp33.869e-4834.08poly (ADP-ribose) polymerase family, member 3 [Sou... [more]
Parp33.869e-4834.08poly (ADP-ribose) polymerase family, member 3 [Sou... [more]
back to top
BLAST of Poly [ADP-ribose] polymerase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O88554|PARP2_MOUSE1.138e-15651.70Poly [ADP-ribose] polymerase 2 OS=Mus musculus OX=... [more]
sp|Q9UGN5|PARP2_HUMAN3.660e-15552.13Poly [ADP-ribose] polymerase 2 OS=Homo sapiens OX=... [more]
sp|Q11207|PARP2_ARATH2.790e-10239.27Poly [ADP-ribose] polymerase 2 OS=Arabidopsis thal... [more]
sp|Q5Z8Q9|PRP2A_ORYSJ1.517e-10141.04Poly [ADP-ribose] polymerase 2-A OS=Oryza sativa s... [more]
sp|O50017|PARP2_MAIZE7.697e-9941.63Poly [ADP-ribose] polymerase 2 OS=Zea mays OX=4577... [more]
back to top
BLAST of Poly [ADP-ribose] polymerase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2K5SJM75.886e-15852.90Poly [ADP-ribose] polymerase OS=Cebus capucinus im... [more]
G1U3921.147e-15751.88Poly [ADP-ribose] polymerase OS=Oryctolagus cunicu... [more]
A0A2F0BK684.883e-15752.93Poly [ADP-ribose] polymerase (Fragment) OS=Eschric... [more]
W5K9Z71.684e-15653.70Poly [ADP-ribose] polymerase OS=Astyanax mexicanus... [more]
A0A341CQK92.521e-15652.70Poly [ADP-ribose] polymerase OS=Neophocaena asiaeo... [more]
back to top
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
parp26.380e-16053.70poly(ADP-ribose) polymerase 2 [Source:NCBI gene;Ac... [more]
parp23.859e-14851.85poly(ADP-ribose) polymerase 2 [Source:NCBI gene;Ac... [more]
parp14.348e-9240.05poly(ADP-ribose) polymerase 1 [Source:NCBI gene;Ac... [more]
parp16.623e-8839.44poly(ADP-ribose) polymerase 1 [Source:NCBI gene;Ac... [more]
parp33.403e-6235.57poly(ADP-ribose) polymerase family member 3 [Sourc... [more]
back to top
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000003213.11.742e-1759.02pep scaffold:Pmarinus_7.0:GL484848:6623:9574:1 gen... [more]
ENSPMAT00000009608.14.656e-634.43pep scaffold:Pmarinus_7.0:GL477242:23155:61557:-1 ... [more]
back to top
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO464805.268e-12646.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468122.281e-9441.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO263457.495e-7243.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO299762.478e-1328.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO299772.418e-1058.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
parp23.589e-15552.20poly(ADP-ribose) polymerase 2 [Source:NCBI gene;Ac... [more]
parp21.891e-14850.81poly(ADP-ribose) polymerase 2 [Source:NCBI gene;Ac... [more]
parp27.309e-14747.37poly(ADP-ribose) polymerase 2 [Source:NCBI gene;Ac... [more]
parp11.065e-8939.67poly(ADP-ribose) polymerase 1 [Source:NCBI gene;Ac... [more]
parp34.448e-6434.23poly(ADP-ribose) polymerase family member 3 [Sourc... [more]
back to top
BLAST of Poly [ADP-ribose] polymerase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000067451.10.000e+099.43SMESG000067451.1[more]
SMESG000060010.10.000e+096.66SMESG000060010.1[more]
SMESG000067451.10.000e+099.41SMESG000067451.1[more]
SMESG000060010.10.000e+096.55SMESG000060010.1[more]
SMESG000060010.16.024e-11597.35SMESG000060010.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035855 ID=SMED30035855|Name=Poly [ADP-ribose] polymerase|organism=Schmidtea mediterranea sexual|type=transcript|length=2387bp
ATTTTTAATTAAATTTATTTTCTAAATAATATTGAAAATAATTTAATAAA
ACTATCTATTTTACAATGCGTAAATGTGAAAAGTCTACAATTTGTAATAA
TAGTAACAAAAGACCAAAGATAATAGTAAAATTAGATAATTTATCTATGG
ATTCACAGGAAGATACATATAAGTCTTTTATAATTAAAAGATCCGAACAC
GTTAAGGATGAATCATGTGTCGATTCTCCTGATTTGAATAGTGACTGTAA
ATCAAGCAAAAGAGAAACTAGAAAAATCAAAAAACTAATATCTTCAGAAA
GTAGTGATGTAATTTCTAACAAAAGAAAAAGGAAATTTACTGAGCCTCCA
AAAGAAAACTTTTCAACTAAGAACTTAAAACAGAGACTAACAGAAAGAAA
AAATATTTTAAAATGTAACAACAAAATACATGCCATAGCTATCGATGAAG
AGAAAAAGAAAGCTAAAACAATTTCAAGTAAAAATAAGGAAAATTTATTA
AGCAATGATCTATCAGTCGCTTTATCACCAGTTATTACAGAACATGGAAG
ATATCCTACCAGAAGAAAAATTGTCCAGGAAGTCGAATTAAATATTTCCA
ATAAAGTTCATAAAAACAGAGTAATAAAAAAGAATTTGAAAATAGTAAAG
TCTCCTGTAAAAACAAGCAAAAGATTGGTAAATTCAGTTAATAGTAATCC
AAACCAATCGAATGATTCAGATTCATCTATTAAAGCAAAAAAGTCGAAAA
TCATTGTCAGTAAAGATGATAAAAAATCAAAATCAGCAAAACTGAATAAA
AAAGTTAAAATAGAAAATCAAACTATAAAAGAAAATGGCAGCATAACTGT
TGGGATGGAGAAATTAGATATTCCCGTAGATAAAGAATGTAAAGAACTAT
CGTGCAAAGCAAAGATTTATGTAGAAAATAGTGAAGTGTTTGATGTTATG
TTGAATCAAACCAATTTGCAGTTCAATAACAACAAATTTTACATAATTCA
ACTGTTAAAAGATGAAAAAGAACCAATTTACTACGTTTGGATGAGATGGG
CCCGTGTAGGGAAAATCGGCCAAATGAAATTAACTAGATTTTATAACAAC
CTTGCCGCTGCCAAAGAGTGCTTCATGAAAAAGTTCTACGATAAAACGAA
AAATGACTGGCAAGATCGTCAGAAATTTGAGAAAATAAATGGCAAATATG
ATCTTGTACAGATTGATTACTGTAAAAAGGAAATTCTGGAAACGAATAAA
ATAGCGAGCCAAGTTAAATTAGAACCGATTGAAAGTAAATTAGAAGAAAA
ATTACAAGATCTTATGCGAATTGTCTTTGATTTGAAAGAAATGAATGATG
CAGTGTCGGAAATGAAATATGATAATAATAAGGTGCCACTTGGACGCCTG
ACTGAGGCACAGATCAAAGCTGGTTATCTAGCTCTCCGAGAAATCGAAGG
ATTGTTGAGTGAGGGGCATTCTAGCAATAAATCGTTAGTCCAGGCGTGCA
ACACGTATTACACTAGAATACCGCACGATTTCGGCATGAGAATTCCACCT
CTCATACGATCCATATCAGAAATTAAAAGAGAACTGGAGTTATTGGAAAC
GTTAAGCGACATAAAGATTGCGCTGAAGCTCATCAATGAAAATGAAGATG
TACATGTTCATCCTCTAGACCGCCATTACCAAAATCTTCATTGTATTATT
AATTTAGTTACAATCGATAATCCGATTTATCAGCTTATTAATGACTACTT
ATTGCTCACTCATGGCTCAACGCATACGACATACAATCTTGAAATGCTCG
ATTTATTTGAGGTAAGAAAGGAACAAGAATGGCAAAATTTCGACGATAAA
GGAAATCGAATGCTTCTTTGGCACGGTTCAAGAACAACTAATTACGGTGG
AATTATCAGTCAAGGATTGAGAATCGCCCCGGCTGAGGCTCCCGTTACCG
GACACATGTTTGGAAAGGGTATTTATTTTGCTGACATGAGCACAAAGTCA
GCAAACTATATTTACCCGACGAGATCGAAAAATACCGGTTTCTTGTTGTT
ATGTGAAGTATCATTAGGAACTTGTAATGAATTAATCAAAGAGAACTCTC
GGGCTAATAAACTGCCACCTAACTGCCATAGTGTAAAGGGGCTCGGAATT
ATCGCTCCTGACCAATCCACATGGAAACATTTGTAAAATTAACTGATTGA
TTCAATTTATTCAATATTAGTTAACTTTCTATTCCTAGGGAGGATGGTAC
GCTCGTTCCCGTAGGGATTCCGGTCGATACTGGAGTGGGGGAGAAACGCA
AGGGGGCATATGTACTCAATTACAACGAATATATCGTTTACAAACAAAAC
CAAGTCAAAATGCGCTTCTTAGTGAAAGTTCGATTCA
back to top

protein sequence of SMED30035855-orf-1

>SMED30035855-orf-1 ID=SMED30035855-orf-1|Name=SMED30035855-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=707bp
MRKCEKSTICNNSNKRPKIIVKLDNLSMDSQEDTYKSFIIKRSEHVKDES
CVDSPDLNSDCKSSKRETRKIKKLISSESSDVISNKRKRKFTEPPKENFS
TKNLKQRLTERKNILKCNNKIHAIAIDEEKKKAKTISSKNKENLLSNDLS
VALSPVITEHGRYPTRRKIVQEVELNISNKVHKNRVIKKNLKIVKSPVKT
