Placenta specific protein 8

Overview
NamePlacenta specific protein 8
Smed IDSMED30035840
Length (bp)629
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Placenta specific protein 8 (SMED30035840) t-SNE clustered cells

Violin plots show distribution of expression levels for Placenta specific protein 8 (SMED30035840) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Placenta specific protein 8 (SMED30035840) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Placenta specific protein 8 (SMED30035840) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035840

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30035840h1SMcG0005193 Contig902GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30035840h1SMcG0005193 dd_Smed_v4_564_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30035840h1SMcG0005193 dd_Smed_v4_564_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035840h1SMcG0005193 dd_Smed_v4_564_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30035840h1SMcG0005193 dd_Smed_v6_564_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
intestinal phagocyteSMED30035840h1SMcG0005193 dd_Smed_v6_564_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Placenta specific protein 8 vs. Ensembl Zebrafish
Match: ponzr5 (plac8 onzin related protein 5 [Source:ZFIN;Acc:ZDB-GENE-081104-325])

HSP 1 Score: 53.1434 bits (126), Expect = 7.407e-9
Identity = 30/76 (39.47%), Postives = 42/76 (55.26%), Query Frame = 1
Query:  223 FFFGCF--YTQYLMSKYGECCCAACL-----IPAPVMALRIQHRNRHKIMGNMLNDCCTSLYCGLCVLCQIKRDMD 429
            F F CF  +      K+GEC C   L     IPA  +A+R+  R+R+ I G++  DC  S +CG C  CQI R+M+
Sbjct:   34 FSFWCFPCFACSTARKHGECLCLPLLDGFGFIPAITLAMRVSVRSRYGIKGSICKDCAYSTFCGACSWCQISREMN 109          
BLAST of Placenta specific protein 8 vs. Ensembl Zebrafish
Match: ponzr5 (plac8 onzin related protein 5 [Source:ZFIN;Acc:ZDB-GENE-081104-325])

HSP 1 Score: 53.1434 bits (126), Expect = 7.477e-9
Identity = 30/76 (39.47%), Postives = 42/76 (55.26%), Query Frame = 1
Query:  223 FFFGCF--YTQYLMSKYGECCCAACL-----IPAPVMALRIQHRNRHKIMGNMLNDCCTSLYCGLCVLCQIKRDMD 429
            F F CF  +      K+GEC C   L     IPA  +A+R+  R+R+ I G++  DC  S +CG C  CQI R+M+
Sbjct:   37 FSFWCFPCFACSTARKHGECLCLPLLDGFGFIPAITLAMRVSVRSRYGIKGSICKDCAYSTFCGACSWCQISREMN 112          
BLAST of Placenta specific protein 8 vs. Ensembl Zebrafish
Match: ponzr2 (plac8 onzin related protein 2 [Source:ZFIN;Acc:ZDB-GENE-050411-41])

HSP 1 Score: 51.6026 bits (122), Expect = 2.522e-8
Identity = 32/77 (41.56%), Postives = 38/77 (49.35%), Query Frame = 1
Query:  223 FFFGCF--YTQYLMSKYGECCCAACL-------IPAPVMALRIQHRNRHKIMGNMLNDCCTSLYCGLCVLCQIKRDM 426
            F F CF  YT      YGEC C   L       IP   M++R   R R+ I G M NDC  S +C  CV CQ+ R+M
Sbjct:   38 FAFWCFSCYTCIQARNYGECLCLPLLDIFCGGMIPPITMSIRTSMRQRYGIQGTMCNDCVLSTFCRPCVWCQMSREM 114          
BLAST of Placenta specific protein 8 vs. Ensembl Zebrafish
Match: ponzr2 (plac8 onzin related protein 2 [Source:ZFIN;Acc:ZDB-GENE-050411-41])

HSP 1 Score: 51.6026 bits (122), Expect = 2.522e-8
Identity = 32/77 (41.56%), Postives = 38/77 (49.35%), Query Frame = 1
Query:  223 FFFGCF--YTQYLMSKYGECCCAACL-------IPAPVMALRIQHRNRHKIMGNMLNDCCTSLYCGLCVLCQIKRDM 426
            F F CF  YT      YGEC C   L       IP   M++R   R R+ I G M NDC  S +C  CV CQ+ R+M
Sbjct:   38 FAFWCFSCYTCIQARNYGECLCLPLLDIFCGGMIPPITMSIRTSMRQRYGIQGTMCNDCVLSTFCRPCVWCQMSREM 114          
BLAST of Placenta specific protein 8 vs. Ensembl Zebrafish
Match: plac8l1 (PLAC8 like 1 [Source:ZFIN;Acc:ZDB-GENE-091204-165])

HSP 1 Score: 45.0542 bits (105), Expect = 8.041e-6
Identity = 28/74 (37.84%), Postives = 36/74 (48.65%), Query Frame = 1
Query:  226 FFGCFYTQYLMSKYGECCCAACLIPAPVMALRIQHRNRHKIMGNMLNDCCTSLYCGLCVLCQIKRDMDYVLATK 447
            F  C     L  +YGEC C   L+P    A+R+  R R KI GN+  D  T   C    LCQ+ R+M   L T+
Sbjct:   65 FVPCCLDLSLAHQYGECMCLP-LLPGSTFAMRVGIRERFKIRGNVCEDWMTVYCCYPLALCQMIREMKRRLKTQ 137          
BLAST of Placenta specific protein 8 vs. Ensembl Xenopus
Match: ENSXETT00000008293.1 (novel protein similar to cornifelin [Source:NCBI gene;Acc:733751])

HSP 1 Score: 48.521 bits (114), Expect = 3.606e-7
Identity = 23/59 (38.98%), Postives = 34/59 (57.63%), Query Frame = 1
Query:  253 LMSKYGECCCAACLIPAPVMALRIQHRNRHKIMGNMLNDCCTSLYCGLCVLCQIKRDMD 429
            +   YGECCC   L+   ++ALR   R R+ I G +  DC    +CG C LCQ+ R+++
Sbjct:   56 VAQDYGECCCLP-LMGGTILALRTGIRERYHIQGTICTDCLCVTFCGPCALCQMARELE 113          
BLAST of Placenta specific protein 8 vs. Ensembl Xenopus
Match: ifi35 (interferon induced protein 35 [Source:Xenbase;Acc:XB-GENE-1010748])

HSP 1 Score: 48.521 bits (114), Expect = 4.591e-7
Identity = 23/59 (38.98%), Postives = 34/59 (57.63%), Query Frame = 1
Query:  253 LMSKYGECCCAACLIPAPVMALRIQHRNRHKIMGNMLNDCCTSLYCGLCVLCQIKRDMD 429
            +   YGECCC   L+   ++ALR   R R+ I G +  DC    +CG C LCQ+ R+++
Sbjct:   66 VAQDYGECCCLP-LMGGTILALRTGIRERYHIQGTICTDCLCVTFCGPCALCQMARELE 123          
BLAST of Placenta specific protein 8 vs. Ensembl Xenopus
Match: ifi35 (interferon induced protein 35 [Source:Xenbase;Acc:XB-GENE-1010748])

HSP 1 Score: 48.1358 bits (113), Expect = 5.803e-7
Identity = 23/59 (38.98%), Postives = 34/59 (57.63%), Query Frame = 1
Query:  253 LMSKYGECCCAACLIPAPVMALRIQHRNRHKIMGNMLNDCCTSLYCGLCVLCQIKRDMD 429
            +   YGECCC   L+   ++ALR   R R+ I G +  DC    +CG C LCQ+ R+++
Sbjct:   64 VAQDYGECCCLP-LMGGTILALRTGIRERYHIQGTICTDCLCVTFCGPCALCQMARELE 121          
BLAST of Placenta specific protein 8 vs. Ensembl Xenopus
Match: abtb1 (ankyrin repeat and BTB (POZ) domain containing 1 [Source:Xenbase;Acc:XB-GENE-976579])

HSP 1 Score: 47.7506 bits (112), Expect = 6.420e-7
Identity = 25/67 (37.31%), Postives = 36/67 (53.73%), Query Frame = 1
Query:  226 FFGCFYTQYLMSKYGECCCAACLIPAPVMALRIQHRNRHKIMGNMLNDCCTSLYCGLCVLCQIKRDM 426
            F  C     +   +GECCC  CL    V+A+R   R R+ I G++ ND     +CG C LCQ+ R++
Sbjct:   42 FVPCILACKVSQDFGECCCLPCLF-GSVLAVRTGIRERYHIEGSICNDWVCLSFCGQCTLCQMAREL 107          
BLAST of Placenta specific protein 8 vs. Ensembl Xenopus
Match: myo19 (myosin XIX [Source:Xenbase;Acc:XB-GENE-999897])

HSP 1 Score: 47.3654 bits (111), Expect = 1.042e-6
Identity = 22/59 (37.29%), Postives = 36/59 (61.02%), Query Frame = 1
Query:  253 LMSKYGECCCAACLIPAPVMALRIQHRNRHKIMGNMLNDCCTSLYCGLCVLCQIKRDMD 429
            +   YGECCC   ++   ++A+R   R R++I G + NDC    +CG C LCQ+ R+++
Sbjct:   51 VAQDYGECCCLP-VLNGTIIAMRTGIRERYQIPGTICNDCVCLTFCGPCTLCQMARELN 108          
BLAST of Placenta specific protein 8 vs. UniProt/SwissProt
Match: sp|Q6DK93|CNFN_XENTR (Cornifelin homolog OS=Xenopus tropicalis OX=8364 GN=cnfn PE=3 SV=1)

HSP 1 Score: 47.7506 bits (112), Expect = 3.401e-6
Identity = 25/67 (37.31%), Postives = 36/67 (53.73%), Query Frame = 1
Query:  226 FFGCFYTQYLMSKYGECCCAACLIPAPVMALRIQHRNRHKIMGNMLNDCCTSLYCGLCVLCQIKRDM 426
            F  C     +   +GECCC  CL    V+A+R   R R+ I G++ ND     +CG C LCQ+ R++
Sbjct:   42 FVPCILACKVSQDFGECCCLPCLF-GSVLAVRTGIRERYHIEGSICNDWVCLSFCGQCTLCQMAREL 107          
BLAST of Placenta specific protein 8 vs. UniProt/SwissProt
Match: sp|Q6DK99|CNFNB_XENLA (Cornifelin homolog B OS=Xenopus laevis OX=8355 GN=cnfn-b PE=3 SV=1)

HSP 1 Score: 46.9802 bits (110), Expect = 5.922e-6
Identity = 25/67 (37.31%), Postives = 35/67 (52.24%), Query Frame = 1
Query:  226 FFGCFYTQYLMSKYGECCCAACLIPAPVMALRIQHRNRHKIMGNMLNDCCTSLYCGLCVLCQIKRDM 426
            F  C     +   YGECCC  CL    V+A+R   R R+ I G++ ND     +C  C LCQ+ R++
Sbjct:   42 FVPCILACKVSKDYGECCCLPCLF-GSVLAVRTGIRERYHIEGSICNDWVCLSFCAPCTLCQMAREL 107          
BLAST of Placenta specific protein 8 vs. TrEMBL
Match: G7Y8A7 (PLAC8-like protein 1 OS=Clonorchis sinensis OX=79923 GN=CLF_102652 PE=4 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 1.331e-15
Identity = 51/150 (34.00%), Postives = 77/150 (51.33%), Query Frame = 1
Query:   34 PYNKFQEKP-------PGYGGEFQPVIQNQPYAGGX-XXXXXXXXXXNIGGRDWXXXXXXXXXXXXXXXXVFFFGCFYTQYLMSKYGECCCAACLIPAPVMALRIQHRNRHKIMGNMLNDCCTSLYCGLCVLCQIKRDMDYVLATKGTLE 459
            PYN  + KP       P +    QP+ Q  P        V   +   + G RDW   +C C ++  +C     F      ++   YGECCC   ++P   M L ++HR+RH+I+G++  DCCT + CG C LC++ RDM +V A KG+L+
Sbjct:   12 PYNSSEAKPLYPTEMQPAFPSPAQPLYQTPPAVPTVNVIVEQPKPVVSEGYRDWKDGLCDCGNNCGNCILTALFYPCMVCHMYKLYGECCCTPLVVPMADMVLSVKHRSRHRIVGSVAGDCCTFMCCGPCALCRLYRDMTFVEALKGSLQ 161          
BLAST of Placenta specific protein 8 vs. TrEMBL
Match: A0A5J4NRE5 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0010981 PE=4 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 4.116e-15
Identity = 36/80 (45.00%), Postives = 51/80 (63.75%), Query Frame = 1
Query:  220 VFFFGCFYTQYLMSKYGECCCAACLIPAPVMALRIQHRNRHKIMGNMLNDCCTSLYCGLCVLCQIKRDMDYVLATKGTLE 459
             FF+ C    ++  +YGECCC  C+IP   M L ++HR+RH+I+G++  DCCT + C  C LC++ RDM YV    GTL 
Sbjct:   74 AFFYPCVEC-HMYQRYGECCCTPCVIPMSGMVLAVKHRSRHRIVGSISGDCCTFMCCAPCALCRLYRDMVYVEGVNGTLS 152          
BLAST of Placenta specific protein 8 vs. TrEMBL
Match: A0A0P0DI19 (Placenta specific protein 8 OS=Dugesia japonica OX=6161 GN=Plac 8 PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.069e-14
Identity = 38/79 (48.10%), Postives = 53/79 (67.09%), Query Frame = 1
Query:  220 VFFFGCFYTQYLMSKYGECCCAACLIPAPVMALRIQHRNRHKIMGNMLNDCCTSLYCGLCVLCQIKRDMDYVLATKGTL 456
             FF  C+     M +Y EC C++ L+P  +MALRIQHRNRH I G + +DC  S   G C +CQ+KRDM ++++TKG+L
Sbjct:   54 TFFPQCYLCCMYM-EYNECFCSSLLVPNSLMALRIQHRNRHGIKGTICDDCIKSTCYGPCTMCQLKRDMKHIISTKGSL 131          
BLAST of Placenta specific protein 8 vs. TrEMBL
Match: A0A4V3SFF2 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004386 PE=4 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 1.351e-14
Identity = 35/80 (43.75%), Postives = 53/80 (66.25%), Query Frame = 1
Query:  220 VFFFGCFYTQYLMSKYGECCCAACLIPAPVMALRIQHRNRHKIMGNMLNDCCTSLYCGLCVLCQIKRDMDYVLATKGTLE 459
              F+ C    ++  +YGECCC   ++P   M L ++HR+RH+I+G++  DCCT L CG C LC++ RDM +V A KG+L+
Sbjct:   82 TLFYPCVEC-HMYKRYGECCCTPLVVPMAGMVLSVKHRSRHRIVGSVAGDCCTFLCCGPCALCRLYRDMVFVEAIKGSLQ 160          
BLAST of Placenta specific protein 8 vs. TrEMBL
Match: A0A4E0RMG0 (Placenta-specific gene 8 protein OS=Fasciola hepatica OX=6192 GN=D915_001276 PE=4 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 6.884e-14
Identity = 44/104 (42.31%), Postives = 58/104 (55.77%), Query Frame = 1
Query:  151 NIGGRDWXXXXXXXXXXXXXXXXVFFFGCFYTQYLMSKYGECCCAACLIPAPVMALRIQHRNRHKIMGNMLNDCCTSLYCGLCVLCQIKRDMDYVLATKGTLEL 462
             I  RDW   +C C  D +SC CV    C Y  Y+  +Y E  C    IP P+M LR  HR R +I+G++  DC TS +C  C LCQ+ RDM Y   T+G L++
Sbjct:   19 QIPFRDWHDGLCQCSSDWKSCACVTLCTCCYMCYMFKRYNENVCTPLFIPTPIMMLRTYHRGRERIVGSLFRDCVTSAFCPWCSLCQLDRDMKYQEITRGYLDV 122          
BLAST of Placenta specific protein 8 vs. Ensembl Cavefish
Match: ponzr6 (cornifelin homolog [Source:NCBI gene;Acc:103028345])

HSP 1 Score: 53.1434 bits (126), Expect = 7.962e-9
Identity = 28/67 (41.79%), Postives = 36/67 (53.73%), Query Frame = 1
Query:  259 SKYGECCCAAC-------LIPAPVMALRIQHRNRHKIMGNMLNDCCTSLYCGLCVLCQIKRDMDYVL 438
             KYGEC C          LIP    ++R   R R+ I G+M +DCC S  CG+C  CQI R++ Y L
Sbjct:   52 KKYGECMCLPLVELCFGGLIPPVTYSMRSSMRERYHIQGSMCDDCCVSTCCGICAWCQIARELKYRL 118          
BLAST of Placenta specific protein 8 vs. Ensembl Cavefish
Match: ponzr6 (cornifelin homolog [Source:NCBI gene;Acc:103028345])

HSP 1 Score: 51.9878 bits (123), Expect = 2.211e-8
Identity = 27/65 (41.54%), Postives = 35/65 (53.85%), Query Frame = 1
Query:  259 SKYGECCCAAC-------LIPAPVMALRIQHRNRHKIMGNMLNDCCTSLYCGLCVLCQIKRDMDY 432
             KYGEC C          LIP    ++R   R R+ I G+M +DCC S  CG+C  CQI R++ Y
Sbjct:   54 KKYGECMCLPLVELCFGGLIPPVTYSMRSSMRERYHIQGSMCDDCCVSTCCGICAWCQIARELKY 118          
BLAST of Placenta specific protein 8 vs. Ensembl Cavefish
Match: ponzr6 (cornifelin homolog [Source:NCBI gene;Acc:103028345])

HSP 1 Score: 51.9878 bits (123), Expect = 2.211e-8
Identity = 27/65 (41.54%), Postives = 35/65 (53.85%), Query Frame = 1
Query:  259 SKYGECCCAAC-------LIPAPVMALRIQHRNRHKIMGNMLNDCCTSLYCGLCVLCQIKRDMDY 432
             KYGEC C          LIP    ++R   R R+ I G+M +DCC S  CG+C  CQI R++ Y
Sbjct:   54 KKYGECMCLPLVELCFGGLIPPVTYSMRSSMRERYHIQGSMCDDCCVSTCCGICAWCQIARELKY 118          
BLAST of Placenta specific protein 8 vs. Ensembl Cavefish
Match: ponzr6 (cornifelin homolog [Source:NCBI gene;Acc:103028345])

HSP 1 Score: 51.6026 bits (122), Expect = 2.380e-8
Identity = 27/65 (41.54%), Postives = 35/65 (53.85%), Query Frame = 1
Query:  259 SKYGECCCAAC-------LIPAPVMALRIQHRNRHKIMGNMLNDCCTSLYCGLCVLCQIKRDMDY 432
             KYGEC C          LIP    ++R   R R+ I G+M +DCC S  CG+C  CQI R++ Y
Sbjct:   54 KKYGECMCLPLVELCFGGLIPPVTYSMRSSMRERYHIQGSMCDDCCVSTCCGICAWCQIARELKY 118          
BLAST of Placenta specific protein 8 vs. Ensembl Cavefish
Match: ponzr6 (cornifelin homolog [Source:NCBI gene;Acc:103028345])

HSP 1 Score: 51.6026 bits (122), Expect = 2.533e-8
Identity = 27/65 (41.54%), Postives = 35/65 (53.85%), Query Frame = 1
Query:  259 SKYGECCCAAC-------LIPAPVMALRIQHRNRHKIMGNMLNDCCTSLYCGLCVLCQIKRDMDY 432
             KYGEC C          LIP    ++R   R R+ I G+M +DCC S  CG+C  CQI R++ Y
Sbjct:   54 KKYGECMCLPLVELCFGGLIPPVTYSMRSSMRERYHIQGSMCDDCCVSTCCGICAWCQIARELKY 118          
BLAST of Placenta specific protein 8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009354.1 (pep scaffold:Pmarinus_7.0:GL483774:7229:14014:-1 gene:ENSPMAG00000008464.1 transcript:ENSPMAT00000009354.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 43.5134 bits (101), Expect = 3.892e-6
Identity = 21/60 (35.00%), Postives = 33/60 (55.00%), Query Frame = 1
Query:  253 LMSKYGECCCAACLIPAPVMALRIQHRNRHKIMGNMLNDCCTSLYCGLCVLCQIKRDMDY 432
            + S +GEC C   ++P  +MALR   R RH I G + +D  +   C  C  CQ+ R++ +
Sbjct:   51 VASDFGECFCVP-MLPGALMALRTGIRERHHIEGTVFDDFVSLWCCNHCTTCQMARELRH 109          
BLAST of Placenta specific protein 8 vs. Ensembl Medaka
Match: ponzr3 (cornifelin homolog A [Source:NCBI gene;Acc:101160195])

HSP 1 Score: 45.8246 bits (107), Expect = 2.449e-6
Identity = 28/75 (37.33%), Postives = 36/75 (48.00%), Query Frame = 1
Query:  223 FFFGCF--YTQYLMSKYGECCCAACL-----IPAPVMALRIQHRNRHKIMGNMLNDCCTSLYCGLCVLCQIKRDM 426
            F F CF  +      K GEC C   L     IP    A+R+  R ++ I G +  DC  S +CG C  CQI R+M
Sbjct:   38 FAFWCFPCFACITSKKAGECLCLPLLDGFGCIPPITTAMRVSIRKQYGIEGTICRDCVFSFFCGPCSWCQISREM 112          
BLAST of Placenta specific protein 8 vs. Ensembl Medaka
Match: plac8.1 (placenta associated 8, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-050809-124])

HSP 1 Score: 44.669 bits (104), Expect = 3.571e-6
Identity = 24/60 (40.00%), Postives = 34/60 (56.67%), Query Frame = 1
Query:  253 LMSKYGECCCAACLIPAPVMALRIQHRNRHKIMGNMLNDCCTSLYCGLCVLCQIKRDMDY 432
            + S  GECC      P     +R  +R R+ I G+M NDC  SL+C +C  CQ+KRD+ +
Sbjct:   35 IASDMGECCMFGTGYP-----IRSVYRTRYNIKGSMCNDCLMSLFCPVCSTCQLKRDIKH 89          
BLAST of Placenta specific protein 8 vs. Ensembl Medaka
Match: ENSORLT00000028572.1 (cornifelin homolog [Source:NCBI gene;Acc:101172524])

HSP 1 Score: 44.669 bits (104), Expect = 5.961e-6
Identity = 39/115 (33.91%), Postives = 57/115 (49.57%), Query Frame = 1
Query:   82 QPVIQNQPYAGGXXXXXXXXXXXNIGGRDWXXXXXXXXXXXXXXXXVFFFGCFYTQYLMSKYGECCCAACLIPAPVMALRIQHRNRHKIMGNMLNDCCTSLYCGLCVLCQIKRDM 426
             PV+ +QP AGG  T        N+   +WS+ +CSC +D   C   FF     + Y   KYGE  C  C +P  + A+R   R  + I G + ND      CGLC +C++ R++
Sbjct:    3 NPVVTHQPGAGGYGT--------NVQTGEWSTGLCSCFNDCLICALGFFCPAGLSCYTAHKYGENFCLGC-VPGGMTAMRTHMRLTYGIQGTVCNDAIMVFCCGLCEMCRMAREI 108          
BLAST of Placenta specific protein 8 vs. Planmine SMEST
Match: SMESG000050216.1 (SMESG000050216.1)

HSP 1 Score: 225.713 bits (574), Expect = 5.063e-76
Identity = 146/146 (100.00%), Postives = 146/146 (100.00%), Query Frame = 1
Query:   25 MNDPYNKFQEKPPGYGGEFQPVIQNQPYAGGXXXXXXXXXXXNIGGRDWXXXXXXXXXXXXXXXXVFFFGCFYTQYLMSKYGECCCAACLIPAPVMALRIQHRNRHKIMGNMLNDCCTSLYCGLCVLCQIKRDMDYVLATKGTLEL 462
            MNDPYNKFQEKPPGYGGEFQPVIQNQPYAGGQTTVIVQQTTQNIGGRDWSSPMCSCCDDMESCCCVFFFGCFYTQYLMSKYGECCCAACLIPAPVMALRIQHRNRHKIMGNMLNDCCTSLYCGLCVLCQIKRDMDYVLATKGTLEL
Sbjct:    1 MNDPYNKFQEKPPGYGGEFQPVIQNQPYAGGQTTVIVQQTTQNIGGRDWSSPMCSCCDDMESCCCVFFFGCFYTQYLMSKYGECCCAACLIPAPVMALRIQHRNRHKIMGNMLNDCCTSLYCGLCVLCQIKRDMDYVLATKGTLEL 146          
BLAST of Placenta specific protein 8 vs. Planmine SMEST
Match: SMESG000050229.1 (SMESG000050229.1)

HSP 1 Score: 111.694 bits (278), Expect = 4.734e-31
Identity = 82/149 (55.03%), Postives = 102/149 (68.46%), Query Frame = 1
Query:   16 SDKMNDPYNKFQEKPPGYGGEFQPVIQNQPYAGGXXXXXXXXXXXNIGGRDWXXXXXXXXXXXXXXXXVFFFGCFYTQYLMSKYGECCCAACLIPAPVMALRIQHRNRHKIMGNMLNDCCTSLYCGLCVLCQIKRDMDYVLATKGTLEL 462
            +D  N+P     ++PP Y G    V   QP   GQTTVI+QQ   + GGR WSS +CSC DDMESCCCV      YT  L S+YGECCC++C +P  + ALRIQHRNRHKI G++LND CT+++C     CQ+KRDMDYV+ATKGTL +
Sbjct:   14 ADDANEP---ILQQPPAYPG----VSVGQPSYPGQTTVIIQQPNISSGGRLWSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCSSCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDMDYVVATKGTLAM 155          
BLAST of Placenta specific protein 8 vs. Planmine SMEST
Match: SMESG000050221.1 (SMESG000050221.1)

