slc4a-2

Overview
Nameslc4a-2 (AKN21408.1)
Smed IDSMED30035834
Length (bp)3133
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc4a-2 (SMED30035834) t-SNE clustered cells

Violin plots show distribution of expression levels for slc4a-2 (SMED30035834) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc4a-2 (SMED30035834) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc4a-2 (SMED30035834) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035834

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30035834SMESG000057490.1 SmedASXL_013820SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30035834SMESG000057490.1 dd_Smed_v4_7905_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035834SMESG000057490.1 dd_Smed_v4_7905_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30035834SMESG000057490.1 dd_Smed_v4_7905_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30035834SMESG000057490.1 dd_Smed_v6_7905_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30035834SMESG000057490.1 dd_Smed_v6_7905_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30035834SMESG000057490.1 dd_Smed_v6_7905_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
pigment cellSMED30035834SMESG000057490.1 SMESG000007865.1 dd_Smed_v6_7905_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
glial cellSMED30035834SMESG000057490.1 SMESG000007865.1 dd_Smed_v6_7905_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30035834SMESG000057490.1 dd_Smed_v4_7905_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035834SMESG000057490.1 dd_Smed_v4_7905_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30035834SMESG000057490.1 dd_Smed_v4_7905_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
non-ciliated epidermisSMED30035834SMESG000057490.1 dd_Smed_v4_7905_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
collecting ductSMED30035834SMESG000057490.1 Smed-slc4a-2smed_ncbi_20200123PMID:21828097
Rink et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc4a-2 vs. Ensembl Human
Match: SLC4A10 (solute carrier family 4 member 10 [Source:HGNC Symbol;Acc:HGNC:13811])

HSP 1 Score: 724.931 bits (1870), Expect = 0.000e+0
Identity = 402/946 (42.49%), Postives = 576/946 (60.89%), Query Frame = 1
Query:   52 STENNDKDNQRY-LFCQLNEL---EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHHNKCGIGSQLSLFRSIVDNPNKKMKQN-----------PSRKTLC-ENGNE---EDGLLEY-KFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEELEMELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGK--LYVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQN 2823
             TE++D+++  + LF +L+E+   E    +W E +RW+KFEE VE+  E WSKP+V  LSL S+   +S IL+  + L+     +E++ D++L + +   +L+      + + L   H   H N+  + +++ + RS  D   K+ + N           P     C EN N+   E+  +++ K    F KKIP G+E +NILV E+ FL   +  F+RL  + ++    EV +PTRF+ I+LG  G     HE GR   +L+ D VF   AYKA +  DL+  IDEFLD   V+PP EW+P+I+I+PPK  +P +    +  P      +   + +P       EL+ TGR FGG + D+KRK  ++ SDFRD+ +LQCLASF+FLY AC++P ITFGGLL +AT+G + A+ES+  A++ G+ YSLF GQPLTILG+TGP+LVFE ++FK C  Y   +L  R  IG W     +I+VA+D S LV Y+T FTEE FA LI +I+I +A + LFEL E YPIN + +   +   SC+C+ P+    + +L E                +  SN S    I W N+T              C    G + G  CG    YVPD+ F+S +L   T T++  LK F+ S   P KVR  +  FAV + I    LID+ IG+ +PKL VPS F+PT     R W V  LG NPWW+ I A IPA+L  ILIFMDQQIT +I+NRK +KLKKG GYHLD+ ++A+++GV S++G+PWFV +TVL++ HV SLK+ES  + PG  P FLG REQR+T LMI + +G SVF T +L+ IPMPVL+GVF YMG S L  I    RI LF++ AK +PDF YL+++P+++VHLFT IQ+ CL LL+ IK ++  ++ FP++VLA+ FVRK ++  F++ EL WLD ++P++
Sbjct:  115 GTEDDDEEHIPHDLFTELDEICWREGEDAEWRETARWLKFEEDVEDGGERWSKPYVATLSLHSLFELRSCILNGTVLLDMHANTLEEIADMVLDQQVSSGQLNEDVRHRVHEALMKQH--HHQNQKKLTNRIPIVRSFADIGKKQSEPNSMDKNAGQVVSPQSAPACVENKNDVSRENSTVDFSKVDLHFMKKIPPGAEASNILVGELEFLDRTVVAFVRLSPAVLLQGLAEVPIPTRFLFILLGPLGKGQQYHEIGRSIATLMTDEVFHDVAYKAKDRNDLVSGIDEFLDQVTVLPPGEWDPSIRIEPPKN-VPSQ--EKRKIPAVPNGTAAHGEAEPHGGHSGPELQRTGRIFGGLILDIKRKAPYFWSDFRDAFSLQCLASFLFLYCACMSPVITFGGLLGEATEGRISAIESLFGASMTGIAYSLFGGQPLTILGSTGPVLVFEKILFKFCKEYGLSYLSLRASIGLWTATLCIILVATDASSLVCYITRFTEEAFASLICIIFIYEALEKLFELSEAYPINMHNDLELLTQYSCNCVEPHNPS-NGTLKE----------------WRESNISASDII-WENLT-----------VSECKSLHGEYVGRACGHDHPYVPDVLFWSVILFFSTVTLSATLKQFKTSRYFPTKVRSIVSDFAVFLTILCMVLIDYAIGIPSPKLQVPSVFKPT--RDDRGWFVTPLGPNPWWTVIAAIIPALLCTILIFMDQQITAVIINRKEHKLKKGCGYHLDLLMVAVMLGVCSIMGLPWFVAATVLSITHVNSLKLESECSAPGEQPKFLGIREQRVTGLMIFILMGSSVFMTSILKFIPMPVLYGVFLYMGASSLKGIQFFDRIKLFWMPAKHQPDFIYLRHVPLRKVHLFTIIQMSCLGLLWIIK-VSRAAIVFPMMVLALVFVRKLMDLLFTKRELSWLDDLMPES 1023          
BLAST of slc4a-2 vs. Ensembl Human
Match: SLC4A10 (solute carrier family 4 member 10 [Source:HGNC Symbol;Acc:HGNC:13811])