SKRLVNSVNSNPNQSNDSDSSIKAKKSKIIVSKDDKKSKSAKLNKKVKIE
NQTIKENGSITVGMEKLDIPVDKECKELSCKAKIYVENSEVFDVMLNQTN
LQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAK
ECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQV
KLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQI
KAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSI
SEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTI
DNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNFDDKGNRML
LWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIY
PTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPDQ
STWKHL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036930WGR_dom_sf
IPR036616Poly(ADP-ribose)pol_reg_dom_sf
IPR012317Poly(ADP-ribose)pol_cat_dom
IPR008893WGR_domain
IPR004102Poly(ADP-ribose)pol_reg_dom
Vocabulary: molecular function
TermDefinition
GO:0003950NAD+ ADP-ribosyltransferase activity
GO:0003677DNA binding
GO:0003910DNA ligase (ATP) activity
GO:0005515protein binding
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
Vocabulary: biological process
TermDefinition
GO:0006471protein ADP-ribosylation
GO:0006273lagging strand elongation
GO:0006281DNA repair
GO:0006284base-excision repair
GO:0051103DNA ligation involved in DNA repair
GO:0097191extrinsic apoptotic signaling pathway
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005730nucleolus
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008893WGR domainSMARTSM00773WGR_clscoord: 291..371
e-value: 1.5E-26
score: 104.2
IPR008893WGR domainPFAMPF05406WGRcoord: 292..371
e-value: 7.5E-24
score: 83.6
IPR036930WGR domain superfamilyGENE3DG3DSA:2.20.140.10coord: 256..399
e-value: 6.4E-42
score: 144.5
IPR036930WGR domain superfamilySUPERFAMILYSSF142921WGR domain-likecoord: 267..381
NoneNo IPR availableGENE3DG3DSA:3.90.228.10coord: 408..701
e-value: 3.8E-109
score: 366.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 201..219
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 201..225
NoneNo IPR availablePANTHERPTHR10459:SF60POLY [ADP-RIBOSE] POLYMERASE 2coord: 63..704
NoneNo IPR availablePANTHERPTHR10459DNA LIGASEcoord: 63..704
NoneNo IPR availableCDDcd08003WGR_PARP2_likecoord: 283..384
e-value: 9.65549E-53
score: 175.208
NoneNo IPR availableCDDcd01437parp_likecoord: 405..700
e-value: 1.05678E-118
score: 357.35
NoneNo IPR availableSUPERFAMILYSSF56399ADP-ribosylationcoord: 540..702
IPR036616Poly(ADP-ribose) polymerase, regulatory domain superfamilyGENE3DG3DSA:1.20.142.10coord: 421..528
e-value: 3.8E-109
score: 366.9
IPR036616Poly(ADP-ribose) polymerase, regulatory domain superfamilySUPERFAMILYSSF47587Domain of poly(ADP-ribose) polymerasecoord: 405..538
IPR012317Poly(ADP-ribose) polymerase, catalytic domainPFAMPF00644PARPcoord: 554..699
e-value: 1.5E-48
score: 165.0
IPR012317Poly(ADP-ribose) polymerase, catalytic domainPROSITEPS51059PARP_CATALYTICcoord: 531..705
score: 59.725
IPR004102Poly(ADP-ribose) polymerase, regulatory domainPFAMPF02877PARP_regcoord: 406..537
e-value: 6.3E-43
score: 146.1
IPR004102Poly(ADP-ribose) polymerase, regulatory domainPROSITEPS51060PARP_ALPHA_HDcoord: 405..523
score: 36.343