HSP 1 Score: 105.145 bits (261), Expect = 1.155e-28
Identity = 76/150 (50.67%), Postives = 99/150 (66.00%), Query Frame = 1
Query:   19 DKMNDPYNKFQEKPPGYGGEFQPVIQNQPYAG--GXXXXXXXXXXXNIGGRDWXXXXXXXXXXXXXXXXVFFFGCFYTQYLMSKYGECCCAACLIPAPVMALRIQHRNRHKIMGNMLNDCCTSLYCGLCVLCQIKRDMDYVLATKGTLEL 462
             +++D  +   ++PP Y G          Y G  GQTTVI+QQ + + GGR WSS +CSC DDMESCCC       Y   L S+Y EC C++C IP  + ALRIQHRNRHK+ G +LNDC T+ +C LC +CQ+KRDMDYV+ATKG+L +
Sbjct:    5 SRIDDSTDPILQQPPEYPG---ISTHQTSYVGNHGQTTVIIQQPSISTGGRLWSSGICSCFDDMESCCCTILLPTCYIGRLYSRYNECICSSCCIPNALFALRIQHRNRHKVSGTILNDCMTASWCYLCAVCQLKRDMDYVVATKGSLAM 151          
BLAST of Placenta specific protein 8 vs. Planmine SMEST
Match: SMESG000050210.1 (SMESG000050210.1)

HSP 1 Score: 97.0561 bits (240), Expect = 1.176e-25
Identity = 44/73 (60.27%), Postives = 57/73 (78.08%), Query Frame = 1
Query:  241 YTQYLMSKYGECCCAACLIPAPVMALRIQHRNRHKIMGNMLNDCCTSLYCGLCVLCQIKRDMDYVLATKGTLE 459
            Y  ++  +Y ECCC ACL+    M LRIQHRNRHKIMG++LNDCCT+L C  C +CQ+KRDM+YV++TKG+L 
Sbjct:   66 YLCHMYCQYDECCCTACLVGCSPMILRIQHRNRHKIMGSILNDCCTTLCCMQCSICQLKRDMNYVISTKGSLH 138          
BLAST of Placenta specific protein 8 vs. Planmine SMEST
Match: SMESG000050208.1 (SMESG000050208.1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.084e-17
Identity = 35/72 (48.61%), Postives = 47/72 (65.28%), Query Frame = 1
Query:  241 YTQYLMSKYGECCCAACLIPAPVMALRIQHRNRHKIMGNMLNDCCTSLYCGLCVLCQIKRDMDYVLATKGTL 456
            Y  +L  +Y ECCC  C +    + L +QHRNRHKI G + NDC  S  C  C +C++KRDMD+V+ TKG+L
Sbjct:   60 YVCHLYMRYDECCCTGCCLMGNPIYLAVQHRNRHKIQGTIFNDCLESFLCYQCSICRLKRDMDHVMNTKGSL 131          
The following BLAST results are available for this feature:
BLAST of Placenta specific protein 8 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Placenta specific protein 8 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Placenta specific protein 8 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Placenta specific protein 8 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ponzr57.407e-939.47plac8 onzin related protein 5 [Source:ZFIN;Acc:ZDB... [more]
ponzr57.477e-939.47plac8 onzin related protein 5 [Source:ZFIN;Acc:ZDB... [more]
ponzr22.522e-841.56plac8 onzin related protein 2 [Source:ZFIN;Acc:ZDB... [more]
ponzr22.522e-841.56plac8 onzin related protein 2 [Source:ZFIN;Acc:ZDB... [more]
plac8l18.041e-637.84PLAC8 like 1 [Source:ZFIN;Acc:ZDB-GENE-091204-165][more]
back to top
BLAST of Placenta specific protein 8 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000008293.13.606e-738.98novel protein similar to cornifelin [Source:NCBI g... [more]
ifi354.591e-738.98interferon induced protein 35 [Source:Xenbase;Acc:... [more]
ifi355.803e-738.98interferon induced protein 35 [Source:Xenbase;Acc:... [more]
abtb16.420e-737.31ankyrin repeat and BTB (POZ) domain containing 1 [... [more]
myo191.042e-637.29myosin XIX [Source:Xenbase;Acc:XB-GENE-999897][more]
back to top
BLAST of Placenta specific protein 8 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Placenta specific protein 8 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q6DK93|CNFN_XENTR3.401e-637.31Cornifelin homolog OS=Xenopus tropicalis OX=8364 G... [more]
sp|Q6DK99|CNFNB_XENLA5.922e-637.31Cornifelin homolog B OS=Xenopus laevis OX=8355 GN=... [more]
back to top
BLAST of Placenta specific protein 8 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G7Y8A71.331e-1534.00PLAC8-like protein 1 OS=Clonorchis sinensis OX=799... [more]
A0A5J4NRE54.116e-1545.00Uncharacterized protein OS=Paragonimus westermani ... [more]
A0A0P0DI191.069e-1448.10Placenta specific protein 8 OS=Dugesia japonica OX... [more]
A0A4V3SFF21.351e-1443.75Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4E0RMG06.884e-1442.31Placenta-specific gene 8 protein OS=Fasciola hepat... [more]
back to top
BLAST of Placenta specific protein 8 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ponzr67.962e-941.79cornifelin homolog [Source:NCBI gene;Acc:103028345... [more]
ponzr62.211e-841.54cornifelin homolog [Source:NCBI gene;Acc:103028345... [more]
ponzr62.211e-841.54cornifelin homolog [Source:NCBI gene;Acc:103028345... [more]
ponzr62.380e-841.54cornifelin homolog [Source:NCBI gene;Acc:103028345... [more]
ponzr62.533e-841.54cornifelin homolog [Source:NCBI gene;Acc:103028345... [more]
back to top
BLAST of Placenta specific protein 8 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000009354.13.892e-635.00pep scaffold:Pmarinus_7.0:GL483774:7229:14014:-1 g... [more]
back to top
BLAST of Placenta specific protein 8 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Placenta specific protein 8 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Placenta specific protein 8 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ponzr32.449e-637.33cornifelin homolog A [Source:NCBI gene;Acc:1011601... [more]
plac8.13.571e-640.00placenta associated 8, tandem duplicate 1 [Source:... [more]
ENSORLT00000028572.15.961e-633.91cornifelin homolog [Source:NCBI gene;Acc:101172524... [more]
back to top
BLAST of Placenta specific protein 8 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000050216.15.063e-76100.00SMESG000050216.1[more]
SMESG000050229.14.734e-3155.03SMESG000050229.1[more]
SMESG000050221.11.155e-2850.67SMESG000050221.1[more]
SMESG000050210.11.176e-2560.27SMESG000050210.1[more]
SMESG000050208.11.084e-1748.61SMESG000050208.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035840 ID=SMED30035840|Name=Placenta specific protein 8|organism=Schmidtea mediterranea sexual|type=transcript|length=629bp
TAAATCATTAAAGTAAGCGATAAAATGAACGATCCATATAATAAATTCCA
AGAAAAGCCGCCCGGTTATGGGGGTGAATTCCAGCCAGTAATTCAAAATC
AACCATATGCGGGGGGTCAGACGACAGTGATAGTTCAACAAACGACGCAA
AACATAGGTGGCAGAGATTGGAGTTCGCCTATGTGTTCATGTTGTGATGA
CATGGAATCATGTTGTTGCGTATTCTTTTTTGGCTGTTTTTATACTCAAT
ATCTTATGTCGAAATACGGAGAATGTTGTTGCGCTGCATGTTTAATTCCA
GCGCCCGTTATGGCTCTCCGAATTCAACATAGAAATCGACACAAAATCAT
GGGTAATATGCTAAATGATTGCTGCACCTCTCTGTATTGTGGACTGTGCG
TTCTCTGCCAAATCAAGCGAGACATGGATTATGTCCTGGCGACAAAGGGA
ACCTTGGAATTGTGAATTCAATCAGAATTTTAATGATTTTATTATTTTTT
TATTAATATTATAAAATAGAACATTAAATTTAAAAATTAGATATCTTTTT
TACTTTGAACTAAAAAACTAAAAGTATTTTTGAAAATTTTTCTATGTAAT
AATATTAAATCTGTTGAAAAACTGTTGCA
back to top

protein sequence of SMED30035840-orf-1

>SMED30035840-orf-1 ID=SMED30035840-orf-1|Name=SMED30035840-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=147bp
MNDPYNKFQEKPPGYGGEFQPVIQNQPYAGGQTTVIVQQTTQNIGGRDWS
SPMCSCCDDMESCCCVFFFGCFYTQYLMSKYGECCCAACLIPAPVMALRI
QHRNRHKIMGNMLNDCCTSLYCGLCVLCQIKRDMDYVLATKGTLEL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR006461PLAC_motif_containing
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006461PLAC8 motif-containing proteinTIGRFAMTIGR01571TIGR01571coord: 47..134
e-value: 5.2E-12
score: 44.4
IPR006461PLAC8 motif-containing proteinPFAMPF04749PLAC8coord: 49..132
e-value: 2.6E-11
score: 44.4
IPR006461PLAC8 motif-containing proteinPANTHERPTHR15907FAMILY NOT NAMEDcoord: 21..136
NoneNo IPR availablePANTHERPTHR15907:SF93PLACENTA-SPECIFIC 8, TANDEM DUPLICATE 1-RELATEDcoord: 21..136