HSP 1 Score: 724.546 bits (1869), Expect = 0.000e+0
Identity = 402/946 (42.49%), Postives = 576/946 (60.89%), Query Frame = 1
Query:   52 STENNDKDNQRY-LFCQLNEL---EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHHNKCGIGSQLSLFRSIVDNPNKKMKQN-----------PSRKTLC-ENGNE---EDGLLEY-KFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEELEMELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGK--LYVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQN 2823
             TE++D+++  + LF +L+E+   E    +W E +RW+KFEE VE+  E WSKP+V  LSL S+   +S IL+  + L+     +E++ D++L + +   +L+      + + L   H   H N+  + +++ + RS  D   K+ + N           P     C EN N+   E+  +++ K    F KKIP G+E +NILV E+ FL   +  F+RL  + ++    EV +PTRF+ I+LG  G     HE GR   +L+ D VF   AYKA +  DL+  IDEFLD   V+PP EW+P+I+I+PPK  +P +    +  P      +   + +P       EL+ TGR FGG + D+KRK  ++ SDFRD+ +LQCLASF+FLY AC++P ITFGGLL +AT+G + A+ES+  A++ G+ YSLF GQPLTILG+TGP+LVFE ++FK C  Y   +L  R  IG W     +I+VA+D S LV Y+T FTEE FA LI +I+I +A + LFEL E YPIN + +   +   SC+C+ P+    + +L E                +  SN S    I W N+T              C    G + G  CG    YVPD+ F+S +L   T T++  LK F+ S   P KVR  +  FAV + I    LID+ IG+ +PKL VPS F+PT     R W V  LG NPWW+ I A IPA+L  ILIFMDQQIT +I+NRK +KLKKG GYHLD+ ++A+++GV S++G+PWFV +TVL++ HV SLK+ES  + PG  P FLG REQR+T LMI + +G SVF T +L+ IPMPVL+GVF YMG S L  I    RI LF++ AK +PDF YL+++P+++VHLFT IQ+ CL LL+ IK ++  ++ FP++VLA+ FVRK ++  F++ EL WLD ++P++
Sbjct:  104 GTEDDDEEHIPHDLFTELDEICWREGEDAEWRETARWLKFEEDVEDGGERWSKPYVATLSLHSLFELRSCILNGTVLLDMHANTLEEIADMVLDQQVSSGQLNEDVRHRVHEALMKQH--HHQNQKKLTNRIPIVRSFADIGKKQSEPNSMDKNAGQVVSPQSAPACVENKNDVSRENSTVDFSKVDLHFMKKIPPGAEASNILVGELEFLDRTVVAFVRLSPAVLLQGLAEVPIPTRFLFILLGPLGKGQQYHEIGRSIATLMTDEVFHDVAYKAKDRNDLVSGIDEFLDQVTVLPPGEWDPSIRIEPPKN-VPSQ--EKRKIPAVPNGTAAHGEAEPHGGHSGPELQRTGRIFGGLILDIKRKAPYFWSDFRDAFSLQCLASFLFLYCACMSPVITFGGLLGEATEGRISAIESLFGASMTGIAYSLFGGQPLTILGSTGPVLVFEKILFKFCKEYGLSYLSLRASIGLWTATLCIILVATDASSLVCYITRFTEEAFASLICIIFIYEALEKLFELSEAYPINMHNDLELLTQYSCNCVEPHNPS-NGTLKE----------------WRESNISASDII-WENLT-----------VSECKSLHGEYVGRACGHDHPYVPDVLFWSVILFFSTVTLSATLKQFKTSRYFPTKVRSIVSDFAVFLTILCMVLIDYAIGIPSPKLQVPSVFKPT--RDDRGWFVTPLGPNPWWTVIAAIIPALLCTILIFMDQQITAVIINRKEHKLKKGCGYHLDLLMVAVMLGVCSIMGLPWFVAATVLSITHVNSLKLESECSAPGEQPKFLGIREQRVTGLMIFILMGSSVFMTSILKFIPMPVLYGVFLYMGASSLKGIQFFDRIKLFWMPAKHQPDFIYLRHVPLRKVHLFTIIQMSCLGLLWIIK-VSRAAIVFPMMVLALVFVRKLMDLLFTKRELSWLDDLMPES 1012          
BLAST of slc4a-2 vs. Ensembl Human
Match: SLC4A10 (solute carrier family 4 member 10 [Source:HGNC Symbol;Acc:HGNC:13811])

HSP 1 Score: 724.161 bits (1868), