WD repeat domain 70

Overview
NameWD repeat domain 70
Smed IDSMED30035842
Length (bp)1677
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of WD repeat domain 70 (SMED30035842) t-SNE clustered cells

Violin plots show distribution of expression levels for WD repeat domain 70 (SMED30035842) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of WD repeat domain 70 (SMED30035842) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for WD repeat domain 70 (SMED30035842) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035842

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30035842SMESG000059911.1 SmedASXL_013721SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30035842SMESG000059911.1 dd_Smed_v4_5151_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035842SMESG000059911.1 Contig35185uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035842SMESG000059911.1 Contig35185newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of WD repeat domain 70 vs. Ensembl Human
Match: WDR70 (WD repeat domain 70 [Source:HGNC Symbol;Acc:HGNC:25495])

HSP 1 Score: 317.005 bits (811), Expect = 1.154e-99
Identity = 174/497 (35.01%), Postives = 269/497 (54.12%), Query Frame = 1
Query:  139 VYFIPKSESVKLSHGQKMITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCE-QEIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDIRTGMKTPQHVWSDLYVTNERTNCIVSPSDKMVITGTSLRKNETESHAIFYNRSTFEEIDRIPLKNASTVTVEWHPRLNQLLIGSSVGTLDLFYDRTFSHNGALSFMSKAPKPKKSNREFYTNDMLLT------YDEETERLARIGQRASKFREGPELNPYLKAKKEMKKRVPQQPTEANNKYPTLHQHLVQQIVIPKRTPEAEYYENNPREAILRHANAPK---YWTAGAYDKTQPKPIFDTEEDE 1599
            V+ IP S  + L HG K +++  ++ +G RL+T   D  +  WDF GM+++  +F+++ PCE  +IK +++S  G+ ILV+S   QA ++DR+G  V+E IKG+ Y+ D  +TKGH  ML+ G W+P++  +  TCS D +VR W +            K  KS   P++++GKK+IP TC Y+  G ++ AAC +GSIQ+WD R     P FH   A+   T+ S + F+YD   + +R  DD++K++DIR     P    S L      T+C  SP DK+++TGTS+++       +F+ R TF+ +  I + +AS V   WHP+LNQ+++G+  G   ++YD   S  GA   + K  + K    E  T D ++T      + E  +R  R      K  E   L+P    K E     P +         TL  ++V+ I + K        ++NPREAILRHA A +   YW + AY KTQPK +F   E +
Sbjct:  167 VHKIPDSHEITLKHGTKTVSALGLDPSGARLVTGGYDYDVKFWDFAGMDASFKAFRSLQPCECHQIKSLQYSNTGDMILVVSGSSQAKVIDRDGFEVMECIKGDQYIVDMANTKGHTAMLHTGSWHPKIKGEFMTCSNDATVRTWEV---------ENPKKQKSVFKPRTMQGKKVIPTTCTYSRDGNLIAAACQNGSIQIWD-RNLTVHPKFHYKQAHDSGTDTSCVTFSYDGNVLASRGGDDSLKLWDIRQ-FNKPLFSASGLPTMFPMTDCCFSPDDKLIVTGTSIQRGCGSGKLVFFERRTFQRVYEIDITDASVVRCLWHPKLNQIMVGTGNGLAKVYYDPNKSQRGAKLCVVKTQR-KAKQAETLTQDYIITPHALPMFREPRQRSTR------KQLEKDRLDPLKSHKPEPPVAGPGRGGRVGTHGGTLSSYIVKNIALDKTD------DSNPREAILRHAKAAEDSPYWVSPAYSKTQPKTMFAQVESD 639          
BLAST of WD repeat domain 70 vs. Ensembl Human
Match: WDR70 (WD repeat domain 70 [Source:HGNC Symbol;Acc:HGNC:25495])

HSP 1 Score: 180.644 bits (457), Expect = 7.618e-51
Identity = 80/203 (39.41%), Postives = 127/203 (62.56%), Query Frame = 1
Query:  139 VYFIPKSESVKLSHGQKMITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCE-QEIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWD 744
            V+ IP S  + L HG K +++  ++ +G RL+T   D  +  WDF GM+++  +F+++ PCE  +IK +++S  G+ ILV+S   QA ++DR+G  V+E IKG+ Y+ D  +TKGH  ML+ G W+P++  +  TCS D +VR W +            K  KS   P++++GKK+IP TC Y+  G ++ AAC +GSIQ+WD
Sbjct:  167 VHKIPDSHEITLKHGTKTVSALGLDPSGARLVTGGYDYDVKFWDFAGMDASFKAFRSLQPCECHQIKSLQYSNTGDMILVVSGSSQAKVIDRDGFEVMECIKGDQYIVDMANTKGHTAMLHTGSWHPKIKGEFMTCSNDATVRTWEV---------ENPKKQKSVFKPRTMQGKKVIPTTCTYSRDGNLIAAACQNGSIQIWD 360          
BLAST of WD repeat domain 70 vs. Ensembl Human
Match: POC1B (POC1 centriolar protein B [Source:HGNC Symbol;Acc:HGNC:30836])

HSP 1 Score: 51.2174 bits (121), Expect = 3.190e-6
Identity = 56/260 (21.54%), Postives = 102/260 (39.23%), Query Frame = 1
Query:  145 FIPKSESVKLSHGQKMITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCEQEIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCI--VPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTR--KSFTKPDFH-----CVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDIRTG 897
            F P + + +    + ++TS      GN L +A++D T+ LW         S FK  T     ++ ++FSA+G+ +   S D    +     +R L ++              H   +    ++P     + +CS D +++IW+               +K C+     SV     +     +  SG  + +A SD ++++WD R  K       H     C+S +P    +            IT S+D  +KI D+  G
Sbjct:    5 FKPHARAYRYVGHKDVVTSVQFSPHGNLLASASRDRTVRLW-IPDKRGKFSEFKAHT---APVRSVDFSADGQFLATASEDKSIKVWSMYRQRFLYSL------------YRHTHWVRCAKFSPD-GRLIVSCSEDKTIKIWDT-------------TNKQCVNNFSDSVGFANFV----DFNPSGTCIASAGSDQTVKVWDVRVNKLLQHYQVHSGGVNCISFHPSGNYL------------ITASSDGTLKILDLLEG 218          
BLAST of WD repeat domain 70 vs. Ensembl Human
Match: POC1B (POC1 centriolar protein B [Source:HGNC Symbol;Acc:HGNC:30836])

HSP 1 Score: 51.6026 bits (122), Expect = 3.209e-6
Identity = 56/260 (21.54%), Postives = 102/260 (39.23%), Query Frame = 1
Query:  145 FIPKSESVKLSHGQKMITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCEQEIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCI--VPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTR--KSFTKPDFH-----CVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDIRTG 897
            F P + + +    + ++TS      GN L +A++D T+ LW         S FK  T     ++ ++FSA+G+ +   S D    +     +R L ++              H   +    ++P     + +CS D +++IW+               +K C+     SV     +     +  SG  + +A SD ++++WD R  K       H     C+S +P    +            IT S+D  +KI D+  G
Sbjct:   47 FKPHARAYRYVGHKDVVTSVQFSPHGNLLASASRDRTVRLW-IPDKRGKFSEFKAHT---APVRSVDFSADGQFLATASEDKSIKVWSMYRQRFLYSL------------YRHTHWVRCAKFSPD-GRLIVSCSEDKTIKIWDT-------------TNKQCVNNFSDSVGFANFV----DFNPSGTCIASAGSDQTVKVWDVRVNKLLQHYQVHSGGVNCISFHPSGNYL------------ITASSDGTLKILDLLEG 260          
BLAST of WD repeat domain 70 vs. Ensembl Celegans
Match: gad-1 (Gastrulation defective protein 1 [Source:UniProtKB/Swiss-Prot;Acc:O16519])

HSP 1 Score: 234.187 bits (596), Expect = 6.105e-69
Identity = 159/511 (31.12%), Postives = 257/511 (50.29%), Query Frame = 1
Query:  139 VYFIPKSESVKLSHGQKMITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCEQE-IKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDIRTGMKTPQHVWSDLYVTNERTNCIVSPSDKMVITGTSLRKNETESHAIFYNRSTFEEIDRIPLKNASTVTVEWHPRLNQLLIGSSVGTLDLFYDRTFSHNGALSFMSKAPKPKKSNR--EFYTNDMLLT---------YDEETERLARIGQRASKF--REGPELNPYLKAKKEMKKRVPQQPTEANNKYP----TLHQHLVQQIVIPKRTPEAEYYEN-NPREAILRHANAPK---YWTAGAYDKTQPKPIFDTEEDEPD 1605
            +  IP +   K+SHG + I++  +E  G R  +   D  + L+DF  M+ +    K + P E   I  + FS NGE ++V S +    +LDR G++  ET++G+ Y+ D   TKGH   +N   +NP    +  +CS DGS+R+WN LD  K+++ + I  H+  I  K   GK++ P  C ++  G  + A C DGS+Q W     +   ++    A+  N  I+S+ F+ D   +++R  DD +K++ +    K P  V + L    + T+C  SP  ++V TGTS    +T     F++  TF+ + +I     S   ++WHPRLNQ++ G S GT+ ++YD+T S  G +S ++   KP K NR  E    DM+L+           EE E     G R  K+   +  +L P  +   +M    P     AN +      +LH +L +QI   +    AE+ ++ + R +IL+HA   +    +   AY KTQPK IF     EP+
Sbjct:  108 IKLIPAACEAKISHGTQAISALRVEPPGVRFASGGLDYYVKLFDFQKMDMSMRYDKELLPAESHVINSLAFSPNGETLVVASGEAIIRLLDRAGKQWSETVRGDQYIIDLNITKGHTATVNCVEFNPLNKNEFISCSDDGSLRLWN-LDDHKVIT-KCINKHRKVIKTKGANGKRVSPQVCTFSPDGKWIAAGCDDGSVQAWKYGSQYVNVNYLVRKAH--NGSITSIAFSPDSKRLLSRGFDDTLKMWSL-DNPKEPLLVKTGLENAFKSTDCGFSPRAEVVFTGTSSPNKDTPGTLQFFDPMTFDLVYKIDYPGISCHRIQWHPRLNQIIAGLSDGTIHVYYDQTMSQRGVMSCVT---KPLKRNRASEVVREDMVLSPLSLEMFQPRGEEGEEKEVTGWRIKKYLRMQDNKLRPEFRKPADM----PINGKSANGRVAASGGSLHSYLAKQIGTAR---NAEFLKDTDVRASILKHAKDAEENPLYIDKAYRKTQPKKIFQETAVEPE 603          
BLAST of WD repeat domain 70 vs. Ensembl Celegans
Match: prp-17 (Yeast PRP (Splicing factor) related [Source:UniProtKB/TrEMBL;Acc:O44729])

HSP 1 Score: 53.1434 bits (126), Expect = 4.499e-7
Identity = 28/115 (24.35%), Postives = 53/115 (46.09%), Query Frame = 1
Query:  475 KGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFH------CVSAYPEN 801
            +GHNK +N+  W P+ A    +CS D  +++W + D ++++              ++  G K+     A+ + G    +A  D  ++LWDT     K  FH      C+  +P++
Sbjct:  272 RGHNKGVNFLQWFPKSAHLFLSCSMDTKIKLWEVYDRQRVV--------------RTYAGHKLPVREVAFNNEGTEFLSASFDRYVKLWDTETGQVKQRFHTGHVPYCLKYHPDD 372          
BLAST of WD repeat domain 70 vs. Ensembl Celegans
Match: prp-17 (Yeast PRP (Splicing factor) related [Source:UniProtKB/TrEMBL;Acc:O44729])

HSP 1 Score: 53.1434 bits (126), Expect = 4.499e-7
Identity = 28/115 (24.35%), Postives = 53/115 (46.09%), Query Frame = 1
Query:  475 KGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFH------CVSAYPEN 801
            +GHNK +N+  W P+ A    +CS D  +++W + D ++++              ++  G K+     A+ + G    +A  D  ++LWDT     K  FH      C+  +P++
Sbjct:  272 RGHNKGVNFLQWFPKSAHLFLSCSMDTKIKLWEVYDRQRVV--------------RTYAGHKLPVREVAFNNEGTEFLSASFDRYVKLWDTETGQVKQRFHTGHVPYCLKYHPDD 372          
BLAST of WD repeat domain 70 vs. Ensembl Celegans
Match: atg-16.2 (Autophagic-related protein 16.2 [Source:UniProtKB/Swiss-Prot;Acc:Q09406])

HSP 1 Score: 51.2174 bits (121), Expect = 1.711e-6
Identity = 67/306 (21.90%), Postives = 129/306 (42.16%), Query Frame = 1
Query:  235 TANKDCTMNLWDFNGMNSTASSFKTVTPCEQEIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNP-YLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDIRT-GMKTPQHVWS-DLYVTN-ERTNCIVSPSDKMVITGTSLRKNETESHAIFYNRST--FEEIDRIPLKN-ASTVTVEWHPRLNQLL 1131
            TA  D  + +W  +   + AS   T++ C   + ++++ +     L  SND    + + + +R+L T  G+   +   R  + HN               + + S D +++ W+I           I+  KS +V  +V     I   C  + S  +  ++  D  ++ WD R S          +     ++SSL  + D L V+  S DD + + D+R  G+    H++S + Y T+ + T  I S + + V+ G+S       S    +N  T   E++ +    + A  +++ W+P    LL
Sbjct:  261 TAGSDSKVQIWRVSPNKTDASKVSTLSGCLGPVNRLDYDSQRHVCLASSNDKTCRLWNIDSQRLLSTFSGHTDKVSSARLFQSHN---------------VISGSADRTIKNWDI---------SSIRCLKSYLVGSTVFD---IVAKCGVSQSSFI--SSHFDKKVRFWDARSS------DATYSVELGQKVSSLDISMDGLQVLASSRDDTLSLIDVRNYGII---HLYSAEQYKTSCDSTRAIFSSTGEYVLAGSS------NSSVFIWNTKTTKLEKVVKTARSDSAQIMSLAWNPSGRGLL 522          
BLAST of WD repeat domain 70 vs. Ensembl Fly
Match: CG5543 (gene:FBgn0034908 transcript:FBtr0072124)

HSP 1 Score: 299.286 bits (765), Expect = 3.657e-93
Identity = 170/497 (34.21%), Postives = 268/497 (53.92%), Query Frame = 1
Query:  148 IPKSESVKLSHGQKMITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCEQE-IKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCV-SAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDIRTGMKTPQHVWSDLYVTNERTNCIVSPSDKMVITGTSLRKNETESHAIFYNRSTFEEIDRIPLKNASTVTVEWHPRLNQLLIGSSVGTLDLFYDRTFSHNGALSFMSKAPKPKK-----SNREFYTNDMLLTYDEETERLARIGQRASKFREGPELNPYLKAKKEMKKRVPQQPTEANNKYPTLHQHLVQQIVIPKRTPEAEYYENNPREAILRHANAPK---YWTAGAYDKTQPKPIFDTE--EDEP 1602
            IP +  V++ HG + + + + + +G RL++ + D  M  WDF GM+S+  SF+ + PCE   I+ +++S  G+ ILVIS + QA +LDR+G   LE  KG+ Y+ D   TKGH   L  GCW+P   E   T + DG++RIW  L         + K     I  ++  G +    +C +     ++ A C DGSIQ WDTRK F     HCV  A+ + +EI+S++F+Y    + TRSND+ MK++D+R   K P H W++L+   + T+C  SP D++++TG SL K + E++  FY+  ++EE+ RIP+ NA  V   WHP+LNQL +    GT+  +YD   S  GA   + K  + ++        +  T   L  + +E  R +R  +R  K R  P     +K+++        Q     +   TL  ++++ + + KR  +    + +PREAIL++A       YW A AY +TQPK IF  +   DEP
Sbjct:  170 IPYTHEVQMQHGSRAVLALAGDPSGARLVSGSIDYDMCFWDFAGMDSSMRSFRQLQPCENHPIRSLQYSVTGDMILVISGNAQAKVLDRDGFEKLECCKGDQYISDMSRTKGHVAQLTSGCWHPFNREQFLTAALDGTLRIWQGL---------KSKEQLQVIKTRAQGGLRTNAASCNFNRDATLIAAGCVDGSIQTWDTRKMFVNTT-HCVRDAHQKGSEITSIVFSYMGQQLATRSNDETMKLWDLRQ-FKQPLHTWTNLFSRYDTTDCCFSPDDRLLVTGESLPKGQAEANLYFYSTKSYEEVQRIPVSNAHVVKTLWHPKLNQLFVSCGNGTIKCYYDEHRSIRGAKLCVVKTHRKRQPMEMVGVSQIITPHALPLFRQEKSRTSR--KRMEKARMDP-----VKSQRPDLPITSGQGGRVASSGGTLSSYVIRNLGLSKRVDD----DQDPREAILKYAKDAAENPYWIAPAYKQTQPKAIFSEKLPADEP 644          
BLAST of WD repeat domain 70 vs. Ensembl Fly
Match: kat80 (gene:FBgn0040207 transcript:FBtr0074246)

HSP 1 Score: 53.9138 bits (128), Expect = 3.346e-7
Identity = 58/233 (24.89%), Postives = 101/233 (43.35%), Query Frame = 1
Query:  193 ITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCEQEIKKIEFSANGEHILVISNDIQAFI-LDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDI 888
            +TS  +  TG  L+T  +D  +NLW   G N     F ++T   + I  + F A  ++ +  ++DI      D   +++  T+ G            H K +    +NP   E + + S D +VR+W++            +N  +CI  K  RG      +  ++  GL + +A  +GSI +WD RKS    +F    A P  T I+ + F   +  +     D  + I+D+
Sbjct:   21 VTSLDLGETGRVLVTGGEDRNVNLWAI-GQNEC---FMSLTGHNRSIDCVRF-AYKDNFVYSADDIGIIRRWDLNSQKIYSTLNG------------HMKSVRTLDFNPS-GEYVVSGSNDTTVRLWDV------------QNENNCI--KVCRGHMSHVNSVKFSPDGLWIASAGLEGSILIWDIRKSKQIMEF---IADPPVTAITCVQFHPFEFLLAAGRVDGTVSIYDL 218          
BLAST of WD repeat domain 70 vs. Ensembl Fly
Match: kat80 (gene:FBgn0040207 transcript:FBtr0074247)

HSP 1 Score: 53.9138 bits (128), Expect = 3.346e-7
Identity = 58/233 (24.89%), Postives = 101/233 (43.35%), Query Frame = 1
Query:  193 ITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCEQEIKKIEFSANGEHILVISNDIQAFI-LDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDI 888
            +TS  +  TG  L+T  +D  +NLW   G N     F ++T   + I  + F A  ++ +  ++DI      D   +++  T+ G            H K +    +NP   E + + S D +VR+W++            +N  +CI  K  RG      +  ++  GL + +A  +GSI +WD RKS    +F    A P  T I+ + F   +  +     D  + I+D+
Sbjct:   21 VTSLDLGETGRVLVTGGEDRNVNLWAI-GQNEC---FMSLTGHNRSIDCVRF-AYKDNFVYSADDIGIIRRWDLNSQKIYSTLNG------------HMKSVRTLDFNPS-GEYVVSGSNDTTVRLWDV------------QNENNCI--KVCRGHMSHVNSVKFSPDGLWIASAGLEGSILIWDIRKSKQIMEF---IADPPVTAITCVQFHPFEFLLAAGRVDGTVSIYDL 218          
BLAST of WD repeat domain 70 vs. Ensembl Fly
Match: kat80 (gene:FBgn0040207 transcript:FBtr0340443)

HSP 1 Score: 53.9138 bits (128), Expect = 3.462e-7
Identity = 58/233 (24.89%), Postives = 101/233 (43.35%), Query Frame = 1
Query:  193 ITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCEQEIKKIEFSANGEHILVISNDIQAFI-LDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDI 888
            +TS  +  TG  L+T  +D  +NLW   G N     F ++T   + I  + F A  ++ +  ++DI      D   +++  T+ G            H K +    +NP   E + + S D +VR+W++            +N  +CI  K  RG      +  ++  GL + +A  +GSI +WD RKS    +F    A P  T I+ + F   +  +     D  + I+D+
Sbjct:   21 VTSLDLGETGRVLVTGGEDRNVNLWAI-GQNEC---FMSLTGHNRSIDCVRF-AYKDNFVYSADDIGIIRRWDLNSQKIYSTLNG------------HMKSVRTLDFNPS-GEYVVSGSNDTTVRLWDV------------QNENNCI--KVCRGHMSHVNSVKFSPDGLWIASAGLEGSILIWDIRKSKQIMEF---IADPPVTAITCVQFHPFEFLLAAGRVDGTVSIYDL 218          
BLAST of WD repeat domain 70 vs. Ensembl Fly
Match: CG10931 (gene:FBgn0034274 transcript:FBtr0089545)

HSP 1 Score: 50.8322 bits (120), Expect = 1.698e-6
Identity = 44/189 (23.28%), Postives = 79/189 (41.80%), Query Frame = 1
Query:  331 IKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDIRTG 897
            +  ++FS+NGE+++  S D    + D    R ++++ G            H   +N   W+   A  +A+CS D +VR+W          D R K     +  K + G      +C +     ++ +   D +++LWD R   T    H          I+S+ F  D    +T S D  ++++D  TG
Sbjct:   59 VTGLKFSSNGENLVSSSGDRLLKLWDLSATRCIQSLAG------------HGDGVNDVAWS--AAGLIASCSDDMTVRLW----------DARSK-----LCVKVLEGHSRYSFSCCFNPQANLLASTSFDETVRLWDVRTGKTLKIVH-----AHQDPITSVDFHRDGNIFVTSSYDGLVRLWDSSTG 213          
BLAST of WD repeat domain 70 vs. Ensembl Zebrafish
Match: WDR70 (WD repeat domain 70 [Source:NCBI gene;Acc:101884837])

HSP 1 Score: 303.908 bits (777), Expect = 1.206e-95
Identity = 143/380 (37.63%), Postives = 235/380 (61.84%), Query Frame = 1
Query:  148 IPKSESVKLSHGQKMITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCE-QEIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDIRTGMKTPQHVWSDLYVTNERTNCIVSPSDKMVITGTSLRKNETESHAIFYNRSTFEEIDRIPLKNASTVTVEWHPRLNQLLIGSSVGTLDLFYDRTFSHNGALSFMSKAPKPKKSNREFYTNDMLLTYDEET 1284
            IP +  + L HG K +++ +++ +G RL+T   D  +  WDF GM++   +F+++ PCE  +IK +++S  G+ ILV++ + QA +LDR+G +VLE IKG+ Y+ D  +TKGH  MLN GCW+P++ E+  TCS DG+VR W++   +K         HKS   P+S +GK++ P  C Y+  G ++ A C DG+IQ+WD R       FHC  A+   ++ SSL F+YD +++ +R  DD +K +DIR+  ++P +V + L      T+C  SP DK+++TGTS+RK+E +   +F+ R T +++  I + +AS V   WHP+LNQ+++G+  G   ++YD   S  GA+  + K+ K K+ + E  T D ++T +  T
Sbjct:  100 IPDTHEITLQHGTKTVSALALDPSGARLVTGGYDYDVRFWDFAGMDANLHAFRSLQPCECHQIKALQYSITGDVILVVAGNSQAKVLDRDGFQVLECIKGDQYIVDMANTKGHTAMLNDGCWHPKIKEEFLTCSNDGTVRTWDLTSEKK---------HKSVFKPRSQQGKRVTPTCCTYSRDGKLIAAGCQDGTIQIWD-RNLSVHTKFHCRQAHAPGSDTSSLCFSYDGVTLASRGGDDTLKTWDIRS-FRSPLNVATGLTSFFPMTDCCFSPDDKLLVTGTSVRKDEGQGKLLFFQRETLQKLYEIEVADASVVRCLWHPKLNQIMVGTGNGLAKVYYDPVKSQRGAILCVVKS-KRKEKHAETLTQDYIITREYST 467          
BLAST of WD repeat domain 70 vs. Ensembl Zebrafish
Match: WDR70 (WD repeat domain 70 [Source:NCBI gene;Acc:101884837])

HSP 1 Score: 304.294 bits (778), Expect = 1.840e-95
Identity = 143/380 (37.63%), Postives = 235/380 (61.84%), Query Frame = 1
Query:  148 IPKSESVKLSHGQKMITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCE-QEIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDIRTGMKTPQHVWSDLYVTNERTNCIVSPSDKMVITGTSLRKNETESHAIFYNRSTFEEIDRIPLKNASTVTVEWHPRLNQLLIGSSVGTLDLFYDRTFSHNGALSFMSKAPKPKKSNREFYTNDMLLTYDEET 1284
            IP +  + L HG K +++ +++ +G RL+T   D  +  WDF GM++   +F+++ PCE  +IK +++S  G+ ILV++ + QA +LDR+G +VLE IKG+ Y+ D  +TKGH  MLN GCW+P++ E+  TCS DG+VR W++   +K         HKS   P+S +GK++ P  C Y+  G ++ A C DG+IQ+WD R       FHC  A+   ++ SSL F+YD +++ +R  DD +K +DIR+  ++P +V + L      T+C  SP DK+++TGTS+RK+E +   +F+ R T +++  I + +AS V   WHP+LNQ+++G+  G   ++YD   S  GA+  + K+ K K+ + E  T D ++T +  T
Sbjct:  130 IPDTHEITLQHGTKTVSALALDPSGARLVTGGYDYDVRFWDFAGMDANLHAFRSLQPCECHQIKALQYSITGDVILVVAGNSQAKVLDRDGFQVLECIKGDQYIVDMANTKGHTAMLNDGCWHPKIKEEFLTCSNDGTVRTWDLTSEKK---------HKSVFKPRSQQGKRVTPTCCTYSRDGKLIAAGCQDGTIQIWD-RNLSVHTKFHCRQAHAPGSDTSSLCFSYDGVTLASRGGDDTLKTWDIRS-FRSPLNVATGLTSFFPMTDCCFSPDDKLLVTGTSVRKDEGQGKLLFFQRETLQKLYEIEVADASVVRCLWHPKLNQIMVGTGNGLAKVYYDPVKSQRGAILCVVKS-KRKEKHAETLTQDYIITREYST 497          
BLAST of WD repeat domain 70 vs. Ensembl Zebrafish
Match: WDR70 (WD repeat domain 70 [Source:NCBI gene;Acc:101884837])

HSP 1 Score: 195.667 bits (496), Expect = 4.706e-57
Identity = 87/227 (38.33%), Postives = 143/227 (63.00%), Query Frame = 1
Query:  193 ITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCE-QEIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDA 870
            +++ +++ +G RL+T   D  +  WDF GM++   +F+++ PCE  +IK +++S  G+ ILV++ + QA +LDR+G +VLE IKG+ Y+ D  +TKGH  MLN GCW+P++ E+  TCS DG+VR W++   +K         HKS   P+S +GK++ P  C Y+  G ++ A C DG+IQ+WD R       FHC  A+   ++ SSL F+YD +++ +R   ++
Sbjct:  127 VSALALDPSGARLVTGGYDYDVRFWDFAGMDANLHAFRSLQPCECHQIKALQYSITGDVILVVAGNSQAKVLDRDGFQVLECIKGDQYIVDMANTKGHTAMLNDGCWHPKIKEEFLTCSNDGTVRTWDLTSEKK---------HKSVFKPRSQQGKRVTPTCCTYSRDGKLIAAGCQDGTIQIWD-RNLSVHTKFHCRQAHAPGSDTSSLCFSYDGVTLASRGGQNS 343          
BLAST of WD repeat domain 70 vs. Ensembl Zebrafish
Match: WDR70 (WD repeat domain 70 [Source:NCBI gene;Acc:101884837])

HSP 1 Score: 174.481 bits (441), Expect = 3.407e-49
Identity = 75/185 (40.54%), Postives = 121/185 (65.41%), Query Frame = 1
Query:  193 ITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCE-QEIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWD 744
            +++ +++ +G RL+T   D  +  WDF GM++   +F+++ PCE  +IK +++S  G+ ILV++ + QA +LDR+G +VLE IKG+ Y+ D  +TKGH  MLN GCW+P++ E+  TCS DG+VR W++   +K         HKS   P+S +GK++ P  C Y+  G ++ A C DG+IQ+WD
Sbjct:  130 VSALALDPSGARLVTGGYDYDVRFWDFAGMDANLHAFRSLQPCECHQIKALQYSITGDVILVVAGNSQAKVLDRDGFQVLECIKGDQYIVDMANTKGHTAMLNDGCWHPKIKEEFLTCSNDGTVRTWDLTSEKK---------HKSVFKPRSQQGKRVTPTCCTYSRDGKLIAAGCQDGTIQIWD 305          
BLAST of WD repeat domain 70 vs. Ensembl Xenopus
Match: wdr70 (WD repeat domain 70 [Source:NCBI gene;Acc:780253])

HSP 1 Score: 324.709 bits (831), Expect = 4.259e-103
Identity = 181/503 (35.98%), Postives = 278/503 (55.27%), Query Frame = 1
Query:  139 VYFIPKSESVKLSHGQKMITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCE-QEIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDIRTGMKTPQHVWSDLYVTNERTNCIVSPSDKMVITGTSLRKNETESHAIFYNRSTFEEIDRIPLKNASTVTVEWHPRLNQLLIGSSVGTLDLFYDRTFSHNGALSFMSKAPKPKKSNREFYTNDMLLT------YDEETERLARIGQRASKFREGPELNPYLKAKKEMKKRVPQQPTEANNKYPTLHQHLVQQIVIPKRTPEAEYYENNPREAILRHA-NAPK--YWTAGAYDKTQPKPIF---DTEEDEPDH 1608
            V  IP S  + L HG K +++  ++ +G RL+T   D  +  WDF GM+++  +F+++ PCE  +IK +++S  G+ ILV++ + QA +LDR+G  V+E +KG+ Y+ D  +TKGH  MLN GCW+P++ E+  TCS DG+VR W++ + +K         HK    P+S++GK++IP  C Y+  G  + A C DGSIQ+WD R       FHC  A+   T+ S + F+Y    + TR  DD +K +DIR   K P +V S L      T+C  SP DK++ITGTS+++   +   +F++  TF+++  I +  AS V   WHP+LNQ+++G+  G   ++YD   S  GA   + K  + K    E  T D ++T      + E  +R  R      K  E   L+P    K E     P +         TL   +V+ I + K        ++NPREAILRHA +A K  YW A AY KTQP  +F   +++E+E D+
Sbjct:  125 VKGIPDSHEITLQHGTKTVSALGLDPSGARLVTGGFDYDVRFWDFAGMDASLQAFRSLQPCECHQIKSLQYSNTGDVILVVAGNSQAKVLDRDGFPVMECVKGDQYIVDMANTKGHTAMLNGGCWHPKIKEEFMTCSNDGTVRTWDVSNEKK---------HKGVFKPRSMQGKRVIPTCCTYSRDGKFIAAGCQDGSIQIWD-RNMSVHTKFHCRQAHTPGTDTSCVTFSYAGNILATRGGDDTLKTWDIRK-FKNPLNVASGLANYFPMTDCCFSPDDKLLITGTSVKRGGGDGKLMFFDVGTFQKVYEIQVTEASVVRCLWHPKLNQIMVGTGNGLAKVYYDPNRSQRGAKLCVVKTQR-KARQAETLTQDYIITPHALPMFREPRQRSTR------KQLEKDRLDPVKSHKPEPPVAGPGRGGRVGTHGGTLSSFIVKNIALDKTD------DSNPREAILRHAKDAEKNPYWVAPAYSKTQPNTVFAEVESDEEETDN 603          
BLAST of WD repeat domain 70 vs. Ensembl Xenopus
Match: wdr70 (WD repeat domain 70 [Source:NCBI gene;Acc:780253])

HSP 1 Score: 325.094 bits (832), Expect = 4.852e-103
Identity = 181/503 (35.98%), Postives = 278/503 (55.27%), Query Frame = 1
Query:  139 VYFIPKSESVKLSHGQKMITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCE-QEIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDIRTGMKTPQHVWSDLYVTNERTNCIVSPSDKMVITGTSLRKNETESHAIFYNRSTFEEIDRIPLKNASTVTVEWHPRLNQLLIGSSVGTLDLFYDRTFSHNGALSFMSKAPKPKKSNREFYTNDMLLT------YDEETERLARIGQRASKFREGPELNPYLKAKKEMKKRVPQQPTEANNKYPTLHQHLVQQIVIPKRTPEAEYYENNPREAILRHA-NAPK--YWTAGAYDKTQPKPIF---DTEEDEPDH 1608
            V  IP S  + L HG K +++  ++ +G RL+T   D  +  WDF GM+++  +F+++ PCE  +IK +++S  G+ ILV++ + QA +LDR+G  V+E +KG+ Y+ D  +TKGH  MLN GCW+P++ E+  TCS DG+VR W++ + +K         HK    P+S++GK++IP  C Y+  G  + A C DGSIQ+WD R       FHC  A+   T+ S + F+Y    + TR  DD +K +DIR   K P +V S L      T+C  SP DK++ITGTS+++   +   +F++  TF+++  I +  AS V   WHP+LNQ+++G+  G   ++YD   S  GA   + K  + K    E  T D ++T      + E  +R  R      K  E   L+P    K E     P +         TL   +V+ I + K        ++NPREAILRHA +A K  YW A AY KTQP  +F   +++E+E D+
Sbjct:  140 VKGIPDSHEITLQHGTKTVSALGLDPSGARLVTGGFDYDVRFWDFAGMDASLQAFRSLQPCECHQIKSLQYSNTGDVILVVAGNSQAKVLDRDGFPVMECVKGDQYIVDMANTKGHTAMLNGGCWHPKIKEEFMTCSNDGTVRTWDVSNEKK---------HKGVFKPRSMQGKRVIPTCCTYSRDGKFIAAGCQDGSIQIWD-RNMSVHTKFHCRQAHTPGTDTSCVTFSYAGNILATRGGDDTLKTWDIRK-FKNPLNVASGLANYFPMTDCCFSPDDKLLITGTSVKRGGGDGKLMFFDVGTFQKVYEIQVTEASVVRCLWHPKLNQIMVGTGNGLAKVYYDPNRSQRGAKLCVVKTQR-KARQAETLTQDYIITPHALPMFREPRQRSTR------KQLEKDRLDPVKSHKPEPPVAGPGRGGRVGTHGGTLSSFIVKNIALDKTD------DSNPREAILRHAKDAEKNPYWVAPAYSKTQPNTVFAEVESDEEETDN 618          
BLAST of WD repeat domain 70 vs. Ensembl Xenopus
Match: wdr70 (WD repeat domain 70 [Source:NCBI gene;Acc:780253])

HSP 1 Score: 310.457 bits (794), Expect = 8.409e-98
Identity = 173/485 (35.67%), Postives = 269/485 (55.46%), Query Frame = 1
Query:  193 ITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCE-QEIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDIRTGMKTPQHVWSDLYVTNERTNCIVSPSDKMVITGTSLRKNETESHAIFYNRSTFEEIDRIPLKNASTVTVEWHPRLNQLLIGSSVGTLDLFYDRTFSHNGALSFMSKAPKPKKSNREFYTNDMLLT------YDEETERLARIGQRASKFREGPELNPYLKAKKEMKKRVPQQPTEANNKYPTLHQHLVQQIVIPKRTPEAEYYENNPREAILRHA-NAPK--YWTAGAYDKTQPKPIF---DTEEDEPDH 1608
            +++  ++ +G RL+T   D  +  WDF GM+++  +F+++ PCE  +IK +++S  G+ ILV++ + QA +LDR+G  V+E +KG+ Y+ D  +TKGH  MLN GCW+P++ E+  TCS DG+VR W++ + +K         HK    P+S++GK++IP  C Y+  G  + A C DGSIQ+WD R       FHC  A+   T+ S + F+Y    + TR  DD +K +DIR   K P +V S L      T+C  SP DK++ITGTS+++   +   +F++  TF+++  I +  AS V   WHP+LNQ+++G+  G   ++YD   S  GA   + K  + K    E  T D ++T      + E  +R  R      K  E   L+P    K E     P +         TL   +V+ I + K        ++NPREAILRHA +A K  YW A AY KTQP  +F   +++E+E D+
Sbjct:  133 VSALGLDPSGARLVTGGFDYDVRFWDFAGMDASLQAFRSLQPCECHQIKSLQYSNTGDVILVVAGNSQAKVLDRDGFPVMECVKGDQYIVDMANTKGHTAMLNGGCWHPKIKEEFMTCSNDGTVRTWDVSNEKK---------HKGVFKPRSMQGKRVIPTCCTYSRDGKFIAAGCQDGSIQIWD-RNMSVHTKFHCRQAHTPGTDTSCVTFSYAGNILATRGGDDTLKTWDIRK-FKNPLNVASGLANYFPMTDCCFSPDDKLLITGTSVKRGGGDGKLMFFDVGTFQKVYEIQVTEASVVRCLWHPKLNQIMVGTGNGLAKVYYDPNRSQRGAKLCVVKTQR-KARQAETLTQDYIITPHALPMFREPRQRSTR------KQLEKDRLDPVKSHKPEPPVAGPGRGGRVGTHGGTLSSFIVKNIALDKTD------DSNPREAILRHAKDAEKNPYWVAPAYSKTQPNTVFAEVESDEEETDN 593          
BLAST of WD repeat domain 70 vs. Ensembl Xenopus
Match: wdr70 (WD repeat domain 70 [Source:NCBI gene;Acc:780253])

HSP 1 Score: 309.301 bits (791), Expect = 1.878e-97
Identity = 171/479 (35.70%), Postives = 262/479 (54.70%), Query Frame = 1
Query:  139 VYFIPKSESVKLSHGQKMITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCE-QEIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDIRTGMKTPQHVWSDLYVTNERTNCIVSPSDKMVITGTSLRKNETESHAIFYNRSTFEEIDRIPLKNASTVTVEWHPRLNQLLIGSSVGTLDLFYDRTFSHNGALSFMSKAPKPKKSNREFYTNDMLLT------YDEETERLARIGQRASKFREGPELNPYLKAKKEMKKRVPQQPTEANNKYPTLHQHLVQQIVIPKRTPEAEYYENNPREAILRHA-NAPK--YWTA 1545
            V  IP S  + L HG K +++  ++ +G RL+T   D  +  WDF GM+++  +F+++ PCE  +IK +++S  G+ ILV++ + QA +LDR+G  V+E +KG+ Y+ D  +TKGH  MLN GCW+P++ E+  TCS DG+VR W++ + +K         HK    P+S++GK++IP  C Y+  G  + A C DGSIQ+WD R       FHC  A+   T+ S + F+Y    + TR  DD +K +DIR   K P +V S L      T+C  SP DK++ITGTS+++   +   +F++  TF+++  I +  AS V   WHP+LNQ+++G+  G   ++YD   S  GA   + K  + K    E  T D ++T      + E  +R  R      K  E   L+P    K E     P +         TL   +V+ I + K        ++NPREAILRHA +A K  YW A
Sbjct:  110 VKGIPDSHEITLQHGTKTVSALGLDPSGARLVTGGFDYDVRFWDFAGMDASLQAFRSLQPCECHQIKSLQYSNTGDVILVVAGNSQAKVLDRDGFPVMECVKGDQYIVDMANTKGHTAMLNGGCWHPKIKEEFMTCSNDGTVRTWDVSNEKK---------HKGVFKPRSMQGKRVIPTCCTYSRDGKFIAAGCQDGSIQIWD-RNMSVHTKFHCRQAHTPGTDTSCVTFSYAGNILATRGGDDTLKTWDIRK-FKNPLNVASGLANYFPMTDCCFSPDDKLLITGTSVKRGGGDGKLMFFDVGTFQKVYEIQVTEASVVRCLWHPKLNQIMVGTGNGLAKVYYDPNRSQRGAKLCVVKTQR-KARQAETLTQDYIITPHALPMFREPRQRSTR------KQLEKDRLDPVKSHKPEPPVAGPGRGGRVGTHGGTLSSFIVKNIALDKTD------DSNPREAILRHAKDAEKNPYWVA 564          
BLAST of WD repeat domain 70 vs. Ensembl Xenopus
Match: wdr70 (WD repeat domain 70 [Source:NCBI gene;Acc:780253])

HSP 1 Score: 286.574 bits (732), Expect = 3.063e-89
Identity = 140/375 (37.33%), Postives = 221/375 (58.93%), Query Frame = 1
Query:  148 IPKSESVKLSHGQKMITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCE-QEIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDIRTGMKTPQHVWSDLYVTNERTNCIVSPSDKMVITGTSLRKNETESHAIFYNRSTFEEIDRIPLKNASTVTVEWHPRLNQLLIGSSVGTLDLFYDRTFSHNGALSFMSKAPKPKKSNREFYTNDMLLT 1269
            IP S  + L HG K +++  ++ +G RL+T   D  +  WDF GM+++  +F+++ PCE  +IK +++S  G+ ILV++ + QA +LDR+G  V+E +KG+ Y+ D  +TKGH  MLN GCW+P++ E+  TCS DG+VR W++ + +K         HK    P+S++GK++IP  C Y+  G  + A C DGSIQ+WD R       FHC  A+   T+ S + F+Y    + TR  DD +K +DIR   K P +V S L      T+C  SP DK++ITGTS+++   +   +F++  TF+++  I +  AS V   WHP+LNQ+++G+  G   ++YD   S  GA   + K  + K    E  T D ++T
Sbjct:  112 IPDSHEITLQHGTKTVSALGLDPSGARLVTGGFDYDVRFWDFAGMDASLQAFRSLQPCECHQIKSLQYSNTGDVILVVAGNSQAKVLDRDGFPVMECVKGDQYIVDMANTKGHTAMLNGGCWHPKIKEEFMTCSNDGTVRTWDVSNEKK---------HKGVFKPRSMQGKRVIPTCCTYSRDGKFIAAGCQDGSIQIWD-RNMSVHTKFHCRQAHTPGTDTSCVTFSYAGNILATRGGDDTLKTWDIRK-FKNPLNVASGLANYFPMTDCCFSPDDKLLITGTSVKRGGGDGKLMFFDVGTFQKVYEIQVTEASVVRCLWHPKLNQIMVGTGNGLAKVYYDPNRSQRGAKLCVVKTQR-KARQAETLTQDYIIT 474          
BLAST of WD repeat domain 70 vs. Ensembl Mouse
Match: Wdr70 (WD repeat domain 70 [Source:MGI Symbol;Acc:MGI:1921020])

HSP 1 Score: 316.62 bits (810), Expect = 1.320e-99
Identity = 175/497 (35.21%), Postives = 268/497 (53.92%), Query Frame = 1
Query:  139 VYFIPKSESVKLSHGQKMITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCE-QEIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDIRTGMKTPQHVWSDLYVTNERTNCIVSPSDKMVITGTSLRKNETESHAIFYNRSTFEEIDRIPLKNASTVTVEWHPRLNQLLIGSSVGTLDLFYDRTFSHNGALSFMSKAPKPKKSNREFYTNDMLLT------YDEETERLARIGQRASKFREGPELNPYLKAKKEMKKRVPQQPTEANNKYPTLHQHLVQQIVIPKRTPEAEYYENNPREAILRHANAPK---YWTAGAYDKTQPKPIFDTEEDE 1599
            V  IP S  + L HG K +++  ++ +G RL+T   D  +  WDF GM+++  +F+++ PCE  +IK +++S  G+ ILV+S   QA ++DR+G  V+E IKG+ Y+ D  +TKGH  ML+ G W+P++  +  TCS D +VR+W +            K  KS   P++++GKK+IP TC Y+  G +V AAC +GSIQ+WD R     P FH   A+   T+ S + F+YD   + +R  DD +K++D+R     P    SDL      T+C  SP DK+++TGTS+++       +F  R TF+ +  I + +AS V   WHP+LNQ+++G+  G   ++YD   S  GA   + K  + K    E  T D ++T      + E  +R  R      K  E   L+P    K E     P +         TL  ++V+ I + K        ++NPREAILRHA A +   YW + AY KTQPK +F   E +
Sbjct:  170 VQRIPDSHEITLRHGTKTVSALGLDPSGARLVTGGYDYDVKFWDFAGMDASFKAFRSLQPCECHQIKSLQYSNTGDMILVVSGSSQAKVIDRDGFEVMECIKGDQYIVDMANTKGHTAMLHTGSWHPKIKGEFMTCSNDATVRLWEV---------ENPKKQKSVFKPRTMQGKKVIPTTCTYSRDGNLVAAACQNGSIQIWD-RNLTVHPKFHYKQAHDPGTDTSCVAFSYDGNVLASRGGDDTLKLWDVRQ-FNKPLFSASDLPTLFPMTDCCFSPDDKLIVTGTSVQRGCGSGKLVFLERRTFQRVYEIHITDASVVRCLWHPKLNQIMVGTGNGLAKVYYDPNKSQRGAKLCVVKTQR-KAKQAETLTQDYIITPHALPMFREPRQRSTR------KQLEKDRLDPLKSHKPEPPVAGPGRGGRVGTHGGTLSSYIVKNIALDKTD------DSNPREAILRHAKAAEDNPYWVSPAYSKTQPKTMFAQVESD 642          
BLAST of WD repeat domain 70 vs. Ensembl Mouse
Match: Poc1a (POC1 centriolar protein A [Source:MGI Symbol;Acc:MGI:1917485])

HSP 1 Score: 49.6766 bits (117), Expect = 7.457e-6
Identity = 50/249 (20.08%), Postives = 105/249 (42.17%), Query Frame = 1
Query:  151 PKSESVKLSHGQKMITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCEQEIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDIRTG 897
            P+S + + +  +  +T  +   +G+ L + ++D T+ +W  N +   ++ F+  T     ++ + F ++G+ ++  S+D    +     +R         +LF   S   H   +    ++P     + + S D +V++W+             K  + CI      G  +  V   +  SG  + AA  D ++++WD R       +   SA      +++L F      +IT S+D  +KI D+  G
Sbjct:   50 PQSRAYRFTGHKDAVTCVNFSPSGHLLASGSRDKTVRIWVPN-VKGESTVFRAHT---ATVRSVHFCSDGQSLVTASDDKTVKVWSTHRQR---------FLF---SLTQHINWVRCAKFSPD-GRLIVSASDDKTVKLWD-------------KTSRECIHSYCEHGGFVTYVD--FHPSGTCIAAAGMDNTVKVWDARTHRLLQHYQLHSA-----AVNALSFHPSGNYLITASSDSTLKILDLMEG 261          
BLAST of WD repeat domain 70 vs. Ensembl Mouse
Match: Poc1a (POC1 centriolar protein A [Source:MGI Symbol;Acc:MGI:1917485])

HSP 1 Score: 49.2914 bits (116), Expect = 7.709e-6
Identity = 50/249 (20.08%), Postives = 105/249 (42.17%), Query Frame = 1
Query:  151 PKSESVKLSHGQKMITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCEQEIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDIRTG 897
            P+S + + +  +  +T  +   +G+ L + ++D T+ +W  N +   ++ F+  T     ++ + F ++G+ ++  S+D    +     +R         +LF   S   H   +    ++P     + + S D +V++W+             K  + CI      G  +  V   +  SG  + AA  D ++++WD R       +   SA      +++L F      +IT S+D  +KI D+  G
Sbjct:   12 PQSRAYRFTGHKDAVTCVNFSPSGHLLASGSRDKTVRIWVPN-VKGESTVFRAHT---ATVRSVHFCSDGQSLVTASDDKTVKVWSTHRQR---------FLF---SLTQHINWVRCAKFSPD-GRLIVSASDDKTVKLWD-------------KTSRECIHSYCEHGGFVTYVD--FHPSGTCIAAAGMDNTVKVWDARTHRLLQHYQLHSA-----AVNALSFHPSGNYLITASSDSTLKILDLMEG 223          
BLAST of WD repeat domain 70 vs. Ensembl Mouse
Match: Poc1a (POC1 centriolar protein A [Source:MGI Symbol;Acc:MGI:1917485])

HSP 1 Score: 49.2914 bits (116), Expect = 7.709e-6
Identity = 50/249 (20.08%), Postives = 105/249 (42.17%), Query Frame = 1
Query:  151 PKSESVKLSHGQKMITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCEQEIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDIRTG 897
            P+S + + +  +  +T  +   +G+ L + ++D T+ +W  N +   ++ F+  T     ++ + F ++G+ ++  S+D    +     +R         +LF   S   H   +    ++P     + + S D +V++W+             K  + CI      G  +  V   +  SG  + AA  D ++++WD R       +   SA      +++L F      +IT S+D  +KI D+  G
Sbjct:   12 PQSRAYRFTGHKDAVTCVNFSPSGHLLASGSRDKTVRIWVPN-VKGESTVFRAHT---ATVRSVHFCSDGQSLVTASDDKTVKVWSTHRQR---------FLF---SLTQHINWVRCAKFSPD-GRLIVSASDDKTVKLWD-------------KTSRECIHSYCEHGGFVTYVD--FHPSGTCIAAAGMDNTVKVWDARTHRLLQHYQLHSA-----AVNALSFHPSGNYLITASSDSTLKILDLMEG 223          
BLAST of WD repeat domain 70 vs. UniProt/SwissProt
Match: sp|Q0VA16|WDR70_XENTR (WD repeat-containing protein 70 OS=Xenopus tropicalis OX=8364 GN=wdr70 PE=2 SV=1)

HSP 1 Score: 324.709 bits (831), Expect = 3.170e-102
Identity = 181/503 (35.98%), Postives = 278/503 (55.27%), Query Frame = 1
Query:  139 VYFIPKSESVKLSHGQKMITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCE-QEIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDIRTGMKTPQHVWSDLYVTNERTNCIVSPSDKMVITGTSLRKNETESHAIFYNRSTFEEIDRIPLKNASTVTVEWHPRLNQLLIGSSVGTLDLFYDRTFSHNGALSFMSKAPKPKKSNREFYTNDMLLT------YDEETERLARIGQRASKFREGPELNPYLKAKKEMKKRVPQQPTEANNKYPTLHQHLVQQIVIPKRTPEAEYYENNPREAILRHA-NAPK--YWTAGAYDKTQPKPIF---DTEEDEPDH 1608
            V  IP S  + L HG K +++  ++ +G RL+T   D  +  WDF GM+++  +F+++ PCE  +IK +++S  G+ ILV++ + QA +LDR+G  V+E +KG+ Y+ D  +TKGH  MLN GCW+P++ E+  TCS DG+VR W++ + +K         HK    P+S++GK++IP  C Y+  G  + A C DGSIQ+WD R       FHC  A+   T+ S + F+Y    + TR  DD +K +DIR   K P +V S L      T+C  SP DK++ITGTS+++   +   +F++  TF+++  I +  AS V   WHP+LNQ+++G+  G   ++YD   S  GA   + K  + K    E  T D ++T      + E  +R  R      K  E   L+P    K E     P +         TL   +V+ I + K        ++NPREAILRHA +A K  YW A AY KTQP  +F   +++E+E D+
Sbjct:  135 VKGIPDSHEITLQHGTKTVSALGLDPSGARLVTGGFDYDVRFWDFAGMDASLQAFRSLQPCECHQIKSLQYSNTGDVILVVAGNSQAKVLDRDGFPVMECVKGDQYIVDMANTKGHTAMLNGGCWHPKIKEEFMTCSNDGTVRTWDVSNEKK---------HKGVFKPRSMQGKRVIPTCCTYSRDGKFIAAGCQDGSIQIWD-RNMSVHTKFHCRQAHTPGTDTSCVTFSYAGNILATRGGDDTLKTWDIRK-FKNPLNVASGLANYFPMTDCCFSPDDKLLITGTSVKRGGGDGKLMFFDVGTFQKVYEIQVTEASVVRCLWHPKLNQIMVGTGNGLAKVYYDPNRSQRGAKLCVVKTQR-KARQAETLTQDYIITPHALPMFREPRQRSTR------KQLEKDRLDPVKSHKPEPPVAGPGRGGRVGTHGGTLSSFIVKNIALDKTD------DSNPREAILRHAKDAEKNPYWVAPAYSKTQPNTVFAEVESDEEETDN 613          
BLAST of WD repeat domain 70 vs. UniProt/SwissProt
Match: sp|Q6GPP0|WDR70_XENLA (WD repeat-containing protein 70 OS=Xenopus laevis OX=8355 GN=wdr70 PE=2 SV=2)

HSP 1 Score: 319.316 bits (817), Expect = 3.032e-100
Identity = 176/488 (36.07%), Postives = 266/488 (54.51%), Query Frame = 1
Query:  148 IPKSESVKLSHGQKMITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCE-QEIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDIRTGMKTPQHVWSDLYVTNERTNCIVSPSDKMVITGTSLRKNETESHAIFYNRSTFEEIDRIPLKNASTVTVEWHPRLNQLLIGSSVGTLDLFYDRTFSHNGALSFMSKAPKPKKSNREFYTNDMLLT------YDEETERLARIGQRASKFREGPELNPYLKAKKEMKKRVPQQPTEANNKYPTLHQHLVQQIVIPKRTPEAEYYENNPREAILRHANAPK---YWTAGAYDKTQPKPIF 1581
            IP S  + L HG K +++  ++ +G RL+T   D  +  WDF GM+++  +F+++ PCE  +IK +++S  G+ ILV++ + QA +LDR+G  V+E +KG+ Y+ D  +TKGH  MLN GCW+P++ E+  TCS DG+VR W++ + +K         HK    P+SV+GK +IP  C Y+  G  + A C DGSIQ+WD R       FHC  A+   T+ S + F+Y    + TR  DD +K +DIR   K P +V S L      T+C  SP DK++ITGTS+++   +   +F++  TF++I  I +  AS V   WHP+LNQ+++G+  G   ++YD   S  GA   + K  + K+   E  T D ++T      + E  +R  R      K  E   L+P    K E     P +         TL   +V+ I + K        ++N REAILRHA   +   YW A AY KTQP  +F
Sbjct:  138 IPDSHEITLQHGTKTVSALGLDPSGARLVTGGYDYDVRFWDFAGMDASLQAFRSLQPCECHQIKSLQYSNTGDVILVVAGNSQAKVLDRDGFPVMECVKGDQYIVDMANTKGHTAMLNGGCWHPKIKEEFMTCSNDGTVRTWDVSNEKK---------HKGIFKPRSVQGKPVIPTCCTYSRDGKFIAAGCQDGSIQIWD-RNMSVHTKFHCRQAHTPGTDTSCVTFSYGGNVLATRGGDDTLKTWDIRK-FKNPLNVASGLENFFPMTDCCFSPDDKLLITGTSVKRGIGDGKLLFFDVVTFQKIYEIQVTEASVVRCLWHPKLNQIMVGTGNGLAKVYYDPNRSQRGAKLCVVKTQR-KERQAETLTQDYIITPHALPMFREPRQRSTR------KQLEKDRLDPVKSHKPEPPVAGPGRGGRVGTHGGTLSSFIVKNIALDKTD------DSNAREAILRHAKDAEQNPYWVAPAYSKTQPNTVF 601          
BLAST of WD repeat domain 70 vs. UniProt/SwissProt
Match: sp|Q5EB92|WDR70_RAT (WD repeat-containing protein 70 OS=Rattus norvegicus OX=10116 GN=Wdr70 PE=1 SV=1)

HSP 1 Score: 318.931 bits (816), Expect = 1.027e-99
Identity = 174/497 (35.01%), Postives = 270/497 (54.33%), Query Frame = 1
Query:  139 VYFIPKSESVKLSHGQKMITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCE-QEIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDIRTGMKTPQHVWSDLYVTNERTNCIVSPSDKMVITGTSLRKNETESHAIFYNRSTFEEIDRIPLKNASTVTVEWHPRLNQLLIGSSVGTLDLFYDRTFSHNGALSFMSKAPKPKKSNREFYTNDMLLT------YDEETERLARIGQRASKFREGPELNPYLKAKKEMKKRVPQQPTEANNKYPTLHQHLVQQIVIPKRTPEAEYYENNPREAILRHANAPK---YWTAGAYDKTQPKPIFDTEEDE 1599
            ++ IP S  + L HG K +++  ++ +G RL+T   D  +  WDF GM+++  +F+++ PCE  +IK +++S  G+ ILV+S   QA ++DR+G  V+E IKG+ Y+ D  +TKGH  ML+ G W+P++  +  TCS D +VR+W +            K  KS   P++++GKK+IP TC Y+  G +V AAC +GSIQ+WD R     P FH   A+   T+ S + F+YD   + +R  DD +K++D+R     P    SDL      T+C  SP DK+++TGTS+++       +F+ R TF+ +  I + +AS V   WHP+LNQ+++G+  G   ++YD   S  GA   + K  + K    E  T D ++T      + E  +R  R      K  E   L+P    K E     P +         TL  ++V+ I + K        ++NPREAILRHA A +   YW + AY KTQPK +F   E +
Sbjct:  168 IHRIPDSHEITLKHGTKTVSALGLDPSGARLVTGGYDYDVKFWDFAGMDASFKAFRSLQPCECHQIKSLQYSNTGDMILVVSGSSQAKVIDRDGFEVMECIKGDQYIVDMANTKGHTAMLHTGSWHPKIKGEFMTCSNDATVRLWEV---------ENPKKQKSVFKPRTMQGKKVIPTTCTYSRDGNLVAAACQNGSIQIWD-RNLTVHPKFHYKQAHAPGTDTSCVAFSYDGNVLASRGGDDTLKLWDVRQ-FNKPLFSASDLPTLFPMTDCCFSPDDKLIVTGTSVQRGCGSGKLVFFERRTFQRVYEIHITDASVVRCLWHPKLNQIMVGTGNGLAKVYYDPNKSQRGAKLCVVKTQR-KAKQAETLTQDYIITPHALPMFREPRQRSTR------KQLEKDRLDPLKSHKPEPPVAGPGRGGRVGTHGGTLSSYIVKNIALDKTD------DSNPREAILRHAKAAEDNPYWVSPAYSKTQPKTMFAQVESD 640          
BLAST of WD repeat domain 70 vs. UniProt/SwissProt
Match: sp|Q9NW82|WDR70_HUMAN (WD repeat-containing protein 70 OS=Homo sapiens OX=9606 GN=WDR70 PE=1 SV=1)

HSP 1 Score: 317.005 bits (811), Expect = 5.540e-99
Identity = 174/497 (35.01%), Postives = 269/497 (54.12%), Query Frame = 1
Query:  139 VYFIPKSESVKLSHGQKMITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCE-QEIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDIRTGMKTPQHVWSDLYVTNERTNCIVSPSDKMVITGTSLRKNETESHAIFYNRSTFEEIDRIPLKNASTVTVEWHPRLNQLLIGSSVGTLDLFYDRTFSHNGALSFMSKAPKPKKSNREFYTNDMLLT------YDEETERLARIGQRASKFREGPELNPYLKAKKEMKKRVPQQPTEANNKYPTLHQHLVQQIVIPKRTPEAEYYENNPREAILRHANAPK---YWTAGAYDKTQPKPIFDTEEDE 1599
            V+ IP S  + L HG K +++  ++ +G RL+T   D  +  WDF GM+++  +F+++ PCE  +IK +++S  G+ ILV+S   QA ++DR+G  V+E IKG+ Y+ D  +TKGH  ML+ G W+P++  +  TCS D +VR W +            K  KS   P++++GKK+IP TC Y+  G ++ AAC +GSIQ+WD R     P FH   A+   T+ S + F+YD   + +R  DD++K++DIR     P    S L      T+C  SP DK+++TGTS+++       +F+ R TF+ +  I + +AS V   WHP+LNQ+++G+  G   ++YD   S  GA   + K  + K    E  T D ++T      + E  +R  R      K  E   L+P    K E     P +         TL  ++V+ I + K        ++NPREAILRHA A +   YW + AY KTQPK +F   E +
Sbjct:  167 VHKIPDSHEITLKHGTKTVSALGLDPSGARLVTGGYDYDVKFWDFAGMDASFKAFRSLQPCECHQIKSLQYSNTGDMILVVSGSSQAKVIDRDGFEVMECIKGDQYIVDMANTKGHTAMLHTGSWHPKIKGEFMTCSNDATVRTWEV---------ENPKKQKSVFKPRTMQGKKVIPTTCTYSRDGNLIAAACQNGSIQIWD-RNLTVHPKFHYKQAHDSGTDTSCVTFSYDGNVLASRGGDDSLKLWDIRQ-FNKPLFSASGLPTMFPMTDCCFSPDDKLIVTGTSIQRGCGSGKLVFFERRTFQRVYEIDITDASVVRCLWHPKLNQIMVGTGNGLAKVYYDPNKSQRGAKLCVVKTQR-KAKQAETLTQDYIITPHALPMFREPRQRSTR------KQLEKDRLDPLKSHKPEPPVAGPGRGGRVGTHGGTLSSYIVKNIALDKTD------DSNPREAILRHAKAAEDSPYWVSPAYSKTQPKTMFAQVESD 639          
BLAST of WD repeat domain 70 vs. UniProt/SwissProt
Match: sp|Q32LB0|WDR70_BOVIN (WD repeat-containing protein 70 OS=Bos taurus OX=9913 GN=WDR70 PE=2 SV=1)

HSP 1 Score: 315.079 bits (806), Expect = 3.681e-98
Identity = 172/494 (34.82%), Postives = 266/494 (53.85%), Query Frame = 1
Query:  148 IPKSESVKLSHGQKMITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCE-QEIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDIRTGMKTPQHVWSDLYVTNERTNCIVSPSDKMVITGTSLRKNETESHAIFYNRSTFEEIDRIPLKNASTVTVEWHPRLNQLLIGSSVGTLDLFYDRTFSHNGALSFMSKAPKPKKSNREFYTNDMLLT------YDEETERLARIGQRASKFREGPELNPYLKAKKEMKKRVPQQPTEANNKYPTLHQHLVQQIVIPKRTPEAEYYENNPREAILRHANAPK---YWTAGAYDKTQPKPIFDTEEDE 1599
            IP S  + + HG K +++  ++ +G RL+T   D  +  WDF GM+++  +F+++ PCE  +IK +++S  G+ ILV+S   QA ++DR+G  V+E IKG+ Y+ D  +TKGH  ML+ G W+P++  +  TCS D +VR W +            K  KS   P++++GKK+IP TC Y+  G ++ AAC +GSIQ+WD R     P FH   A+   T+ S + F+YD   + +R  DD +K++DIR     P    S L      T+C  SP DK+++TGTS+++       +F+ R TF+ +  I + +AS V   WHP+LNQ+++G+  G   ++YD   S  GA   + K  + K    E  T D ++T      + E  +R  R      K  E   L+P    K E     P +         TL  ++V+ I + K        ++NPREAILRHA A +   YW + AY KTQPK +F   E +
Sbjct:  168 IPDSHEITIKHGTKTVSALGLDPSGARLVTGGYDYDVKFWDFAGMDASFKAFRSLQPCECHQIKSLQYSNTGDMILVVSGSSQAKVIDRDGFEVMECIKGDQYIVDMANTKGHTAMLHTGSWHPKIKGEFMTCSNDATVRTWEV---------ENPKKQKSVFKPRTMQGKKVIPTTCTYSRDGSLIAAACQNGSIQIWD-RNLTVHPKFHYKQAHDPGTDTSCVTFSYDGTVLASRGGDDTLKLWDIRQ-FNKPLFSASGLPTMFPMTDCCFSPDDKLIVTGTSVQRGCGSGKLVFFERRTFQRVYEIDITDASVVRCLWHPKLNQIMVGTGNGLAKVYYDPNKSQRGAKLCVVKTQR-KAKQAETLTQDYIITPHALPMFREPRQRSTR------KQLEKDRLDPLKSHKPEPPVAGPGRGGRVGTHGGTLSSYIVKNIALDKTD------DSNPREAILRHAKAAEDNPYWVSPAYSKTQPKTMFAQVESD 637          
BLAST of WD repeat domain 70 vs. TrEMBL
Match: A0A4Z2D2N2 (WD repeat-containing protein isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_005183 PE=4 SV=1)

HSP 1 Score: 362.073 bits (928), Expect = 2.012e-114
Identity = 201/514 (39.11%), Postives = 292/514 (56.81%), Query Frame = 1
Query:  142 YFIPKSESVKLSHGQKMITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCEQ-EIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDIRTGMKTPQHVWSDLYVTNERTNCIVSPSDKMVITGTSL-RKNETESHAIFYNRSTFEEIDRIPLKNASTVTVEWHPRLNQLLIGSSVGTLDLFYDRTFSHNGALSFMSKAPKPKKSNR-----EFYTNDMLLTYDEETERLARIGQRASKFREGPELNPYL----------------KAKK--EMKKRVPQQPTEANNKYPTLHQHLVQQIVIPKRTPEAEYYENNPREAILRHANAPK---YWTAGAYDKTQPKPIFDTEEDE 1599
            Y++P +E++ LSHG K +T+  I+  G R+ T   D  + LWDF GM+S    FK   PCE+ +IK ++FS +GEH+LVIS   QAFI+DR+GE V  T KG  Y+ DP S KGH   LN+G W+P  +  + TCS D ++R+W+I D E+I+++ RI  HK  I  ++ +G+K  P +CAY   G ++ A C DGSIQ+WDTRK        C +A+P NT+I+ + +++D   +++R  DD MK++D R   K   +V+ DL V   ++    SP+D  +    S+ R N  + H  FY R  FE I +    + S + + WH RLNQ+   SS GT +++YD   SHNGAL   ++        R     E Y   +LLTYDEE  R+AR   ++ K+    E++  L                +A K  E K+RVP +     N+  +LHQ +VQQIV+ K+    E  E + R AILRHA+  K   +WT  AY KTQP PIF   ++E
Sbjct:   76 YYLPITENLTLSHGVKPLTAIGIDPAGARVATGGFDFDVKLWDFGGMDSACRPFKVFRPCEEHQIKHLDFSPSGEHLLVISGSAQAFIVDRDGEPVCYTNKGYQYITDPASAKGHTHALNWGMWHPLDSNKLLTCSQDSTLRVWDINDAEEIMNEIRIPTHKIVIKTRNAQGRKTSPTSCAYTKDGQLIAAGCQDGSIQIWDTRKPLVNTTQLCRTAHPVNTDITCVNWSWDSKQLLSRGMDDTMKLWDTRALSKGAIYVFKDLPVLFNQSEVTFSPNDHAIAVSVSVPRDNPKKGHLNFYRRDNFEMIKQFSPCHGSVIGLTWHHRLNQVFCSSSDGTANVYYDSKVSHNGALMCANRQATTASRRRHTGTGEAYMKPILLTYDEEAVRIAR---KSKKYLNNTEVDSELAMAAVNAILQKDHQTIQAAKEDEAKQRVPNREESVGNRVGSLHQFMVQQIVL-KKNEADERAEKDIRGAILRHADEAKKQPFWTK-AYLKTQPNPIFYNPDEE 584          
BLAST of WD repeat domain 70 vs. TrEMBL
Match: G4LWB6 (WD_REPEATS_REGION domain-containing protein OS=Schistosoma mansoni OX=6183 GN=Smp_098920 PE=4 SV=1)

HSP 1 Score: 354.369 bits (908), Expect = 1.993e-111
Identity = 195/515 (37.86%), Postives = 294/515 (57.09%), Query Frame = 1
Query:  142 YFIPKSESVKLSHGQKMITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCEQ-EIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRS-NDDAMKIFDIRTGMKTPQHVWSDLYVTNERTNCIVSPSDKMVITGTSLRKNETESHAI-FYNRSTFEEIDRIPLKNASTVTVEWHPRLNQLLIGSSVGTLDLFYDRTFSHNGALSFMSKAPKPKKSNR-----EFYTNDMLLTYDEETERLARIGQRASKFREGPELNPYL----------------KAKK--EMKKRVPQQPTEANNKYPTLHQHLVQQIVIPKRTPEAEYYENNPREAILRHANAPK---YWTAGAYDKTQPKPIFDTEEDE 1599
            Y++P ++++ LSHG K +T+  ++  G R+ T   D  + LWDF GM++    FK   PCE+ +IK ++FS +GEH+LVIS   QAFI+DR+GE V  T KG  Y+ DP S KGH   L++G W+P  +  + TCS D ++R+W+I D E ++++ RI  HK  I  ++ +G+K  P +CAY+  G ++ A C DGSIQ+WDTRK        C +A+P NT+I+ + +++D   +I+R  NDD MK++D R   K   HV+ DL V   ++    SP+D ++    S+ +N+ +   I FY R  F+ I++    + S + + WH RLNQ+   SS G  +++YD   SHNGAL   ++        R     E Y   ++LTYDEE  R+AR   +  K+    E++  L                +A K  E K+RVP +     N+  +LHQ +VQQIV+ K+    E  E + R AILRHA+  K   +WT  AY KTQP PIF   ++E
Sbjct:   81 YYLPITQNLTLSHGCKPLTAIGVDPAGARVATGGFDFDVKLWDFGGMDNACRPFKAFRPCEEHQIKHLDFSPSGEHLLVISGSAQAFIVDRDGEAVCYTNKGYQYITDPASAKGHTHALHWGMWHPLDSNKLLTCSQDSTLRVWDINDAEAVMNETRIPTHKIVIKTRNAQGRKTSPTSCAYSKDGQLIAAGCQDGSIQIWDTRKPLVNTTQICRTAHPMNTDITCVSWSWDSKQLISRGMNDDTMKLWDTRGLSKGAIHVFKDLPVLFNQSEVTFSPNDHVLAVAVSVPRNDPKGGQINFYRRDNFQLINKFSPCHGSVIGLTWHHRLNQVFCSSSDGVANVYYDSKVSHNGALMCANRQATTSSRRRHTGTGEAYMKPIILTYDEEAVRIAR---KNKKYLNQTEIDSELAMAAVNAILQKDHQTIQAAKEDEAKQRVPNREESVGNRVGSLHQFMVQQIVL-KKNEADERAEKDIRGAILRHADEAKKQPFWTR-AYLKTQPNPIFHNPDEE 590          
BLAST of WD repeat domain 70 vs. TrEMBL
Match: A0A4S2LK67 (WD_REPEATS_REGION domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006642 PE=4 SV=1)

HSP 1 Score: 353.984 bits (907), Expect = 3.957e-111
Identity = 192/516 (37.21%), Postives = 289/516 (56.01%), Query Frame = 1
Query:  136 DVYFIPKSESVKLSHGQKMITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCE-QEIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDIRTGMKTPQHVWSDLYVTNERTNCIVSPSDKMVITGTSL-RKNETESHAIFYNRSTFEEIDRIPLKNASTVTVEWHPRLNQLLIGSSVGTLDLFYDRTFSHNGALSFMSKAPKPKKSNR-----EFYTNDMLLTYDEETERLARIGQRASKFREGPELNPYLK------------------AKKEMKKRVPQQPTEANNKYPTLHQHLVQQIVIPKRTPEAEYYENNPREAILRHANAPK---YWTAGAYDKTQPKPIFDTEEDE 1599
            D YF+P ++ + L HG K +T+  ++ +G R+ T   D  + LWDF GM+S+  +FK V PCE  +IK +EFS +GE++LVIS    A ++ R+GE V  T KG  Y+ DP S KGH   L++GCW+P  +    TCS D ++RIWNI D E ++++ RI  HKS I P++ +G+K+IP TC ++  G ++ A C DGS+Q+WDTRK F         A+P NT I+ +  ++D   +++R+ DD +K++D R   K P H+  DL V  ++++ + SP+D ++    S  R ++      FY R  F+ ++ I  ++ S + V WH R+NQL   SS GT ++ YD   SH+GAL   S+        R     E Y    LLTY+E++ R AR   +A K    P +   +                   A ++ + R P Q     N+  +LHQ++VQQIV+ K   E E  E + R AILRHA   K   +WT  AY KTQP P+F   ++E
Sbjct:   98 DPYFLPITDMLALCHGTKPLTALGVDPSGARVATGGFDFEVKLWDFGGMDSSCRAFKAVRPCEDHQIKHLEFSPSGENLLVISGSAHAHVVTRDGEPVCFTNKGFQYITDPASAKGHTHGLHWGCWHPLDSSRFLTCSQDATLRIWNIEDAETLMNETRIPTHKSVIKPRTSQGRKVIPTTCTFSKDGQVIVAGCQDGSLQMWDTRKLFVNTSQLVREAHPPNTTITCVACSWDGKHLVSRAVDDTVKLWDGRALSKGPVHIVRDLPVLFDQSDVVFSPNDHIISAAVSAPRGDQKAGRITFYRRDNFKLMEEIKPEHGSVIRVAWHHRINQLFCASSDGTANVLYDNQASHHGALLCASRQATAASRRRRLGGSEAYMKPYLLTYNEDSVRSAR---KAKKLLNQPGMESQIALAAVTAPVHANRQAAATLANQQARARAPVQEEALGNRVGSLHQYMVQQIVLKKDEAE-ERAEKDIRGAILRHAEEAKSKPFWTK-AYLKTQPNPVFYNADEE 608          
BLAST of WD repeat domain 70 vs. TrEMBL
Match: A0A5J4NFH1 (WD_REPEATS_REGION domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0014728 PE=4 SV=1)

HSP 1 Score: 353.599 bits (906), Expect = 6.368e-111
Identity = 194/514 (37.74%), Postives = 293/514 (57.00%), Query Frame = 1
Query:  136 DVYFIPKSESVKLSHGQKMITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCEQ-EIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDIRTGMKTPQHVWSDLYVTNERTNCIVSPSDKMVITGTSLRKNETESHAI-FYNRSTFEEIDRIPLKNASTVTVEWHPRLNQLLIGSSVGTLDLFYDRTFSHNGALSFMSKAPKPKKSNR-----EFYTNDMLLTYDEETERLARIGQRASKFREGPE-------LNPYLK---------AKKEMKKRVPQQPTEANNKYPTLHQHLVQQIVIPKRTPEAEYYENNPREAILRHANAPK---YWTAGAYDKTQPKPIF-DTEED 1596
            D Y++P  +S+   HG K +T+ +++  G R+ T   D  + LWDF GM+S+  +FK V PCE+ +IK +EFS +GEH+L IS   QA I+DR+GE V  T KG  Y+ DP + KGH   L++GCW+P  +    TCS D ++R+W++ D E ++++ RI NHK+ I P+S++G+K++P  CAY+    ++ A C DGS+Q+WDTRK F         A+P N  IS + +++D   ++TR+ DD +K++D R   +   H+  DL V  ++T    SP+D +V    S  +   ++  + F+ R  F+ ++ +   + S V V WH R+NQ+   SS GT ++ YD   SHNGAL   ++        R     E Y    LLTY+E+T RLAR  ++    + G E       LN  ++         A ++ K RVP       N+  +LHQ++VQQIV+ K   + E  E + R AILRHA+  K   +WT  AY KTQP PIF D  ED
Sbjct:   97 DSYYLPICDSLSFCHGCKPLTALAVDPAGARIATGGFDFDIKLWDFGGMDSSCRAFKVVRPCEEHQIKHLEFSPSGEHLLAISGSAQAQIVDRDGEPVCFTNKGFQYITDPSNAKGHTHALHWGCWHPLDSSKFLTCSQDATLRVWDLNDAESLMNETRIPNHKAVIKPRSLQGRKVVPTACAYSKDSQVIAAGCLDGSLQMWDTRKLFVNTCQLVRDAHPANQHISCVAWSWDGRQLVTRAMDDTVKLWDARVLSRGAVHIRPDLPVLFDQTEVTFSPNDHIVTASVSAPRGAVKAGRLAFFRRDNFQPLEDLCPGHGSVVRVIWHHRINQIFCASSDGTANVHYDPQVSHNGALLCAARQATAASRRRRLGGSEAYMKPYLLTYNEDTVRLARKNKKVVN-QPGLETQVAMAALNAQIQTERQTAAALANQKAKARVPVLEETLGNRVGSLHQYMVQQIVLRKNEAD-ERAEKDIRGAILRHADEAKAKPFWTK-AYQKTQPNPIFHDPHED 607          
BLAST of WD repeat domain 70 vs. TrEMBL
Match: A0A452GM17 (WD repeat domain 70 OS=Gopherus agassizii OX=38772 GN=WDR70 PE=4 SV=1)

HSP 1 Score: 347.436 bits (890), Expect = 4.759e-108
Identity = 189/500 (37.80%), Postives = 279/500 (55.80%), Query Frame = 1
Query:  148 IPKSESVKLSHGQKMITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCE-QEIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDIRTGMKTPQHVWSDLYVTNERTNCIVSPSDKMVITGTSLRKNETESHAIFYNRSTFEEIDRIPLKNASTVTVEWHPRLNQLLIGSSVGTLDLFYDRTFSHNGALSFMSKAPKPKKSNREFYTNDMLLT------YDEETERLARIGQRASKFREGPELNPYLKAKKEMKKRVPQQPTEANNKYPTLHQHLVQQIVIPKRTPEAEYYENNPREAILRHANAPK---YWTAGAYDKTQPKPIF---DTEEDEPDH 1608
            IP S  + L HG K +++  ++ +G RL+T   D  + LWDF GM+++  +F+++ PCE  +IK +++S+ G+ ILV+S + QA +LDR+G  V+E IKG+ Y+ D  +TKGH  MLN GCW+P++ E+  TCS DG+VR W++            K HK    P+SV+GK++IP TC Y+  G ++ A C DGSIQ+WD R       FHC  A+   TE S L+F+YD   + +R  DD +K +DIR   K P +    L      T+C  SP DK+++TGTS++K       IF+ R TF+++  I + +AS V   WHP+LNQ+++G+  G   ++YD   S  GA   + K  K K    E  T D ++T      + E  +R  R      K  E   L+P    K E     P +         TL  ++V+ I + K        ++NPREAILRHA   +   YW A AY KTQPK +F   ++EEDE D+
Sbjct:  178 IPDSHEITLQHGTKTVSALGLDPSGARLVTGGYDYDVRLWDFAGMDASLQAFRSLQPCECHQIKSLQYSSTGDVILVVSGNSQAKVLDRDGFPVMECIKGDQYIVDMANTKGHTAMLNTGCWHPKIKEEFLTCSNDGTVRTWDV---------NNDKKHKGVFKPRSVQGKRVIPTTCTYSRDGKLIAAGCQDGSIQIWD-RNMNVHTKFHCRQAHAPGTETSCLMFSYDGTVLASRGGDDTLKTWDIRQ-FKKPINSVEGLSSFFPMTDCCFSPDDKLIVTGTSIKKGGGNGKLIFFERETFQKVYEIEVTDASVVRCLWHPKLNQIMVGTGNGLAKVYYDPVKSQRGAKLCVVKT-KRKARQAETLTQDYIITPHALPMFREPRQRSTR------KQLEKDRLDPLKSHKPEPPVAGPGRGGRVGTHGGTLSSYIVKNIALDKTD------DSNPREAILRHAKEAEDNPYWVAPAYSKTQPKAVFAEVESEEDETDN 653          
BLAST of WD repeat domain 70 vs. Ensembl Cavefish
Match: WDR70 (WD repeat domain 70 [Source:HGNC Symbol;Acc:HGNC:25495])

HSP 1 Score: 330.102 bits (845), Expect = 3.509e-105
Identity = 174/484 (35.95%), Postives = 280/484 (57.85%), Query Frame = 1
Query:  148 IPKSESVKLSHGQKMITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCE-QEIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDIRTGMKTPQHVWSDLYVTNERTNCIVSPSDKMVITGTSLRKNETESHAIFYNRSTFEEIDRIPLKNASTVTVEWHPRLNQLLIGSSVGTLDLFYDRTFSHNGALSFMSKAPKPKKSNREFYTNDMLLT-YDEETERLARIGQRASKFR-EGPELNPYLKAKKEMKKRVPQQPTEANNKYPTLHQHLVQQIVIPKRTPEAEYYENNPREAILRHANAPK---YWTAGAYDKTQPKPIF 1581
            IP +  + L HG K +++  ++ +G RL+T   D  +  WDF GM++   +F+++ PCE  +I+ +++S  G+ ILV++ + QA +LDR+G +VLE +KG+ Y+ D  +TKGH  MLN GCW+P++ E+  TCS DG+VR W+      + SD   K HKS   P+S++GK++ P  C Y+  G ++ A C DG+IQ+WD R       FHC  A+  +T+   L F+YD  ++ +R  DD +K +D+R   + P +V + L      T+C  SP DK+++TGTS++++E     +F++R +F+++  I + +AS V   WHP+LNQ+++G+  G   ++YD   S  GA   + K  K K+   E  T D ++T +     R AR  QR+++ + E   L+P    K E     P +         TL  ++V+ I + K        ++NPREAILRHA       YW A AY +TQP+P+F
Sbjct:  142 IPDTHEITLQHGTKTVSALGLDPSGARLVTGGYDYDVKFWDFAGMDAALHAFRSLQPCECHQIRSLQYSITGDVILVVAGNSQAKVLDRDGFQVLECVKGDQYIVDMANTKGHTAMLNGGCWHPKIKEEFLTCSNDGTVRTWD------LNSD---KKHKSVFKPRSLQGKRVTPTCCTYSRDGKLIAAGCQDGTIQIWD-RNLSVHTKFHCRQAHTPSTDTCCLTFSYDGTTLASRGGDDTLKTWDLRN-FRKPLNVATGLTTYFPMTDCCFSPDDKLLVTGTSVKRDEGNGKLVFFDRESFKKVYEIEVASASVVRCLWHPKLNQIMVGTGNGLAKVYYDPVKSQRGAKLCVVKN-KRKEKQAETLTQDYIITPHALPMFREAR--QRSTRKQLEKDRLDPMKSHKPEPPVSGPGRGGRVAAHGGTLSSYIVKNIALDKTD------DSNPREAILRHARDAAENPYWVAPAYTQTQPEPVF 605          
BLAST of WD repeat domain 70 vs. Ensembl Cavefish
Match: daw1 (dynein assembly factor with WD repeats 1 [Source:NCBI gene;Acc:103035445])

HSP 1 Score: 53.1434 bits (126), Expect = 4.722e-7
Identity = 60/244 (24.59%), Postives = 101/244 (41.39%), Query Frame = 1
Query:  160 ESVKLSHGQKMITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCEQEIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKI--LSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENT-EISSLIFTYDDLSVITRSNDDAMKIF 882
            E   LS     I S S  + G+RL+T + D T+++WD      +      +     EI  + F+ +   I+  S D    + D EG R L T+             GHN  +   C+N +  + +AT S DG+ R+++   F+ +  L     +  K C  P+          TC      ++ G+A  D + ++W            C+     +T EI S  F Y   ++IT S D+  +I+
Sbjct:  211 EVSTLSGHSAEIISLSFNTVGSRLVTGSFDHTVSVWDV----PSGRLVHNLKGHRGEISSVNFNWDSSLIVTASMDKTCKVWDAEGGRCLATL------------TGHNDEVLDVCFNFK-GQLIATASADGTSRVYDAQTFQFVCKLEGHEGEISKVCFNPQG---------TC------VLTGSA--DKTARVWSVSSG------SCLQVLEGHTDEIFSCAFNYYGDTIITGSKDNTCRIW 414          
BLAST of WD repeat domain 70 vs. Ensembl Cavefish
Match: POC1B (POC1 centriolar protein homolog B [Source:NCBI gene;Acc:103029957])

HSP 1 Score: 50.447 bits (119), Expect = 4.123e-6
Identity = 50/251 (19.92%), Postives = 109/251 (43.43%), Query Frame = 1
Query:  151 PKSESVKLSHGQKMITSTSIESTGNRLITANKDCTMNLWDFN-GMNSTASSFKTVTPCEQEIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCA-YASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDIRTG 897
            PK+ + +    + ++T+     +G+ L +A++D T+ LW  N   +ST  +  T T     ++ + FS++G+ ++  S+D    I     ++ + ++              H   +    ++P     +A+C  D +VR+W+              + + CI   +  G    P T   + +SG  + ++ +D ++++WD R +     +   SA      ++   F      +I+ S+D  +KI D+  G
Sbjct:   62 PKARAFRFEGHKDVVTAVHFSPSGDLLASASRDKTVRLWTPNIKGDSTVFTAHTAT-----VRSVNFSSDGQRLITASDDKSLKIWSVHRQKFIYSL------------NQHTNWVRCARFSPD-GRLVASCGDDRTVRLWD-------------TSSRQCINTFTDYGG---PATFVDFNASGTCIASSGADNTLKIWDIRTNKLIQHYQVHSA-----SVNCFSFHPSGNYLISGSSDSTVKILDLLEG 273          
BLAST of WD repeat domain 70 vs. Ensembl Cavefish
Match: POC1B (POC1 centriolar protein homolog B [Source:NCBI gene;Acc:103029957])

HSP 1 Score: 50.0618 bits (118), Expect = 4.334e-6
Identity = 50/251 (19.92%), Postives = 109/251 (43.43%), Query Frame = 1
Query:  151 PKSESVKLSHGQKMITSTSIESTGNRLITANKDCTMNLWDFN-GMNSTASSFKTVTPCEQEIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCA-YASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDIRTG 897
            PK+ + +    + ++T+     +G+ L +A++D T+ LW  N   +ST  +  T T     ++ + FS++G+ ++  S+D    I     ++ + ++              H   +    ++P     +A+C  D +VR+W+              + + CI   +  G    P T   + +SG  + ++ +D ++++WD R +     +   SA      ++   F      +I+ S+D  +KI D+  G
Sbjct:   49 PKARAFRFEGHKDVVTAVHFSPSGDLLASASRDKTVRLWTPNIKGDSTVFTAHTAT-----VRSVNFSSDGQRLITASDDKSLKIWSVHRQKFIYSL------------NQHTNWVRCARFSPD-GRLVASCGDDRTVRLWD-------------TSSRQCINTFTDYGG---PATFVDFNASGTCIASSGADNTLKIWDIRTNKLIQHYQVHSA-----SVNCFSFHPSGNYLISGSSDSTVKILDLLEG 260          
BLAST of WD repeat domain 70 vs. Ensembl Cavefish
Match: POC1B (POC1 centriolar protein homolog B [Source:NCBI gene;Acc:103029957])

HSP 1 Score: 50.0618 bits (118), Expect = 5.267e-6
Identity = 50/251 (19.92%), Postives = 109/251 (43.43%), Query Frame = 1
Query:  151 PKSESVKLSHGQKMITSTSIESTGNRLITANKDCTMNLWDFN-GMNSTASSFKTVTPCEQEIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCA-YASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDIRTG 897
            PK+ + +    + ++T+     +G+ L +A++D T+ LW  N   +ST  +  T T     ++ + FS++G+ ++  S+D    I     ++ + ++              H   +    ++P     +A+C  D +VR+W+              + + CI   +  G    P T   + +SG  + ++ +D ++++WD R +     +   SA      ++   F      +I+ S+D  +KI D+  G
Sbjct:   49 PKARAFRFEGHKDVVTAVHFSPSGDLLASASRDKTVRLWTPNIKGDSTVFTAHTAT-----VRSVNFSSDGQRLITASDDKSLKIWSVHRQKFIYSL------------NQHTNWVRCARFSPD-GRLVASCGDDRTVRLWD-------------TSSRQCINTFTDYGG---PATFVDFNASGTCIASSGADNTLKIWDIRTNKLIQHYQVHSA-----SVNCFSFHPSGNYLISGSSDSTVKILDLLEG 260          
BLAST of WD repeat domain 70 vs. Ensembl Sea Lamprey
Match: snrnp40 (small nuclear ribonucleoprotein 40 (U5) [Source:ZFIN;Acc:ZDB-GENE-040426-978])

HSP 1 Score: 50.0618 bits (118), Expect = 8.087e-7
Identity = 57/226 (25.22%), Postives = 93/226 (41.15%), Query Frame = 1
Query:  220 GNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCEQEIKKIEFSANGEHILVISNDIQAFILDRE-GERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDM-ATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDIR 891
            GN L +A  D T+ +W+  G     +  K  T     I  I +S +G  I   S D    + D E GER+             +  KGH   +N  C+  R    M  T S DG+V++W   D  K  S    +N   C           + VT    S  ++ G    D  I++WD R++         +    N  ++ L  + D   +++ + D++++I+DIR
Sbjct:   69 GNTLASAGFDRTILMWNVYGDCDNYAHLKGHT---GAILDIHYSTDGSTIFTSSTDKTVGLWDSETGERI-------------KRLKGHTSFVN-ACFPARRGPQMVCTASDDGTVKLW---DTRKKGSVHSFQNTYQC-----------LSVTFNDTSDQILSGGI--DNVIKVWDLRQNKL-----IYTMKGHNDSVTGLSLSPDGSYLLSNAMDNSVRIWDIR 256          
BLAST of WD repeat domain 70 vs. Ensembl Sea Lamprey
Match: WDR33 (WD repeat domain 33 [Source:HGNC Symbol;Acc:HGNC:25651])

HSP 1 Score: 48.521 bits (114), Expect = 3.674e-6
Identity = 52/228 (22.81%), Postives = 96/228 (42.11%), Query Frame = 1
Query:  220 GNRLITANKDCTMNLWDFNGMNSTASSFKTVTPC-EQEIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCA--YASSGLMV-GAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDIR 891
            G RL+T        LW     N  A +F+T+    +  ++ + +S N   + +++ D   F+      +  ++   N  +F     + H + +    + P      ATCS DG+VR+W   DF +   +R ++ H +              V C   + + GL+V G+  S   I+ WD +   +    H      +NT +  + +  +   ++T S D   K+FDIR
Sbjct:  131 GRRLVTGASSGEFTLW-----NGLAFNFETILQAHDSSVRAMTWSHN--DMWMLTADHGGFV------KYWQSNMNNVKMF-----QAHKEPIREASFAP-TDNKFATCSDDGTVRVW---DFMRCHEERILRGHGAD-------------VKCVDWHPTKGLLVSGSKDSQQPIKFWDPKSGHSLATLHAH----KNT-VMEVKWNQNGNWLLTASRDHLCKLFDIR 318          
BLAST of WD repeat domain 70 vs. Ensembl Sea Lamprey
Match: WDR33 (WD repeat domain 33 [Source:HGNC Symbol;Acc:HGNC:25651])

HSP 1 Score: 48.1358 bits (113), Expect = 4.853e-6
Identity = 52/228 (22.81%), Postives = 96/228 (42.11%), Query Frame = 1
Query:  220 GNRLITANKDCTMNLWDFNGMNSTASSFKTVTPC-EQEIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCA--YASSGLMV-GAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDIR 891
            G RL+T        LW     N  A +F+T+    +  ++ + +S N   + +++ D   F+      +  ++   N  +F     + H + +    + P      ATCS DG+VR+W   DF +   +R ++ H +              V C   + + GL+V G+  S   I+ WD +   +    H      +NT +  + +  +   ++T S D   K+FDIR
Sbjct:  131 GRRLVTGASSGEFTLW-----NGLAFNFETILQAHDSSVRAMTWSHN--DMWMLTADHGGFV------KYWQSNMNNVKMF-----QAHKEPIREASFAP-TDNKFATCSDDGTVRVW---DFMRCHEERILRGHGAD-------------VKCVDWHPTKGLLVSGSKDSQQPIKFWDPKSGHSLATLHAH----KNT-VMEVKWNQNGNWLLTASRDHLCKLFDIR 318          
BLAST of WD repeat domain 70 vs. Ensembl Nematostella
Match: EDO47857 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL14])

HSP 1 Score: 295.049 bits (754), Expect = 1.608e-93
Identity = 159/486 (32.72%), Postives = 267/486 (54.94%), Query Frame = 1
Query:  136 DVYFIPKSESVKLSHGQKMITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCE-QEIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDIRTGMKTPQHVWSDLYVTNERTNCIVSPSDKMVITGTSLRKNETESHAIFYNRSTFEEIDRIPLKNASTVTVEWHPRLNQLLIGSSVGTLDLFYDRTFSHNGALSFMSKAPKPKKSNREFYTNDMLLTYDEETERLARIGQRASKFREGPELNPYLKAKKEMKKRVPQQPTEANNKYPTLHQHLVQQIVIPKRTPEAEYYENNPREAILRHANAPK---YWTAGAYDKTQPKPIF 1581
            +V F+P +  V L HG K +++ +++ +G+RL+T + D  +  WDFN M+S+  +F+T+ P E  +IK  ++S  G+ +LV + + QA +LDR+G   LE +KG+ YL D  +TKGH  ML+  CW+P+  E   TCS DG+VRIW++            K +K+ I  K+ +GKK IP  C ++  G ++ AAC DGSIQ WDT++ F    +    A+   ++ S L F+     +++R  DD +K +D+R   + P ++ +DL     +T+C+ SP D++++TGTS+RK E     +F  + T     +  + ++S V+  WH +LNQ+++G+S G + +++D   S+ GA+  + K  + KK  R+    D ++T         +  +   K +E    +P       +K R P  P     K   +   +     + K     +  +++PREAIL+HA A K   YW + AY  TQP+ IF
Sbjct:   20 EVLFLPITHEVALEHGSKTVSAVALDPSGSRLVTGSYDYEIKFWDFNSMDSSLRAFRTLQPFECHQIKSAQYSITGDVLLVAAGNAQAKVLDRDGFEALECVKGDQYLTDMGNTKGHTAMLHCACWHPKQKEQFITCSNDGTVRIWDV---------NSPKKNKNVIKTKNKQGKKTIPTRCCFSRDGKLIVAACQDGSIQAWDTKRMFVHTTYLQREAHMSGSDTSGLDFSLSGNLLVSRGGDDTVKTWDLRN-FRKPVNIATDLPNFYSQTSCLFSPDDRLIVTGTSVRKGEGMGRLVFLEKDTLNIAYQFEVADSSVVSCMWHQKLNQIIVGTSDGKVKVYFDPNRSNKGAMLCVGKTQR-KKVLRDMVLPDHIITPHALPIYRQKQPRNMKKVKESDRKDP-------IKSRRPDLPMTGPGKGGRVTSGMSLSAFVVKNLALEKMDDSHPREAILKHAEAAKDDPYWVSPAYKTTQPETIF 487          
BLAST of WD repeat domain 70 vs. Ensembl Nematostella
Match: EDO41896 (Lissencephaly-1 homolog [Source:UniProtKB/Swiss-Prot;Acc:A7S338])

HSP 1 Score: 50.447 bits (119), Expect = 1.043e-6
Identity = 49/247 (19.84%), Postives = 100/247 (40.49%), Query Frame = 1
Query:  193 ITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCEQEIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAED-----MATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYA---------SSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDIR 891
            +   + + TG  L +++ D T+ LWDF G        +T+   +  +  I F  +G+H++  S D    + +      ++T +G                  +G W  RV  +     +A+CS D ++R+W +   E       +++H   I   +   +   PV    A         S G  + +A  D SI++WD            V+    +  + +++F      +++ S+D  ++I+D +
Sbjct:  151 VQDLAFDHTGKFLASSSADMTIKLWDFQGFE----CIRTLHGHDHNVSSISFLPSGDHLVSASRDKTIKMWEIATGYCVKTFQG------------------HGEWVRRVRPNADGSLIASCSNDQTIRVWVVASRE---CKCDLRDHDHVIEDLNWAPESATPVINEAAGVEGGKKAMSPGPFLVSASRDKSIKIWDVSAGVC-----LVTLVGHDNWVRAVMFHPGGKFIVSCSDDKTLRIWDYK 367          
BLAST of WD repeat domain 70 vs. Ensembl Nematostella
Match: EDO34865 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN68])

HSP 1 Score: 47.7506 bits (112), Expect = 9.214e-6
Identity = 56/243 (23.05%), Postives = 103/243 (42.39%), Query Frame = 1
Query:  157 SESVKLSHGQKMITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCEQEIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENT-EISSLIFTYDDLSVITRSNDDAMKIF 882
            +E   LS     I S +  STG +L+T + D T+++WD      +     T+     EI   +F+ +   I+  S D    I D    + + T++G+            +++L+         + +AT S DG+ R++N L    +    +++ H+           +I  +T  + + G  +  A SD + +LWD           C+     +T EI S  F YD   +IT S D+  +++
Sbjct:  210 AEISTLSGHSAEIISCAFNSTGTQLLTGSFDHTVSVWD----TRSGRRVHTLIGHRGEISNAQFNFDCSFIVTGSMDKTCKIWDAGTGKCIGTLRGHD-----------DEVLDVAF--DYTGQLIATASADGTGRVYNALTHHCL---SKLEGHEG----------EISKIT--FNAQGTRLLTASSDKTARLWDPNTG------KCLQVLEGHTDEIFSCAFNYDGDIIITGSKDNTCRLW 414          
BLAST of WD repeat domain 70 vs. Ensembl Medaka
Match: WDR70 (WD repeat domain 70 [Source:NCBI gene;Acc:101158713])

HSP 1 Score: 332.413 bits (851), Expect = 5.920e-106
Identity = 174/484 (35.95%), Postives = 280/484 (57.85%), Query Frame = 1
Query:  148 IPKSESVKLSHGQKMITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCE-QEIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDIRTGMKTPQHVWSDLYVTNERTNCIVSPSDKMVITGTSLRKNETESHAIFYNRSTFEEIDRIPLKNASTVTVEWHPRLNQLLIGSSVGTLDLFYDRTFSHNGALSFMSKAPKPKKSNREFYTNDMLLT-YDEETERLARIGQRASKFR-EGPELNPYLKAKKEMKKRVPQQPTEANNKYPTLHQHLVQQIVIPKRTPEAEYYENNPREAILRHANAPK---YWTAGAYDKTQPKPIF 1581
            IP +  + L HG K +++ +++ +G RL+T   D  +  WDF GM+ +  +F+++ PC+  +IK +++S  G+ +LV+S + QA +LDR+G  V+E IKG+ Y+ D  +TKGH  MLN GCW+P++ E+  TCS DG+VR W++         +  K HKS   P+S +GKK+IP+ C Y+  G ++ A C DGSIQ+WD R       FHC  A+   ++ S L F+YD +++ +R  DD +K++DIR+  + P +  S L      T+C  SP +K+++TGTS+++ +     +F+++ +F+ +  I + NAS V   WHP+LNQ++ G+  G   ++YD   SH GA   + K+ + K  + E  T D ++T +     R AR  QR+++ + E   L+P    K E     P +         TL   +V+ I + K        ++NPREAILRHA       YW A AY +TQP+P+F
Sbjct:  154 IPDTHEIILQHGTKTVSALALDPSGARLVTGGYDYDVRFWDFAGMDQSLQAFRSLQPCDCHQIKSLQYSITGDVLLVVSGNAQAKVLDRDGFNVMECIKGDQYIVDMANTKGHTAMLNSGCWHPKMKEEFMTCSNDGTVRTWDV---------KSEKQHKSVFKPRSFQGKKVIPICCTYSRDGKLIAAGCQDGSIQIWD-RNLSVHTKFHCRQAHAVGSDTSCLCFSYDGVTLASRGGDDTLKVWDIRS-FRKPVNEASGLTNYFSMTDCCFSPDNKLLLTGTSVKREQGSGKLVFFDKLSFKRVYEIEVTNASVVRCLWHPKLNQVMAGTGNGLAKVYYDPVKSHRGAKLCVVKSQR-KGKHAETLTQDYIITPHALPMFRDAR--QRSTRKQLEKDRLDPKKSHKPEPPVSGPGRGGRVAAHGGTLSSFIVKNIALDKTD------DSNPREAILRHAKEASENPYWVAPAYKETQPEPVF 617          
BLAST of WD repeat domain 70 vs. Ensembl Medaka
Match: WDR70 (WD repeat domain 70 [Source:NCBI gene;Acc:101158713])

HSP 1 Score: 332.413 bits (851), Expect = 5.920e-106
Identity = 174/484 (35.95%), Postives = 280/484 (57.85%), Query Frame = 1
Query:  148 IPKSESVKLSHGQKMITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCE-QEIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDIRTGMKTPQHVWSDLYVTNERTNCIVSPSDKMVITGTSLRKNETESHAIFYNRSTFEEIDRIPLKNASTVTVEWHPRLNQLLIGSSVGTLDLFYDRTFSHNGALSFMSKAPKPKKSNREFYTNDMLLT-YDEETERLARIGQRASKFR-EGPELNPYLKAKKEMKKRVPQQPTEANNKYPTLHQHLVQQIVIPKRTPEAEYYENNPREAILRHANAPK---YWTAGAYDKTQPKPIF 1581
            IP +  + L HG K +++ +++ +G RL+T   D  +  WDF GM+ +  +F+++ PC+  +IK +++S  G+ +LV+S + QA +LDR+G  V+E IKG+ Y+ D  +TKGH  MLN GCW+P++ E+  TCS DG+VR W++         +  K HKS   P+S +GKK+IP+ C Y+  G ++ A C DGSIQ+WD R       FHC  A+   ++ S L F+YD +++ +R  DD +K++DIR+  + P +  S L      T+C  SP +K+++TGTS+++ +     +F+++ +F+ +  I + NAS V   WHP+LNQ++ G+  G   ++YD   SH GA   + K+ + K  + E  T D ++T +     R AR  QR+++ + E   L+P    K E     P +         TL   +V+ I + K        ++NPREAILRHA       YW A AY +TQP+P+F
Sbjct:  154 IPDTHEIILQHGTKTVSALALDPSGARLVTGGYDYDVRFWDFAGMDQSLQAFRSLQPCDCHQIKSLQYSITGDVLLVVSGNAQAKVLDRDGFNVMECIKGDQYIVDMANTKGHTAMLNSGCWHPKMKEEFMTCSNDGTVRTWDV---------KSEKQHKSVFKPRSFQGKKVIPICCTYSRDGKLIAAGCQDGSIQIWD-RNLSVHTKFHCRQAHAVGSDTSCLCFSYDGVTLASRGGDDTLKVWDIRS-FRKPVNEASGLTNYFSMTDCCFSPDNKLLLTGTSVKREQGSGKLVFFDKLSFKRVYEIEVTNASVVRCLWHPKLNQVMAGTGNGLAKVYYDPVKSHRGAKLCVVKSQR-KGKHAETLTQDYIITPHALPMFRDAR--QRSTRKQLEKDRLDPKKSHKPEPPVSGPGRGGRVAAHGGTLSSFIVKNIALDKTD------DSNPREAILRHAKEASENPYWVAPAYKETQPEPVF 617          
BLAST of WD repeat domain 70 vs. Ensembl Medaka
Match: katnb1 (katanin regulatory subunit B1 [Source:NCBI gene;Acc:101167102])

HSP 1 Score: 55.8398 bits (133), Expect = 9.441e-8
Identity = 49/228 (21.49%), Postives = 98/228 (42.98%), Query Frame = 1
Query:  211 ESTGNRLITANKDCTMNLWDFNGMNSTAS--SFKTVTPCEQEIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDI 888
            +STG  L T  +DC +NLW  N  N   S    KT   C      I+FS + E +   S      + D E  ++L+T+             GH   +    ++P   + +A+ S D ++++W++     +    R K H   +             + A++  G  + +A  D +++LWD  +     +F   SA      ++ + F  ++  + + S+D +++++D+
Sbjct:   30 KSTGRLLATGGEDCRVNLWSLNKANCIMSLTGHKTAVEC------IQFSLSEEQVAAGSQSGSIRVWDLEAAKILQTL------------MGHKASITSLGFHP-YGQFLASSSMDTNIKLWDVRRKGYVF---RFKGHTDAV------------RSLAFSPDGKWLASASDDCTVKLWDLSQGKIITEFKSHSA-----AVNIVQFHPNEYLLASGSSDRSVRLWDL 218          
BLAST of WD repeat domain 70 vs. Ensembl Medaka
Match: katnb1 (katanin regulatory subunit B1 [Source:NCBI gene;Acc:101167102])

HSP 1 Score: 55.8398 bits (133), Expect = 9.441e-8
Identity = 49/228 (21.49%), Postives = 98/228 (42.98%), Query Frame = 1
Query:  211 ESTGNRLITANKDCTMNLWDFNGMNSTAS--SFKTVTPCEQEIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDI 888
            +STG  L T  +DC +NLW  N  N   S    KT   C      I+FS + E +   S      + D E  ++L+T+             GH   +    ++P   + +A+ S D ++++W++     +    R K H   +             + A++  G  + +A  D +++LWD  +     +F   SA      ++ + F  ++  + + S+D +++++D+
Sbjct:   30 KSTGRLLATGGEDCRVNLWSLNKANCIMSLTGHKTAVEC------IQFSLSEEQVAAGSQSGSIRVWDLEAAKILQTL------------MGHKASITSLGFHP-YGQFLASSSMDTNIKLWDVRRKGYVF---RFKGHTDAV------------RSLAFSPDGKWLASASDDCTVKLWDLSQGKIITEFKSHSA-----AVNIVQFHPNEYLLASGSSDRSVRLWDL 218          
BLAST of WD repeat domain 70 vs. Ensembl Medaka
Match: ENSORLT00000025739.2 (autophagy related 16 like 2 [Source:NCBI gene;Acc:101163065])

HSP 1 Score: 55.0694 bits (131), Expect = 1.670e-7
Identity = 57/285 (20.00%), Postives = 114/285 (40.00%), Query Frame = 1
Query:  148 IPKSESVKLSHGQKMITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCEQEIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDIRTGMKTPQHVWSDLY-VTNERTNCIVSPSDKMVITGTS 999
            +P      L   ++ I +     + + L T   D  + LW+      T +   T+    + +  +EF   G  +L  S D  A +L R G+        NP +    +  GH++ +    +       + T S D ++R+W   D ++    ++++   SC             + C    SG  + +   D  I++WD R         CV   P    ++SL  +YD   V++   DD++++ D+R   +      ++ +   ++ T  ++SP    V  G++
Sbjct:  318 VPARALQVLEAHEQGINAVRFSCSSDLLATGGTDRVVKLWELRA--GTLTHRATLDGSTEGVTCVEFDHTGRRVLAASFDRSA-LLWRLGD-------SNPKV----TLTGHSRKVTAARFTS-APHQVVTGSADRTIRLW---DLQRAACVQQVETPSSCS-----------DLVC----SGNCIISGHFDSKIRVWDGRLG------GCVQELPSQGRVTSLDLSYDHRQVLSCCRDDSLQLVDLRRWSRDRVVFRAEGFKCGSDSTKAVISPDSSYVAAGSA 563          
BLAST of WD repeat domain 70 vs. Planmine SMEST
Match: SMESG000059911.1 (SMESG000059911.1)

HSP 1 Score: 1035.4 bits (2676), Expect = 0.000e+0
Identity = 492/492 (100.00%), Postives = 492/492 (100.00%), Query Frame = 1
Query:  133 ADVYFIPKSESVKLSHGQKMITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCEQEIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDIRTGMKTPQHVWSDLYVTNERTNCIVSPSDKMVITGTSLRKNETESHAIFYNRSTFEEIDRIPLKNASTVTVEWHPRLNQLLIGSSVGTLDLFYDRTFSHNGALSFMSKAPKPKKSNREFYTNDMLLTYDEETERLARIGQRASKFREGPELNPYLKAKKEMKKRVPQQPTEANNKYPTLHQHLVQQIVIPKRTPEAEYYENNPREAILRHANAPKYWTAGAYDKTQPKPIFDTEEDEPDH 1608
            ADVYFIPKSESVKLSHGQKMITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCEQEIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDIRTGMKTPQHVWSDLYVTNERTNCIVSPSDKMVITGTSLRKNETESHAIFYNRSTFEEIDRIPLKNASTVTVEWHPRLNQLLIGSSVGTLDLFYDRTFSHNGALSFMSKAPKPKKSNREFYTNDMLLTYDEETERLARIGQRASKFREGPELNPYLKAKKEMKKRVPQQPTEANNKYPTLHQHLVQQIVIPKRTPEAEYYENNPREAILRHANAPKYWTAGAYDKTQPKPIFDTEEDEPDH
Sbjct:   19 ADVYFIPKSESVKLSHGQKMITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCEQEIKKIEFSANGEHILVISNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFTYDDLSVITRSNDDAMKIFDIRTGMKTPQHVWSDLYVTNERTNCIVSPSDKMVITGTSLRKNETESHAIFYNRSTFEEIDRIPLKNASTVTVEWHPRLNQLLIGSSVGTLDLFYDRTFSHNGALSFMSKAPKPKKSNREFYTNDMLLTYDEETERLARIGQRASKFREGPELNPYLKAKKEMKKRVPQQPTEANNKYPTLHQHLVQQIVIPKRTPEAEYYENNPREAILRHANAPKYWTAGAYDKTQPKPIFDTEEDEPDH 510          
BLAST of WD repeat domain 70 vs. Planmine SMEST
Match: SMESG000068152.1 (SMESG000068152.1)

HSP 1 Score: 56.6102 bits (135), Expect = 2.633e-8
Identity = 48/185 (25.95%), Postives = 86/185 (46.49%), Query Frame = 1
Query:  190 MITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCEQEIKKIEFSANGEHILVISNDIQAFILD-REGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQLW 741
            ++  +S++ST   L+T   D T  LW  NG  ST    +   PC+  +  ++ + + + IL+  +D +    D RE +  + TI G            H+K +N   WNP       TCS DG+ ++W+          R IK+ ++ IV KS    +     C ++  G ++  + +DGS++ +
Sbjct:  273 VVIDSSVKSTSGNLMTIGNDIT--LWHINGFESTVLR-RITLPCKFMV--MDHNQHTQLILIGCSDTRLRCFDFREAKHEVNTING-----------AHDKGINVVKWNPINPNMFVTCSYDGATKLWDA---------RNIKSARA-IVHKSTEAIR----CCDWSHDGELLAVSYTDGSLKFF 427          
The following BLAST results are available for this feature:
BLAST of WD repeat domain 70 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
WDR701.154e-9935.01WD repeat domain 70 [Source:HGNC Symbol;Acc:HGNC:2... [more]
WDR707.618e-5139.41WD repeat domain 70 [Source:HGNC Symbol;Acc:HGNC:2... [more]
POC1B3.190e-621.54POC1 centriolar protein B [Source:HGNC Symbol;Acc:... [more]
POC1B3.209e-621.54POC1 centriolar protein B [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of WD repeat domain 70 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
gad-16.105e-6931.12Gastrulation defective protein 1 [Source:UniProtK... [more]
prp-174.499e-724.35Yeast PRP (Splicing factor) related [Source:UniPr... [more]
prp-174.499e-724.35Yeast PRP (Splicing factor) related [Source:UniPr... [more]
atg-16.21.711e-621.90Autophagic-related protein 16.2 [Source:UniProtKB... [more]
back to top
BLAST of WD repeat domain 70 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG55433.657e-9334.21gene:FBgn0034908 transcript:FBtr0072124[more]
kat803.346e-724.89gene:FBgn0040207 transcript:FBtr0074246[more]
kat803.346e-724.89gene:FBgn0040207 transcript:FBtr0074247[more]
kat803.462e-724.89gene:FBgn0040207 transcript:FBtr0340443[more]
CG109311.698e-623.28gene:FBgn0034274 transcript:FBtr0089545[more]
back to top
BLAST of WD repeat domain 70 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
WDR701.206e-9537.63WD repeat domain 70 [Source:NCBI gene;Acc:10188483... [more]
WDR701.840e-9537.63WD repeat domain 70 [Source:NCBI gene;Acc:10188483... [more]
WDR704.706e-5738.33WD repeat domain 70 [Source:NCBI gene;Acc:10188483... [more]
WDR703.407e-4940.54WD repeat domain 70 [Source:NCBI gene;Acc:10188483... [more]
back to top
BLAST of WD repeat domain 70 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr704.259e-10335.98WD repeat domain 70 [Source:NCBI gene;Acc:780253][more]
wdr704.852e-10335.98WD repeat domain 70 [Source:NCBI gene;Acc:780253][more]
wdr708.409e-9835.67WD repeat domain 70 [Source:NCBI gene;Acc:780253][more]
wdr701.878e-9735.70WD repeat domain 70 [Source:NCBI gene;Acc:780253][more]
wdr703.063e-8937.33WD repeat domain 70 [Source:NCBI gene;Acc:780253][more]
back to top
BLAST of WD repeat domain 70 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Wdr701.320e-9935.21WD repeat domain 70 [Source:MGI Symbol;Acc:MGI:192... [more]
Poc1a7.457e-620.08POC1 centriolar protein A [Source:MGI Symbol;Acc:M... [more]
Poc1a7.709e-620.08POC1 centriolar protein A [Source:MGI Symbol;Acc:M... [more]
Poc1a7.709e-620.08POC1 centriolar protein A [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of WD repeat domain 70 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q0VA16|WDR70_XENTR3.170e-10235.98WD repeat-containing protein 70 OS=Xenopus tropica... [more]
sp|Q6GPP0|WDR70_XENLA3.032e-10036.07WD repeat-containing protein 70 OS=Xenopus laevis ... [more]
sp|Q5EB92|WDR70_RAT1.027e-9935.01WD repeat-containing protein 70 OS=Rattus norvegic... [more]
sp|Q9NW82|WDR70_HUMAN5.540e-9935.01WD repeat-containing protein 70 OS=Homo sapiens OX... [more]
sp|Q32LB0|WDR70_BOVIN3.681e-9834.82WD repeat-containing protein 70 OS=Bos taurus OX=9... [more]
back to top
BLAST of WD repeat domain 70 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2D2N22.012e-11439.11WD repeat-containing protein isoform 2 OS=Schistos... [more]
G4LWB61.993e-11137.86WD_REPEATS_REGION domain-containing protein OS=Sch... [more]
A0A4S2LK673.957e-11137.21WD_REPEATS_REGION domain-containing protein OS=Opi... [more]
A0A5J4NFH16.368e-11137.74WD_REPEATS_REGION domain-containing protein OS=Par... [more]
A0A452GM174.759e-10837.80WD repeat domain 70 OS=Gopherus agassizii OX=38772... [more]
back to top
BLAST of WD repeat domain 70 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WDR703.509e-10535.95WD repeat domain 70 [Source:HGNC Symbol;Acc:HGNC:2... [more]
daw14.722e-724.59dynein assembly factor with WD repeats 1 [Source:N... [more]
POC1B4.123e-619.92POC1 centriolar protein homolog B [Source:NCBI gen... [more]
POC1B4.334e-619.92POC1 centriolar protein homolog B [Source:NCBI gen... [more]
POC1B5.267e-619.92POC1 centriolar protein homolog B [Source:NCBI gen... [more]
back to top
BLAST of WD repeat domain 70 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
snrnp408.087e-725.22small nuclear ribonucleoprotein 40 (U5) [Source:ZF... [more]
WDR333.674e-622.81WD repeat domain 33 [Source:HGNC Symbol;Acc:HGNC:2... [more]
WDR334.853e-622.81WD repeat domain 33 [Source:HGNC Symbol;Acc:HGNC:2... [more]
back to top
BLAST of WD repeat domain 70 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD repeat domain 70 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO478571.608e-9332.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418961.043e-619.84Lissencephaly-1 homolog [Source:UniProtKB/Swiss-P... [more]
EDO348659.214e-623.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of WD repeat domain 70 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WDR705.920e-10635.95WD repeat domain 70 [Source:NCBI gene;Acc:10115871... [more]
WDR705.920e-10635.95WD repeat domain 70 [Source:NCBI gene;Acc:10115871... [more]
katnb19.441e-821.49katanin regulatory subunit B1 [Source:NCBI gene;Ac... [more]
katnb19.441e-821.49katanin regulatory subunit B1 [Source:NCBI gene;Ac... [more]
ENSORLT00000025739.21.670e-720.00autophagy related 16 like 2 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of WD repeat domain 70 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000059911.10.000e+0100.00SMESG000059911.1[more]
SMESG000068152.12.633e-825.95SMESG000068152.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035842 ID=SMED30035842|Name=WD repeat domain 70|organism=Schmidtea mediterranea sexual|type=transcript|length=1677bp
AAATGCAAATCTTTGTTTTAATATCTATAATATTTAATGTAATTTTGAAA
TTAGTATTTATTTTTATAATTGCTTATAATGGGTGTAGAAGATAAAATTG
AGTCGGACGAAGAATATGAAGAAATTCCTGAAGCTGATGTGTATTTTATA
CCTAAAAGTGAATCCGTAAAATTAAGTCACGGGCAGAAAATGATAACATC
AACGTCAATTGAATCAACTGGTAATAGACTTATTACGGCAAACAAGGATT
GTACAATGAACCTTTGGGACTTCAATGGTATGAATTCTACCGCATCATCA
TTTAAGACTGTAACTCCATGTGAGCAGGAAATTAAGAAAATTGAATTCAG
TGCTAATGGAGAGCATATTCTCGTTATTAGTAATGATATACAGGCCTTTA
TATTAGACAGAGAAGGTGAAAGAGTGTTAGAAACCATCAAAGGAAATCCG
TATTTATTTGATCCACGTTCTACTAAAGGGCATAATAAAATGCTTAACTA
TGGTTGTTGGAATCCACGAGTAGCTGAAGACATGGCTACATGCTCTGGGG
ATGGTAGTGTTCGAATTTGGAATATTTTAGATTTTGAAAAAATTCTTAGT
GACAGGCGTATTAAAAATCACAAATCATGCATCGTACCAAAATCAGTGCG
TGGGAAAAAAATAATACCTGTGACATGTGCATATGCAAGCAGTGGTTTGA
TGGTTGGAGCTGCATGCAGCGATGGATCGATACAGCTGTGGGATACAAGA
AAATCATTCACAAAACCAGATTTTCATTGTGTTTCTGCATATCCAGAAAA
TACGGAAATATCTTCTTTGATATTTACATATGATGATTTATCCGTTATAA
CTCGTTCTAATGACGACGCAATGAAAATATTTGATATTAGAACTGGAATG
AAAACTCCGCAACATGTTTGGAGTGATTTGTATGTGACAAATGAGAGGAC
AAATTGCATCGTTAGTCCAAGCGATAAGATGGTGATCACCGGTACTTCGT
TGCGTAAAAATGAAACAGAAAGCCATGCGATATTCTACAATCGATCAACG
TTTGAAGAGATCGATCGTATTCCATTGAAAAATGCGAGTACAGTCACAGT
GGAATGGCATCCAAGATTAAATCAATTATTGATCGGTTCATCAGTTGGCA
CATTGGATTTATTCTATGATAGAACATTTAGCCACAACGGAGCTCTATCT
TTCATGAGCAAAGCACCGAAACCGAAGAAGTCCAATCGAGAATTTTACAC
CAATGACATGTTATTGACATATGACGAGGAAACCGAACGGTTGGCACGAA
TCGGTCAAAGGGCCTCGAAGTTCCGTGAAGGTCCCGAATTGAATCCGTAT
CTAAAGGCCAAGAAAGAAATGAAAAAAAGAGTTCCTCAACAGCCGACCGA
GGCCAACAACAAATATCCAACATTACATCAGCATTTGGTGCAGCAGATCG
TTATTCCCAAGCGCACTCCGGAAGCAGAATATTATGAGAACAATCCCAGA
GAGGCCATTTTGCGACACGCCAACGCCCCGAAATACTGGACAGCTGGGGC
ATATGATAAAACTCAGCCGAAACCAATATTCGATACAGAAGAAGACGAGC
CAGACCATAAAAAATCCAAAATTGTTTGAGTTTTATTAATAAATGTTTTG
TTTCTTTTCTCAAAAAAAAAGATCGGA
back to top

protein sequence of SMED30035842-orf-1

>SMED30035842-orf-1 ID=SMED30035842-orf-1|Name=SMED30035842-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=517bp
MGVEDKIESDEEYEEIPEADVYFIPKSESVKLSHGQKMITSTSIESTGNR
LITANKDCTMNLWDFNGMNSTASSFKTVTPCEQEIKKIEFSANGEHILVI
SNDIQAFILDREGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAE
DMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTC
AYASSGLMVGAACSDGSIQLWDTRKSFTKPDFHCVSAYPENTEISSLIFT
YDDLSVITRSNDDAMKIFDIRTGMKTPQHVWSDLYVTNERTNCIVSPSDK
MVITGTSLRKNETESHAIFYNRSTFEEIDRIPLKNASTVTVEWHPRLNQL
LIGSSVGTLDLFYDRTFSHNGALSFMSKAPKPKKSNREFYTNDMLLTYDE
ETERLARIGQRASKFREGPELNPYLKAKKEMKKRVPQQPTEANNKYPTLH
QHLVQQIVIPKRTPEAEYYENNPREAILRHANAPKYWTAGAYDKTQPKPI
FDTEEDEPDHKKSKIV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0019899enzyme binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 231..269
e-value: 100.0
score: 4.3
coord: 183..222
e-value: 14.0
score: 9.7
coord: 113..165
e-value: 1.1
score: 16.7
coord: 71..110
e-value: 140.0
score: 3.5
coord: 25..64
e-value: 0.83
score: 17.5
IPR001680WD40 repeatPFAMPF00400WD40coord: 143..165
e-value: 0.17
score: 12.8
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 32..73
score: 9.472
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 132..174
score: 9.807
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 26..361
e-value: 5.3E-32
score: 113.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 489..516
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 498..516
NoneNo IPR availablePANTHERPTHR16017GASTRULATION DEFECTIVE PROTEIN 1-RELATEDcoord: 8..512
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 209..223
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 51..65
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 152..166
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 32..278
score: 16.296
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 36..361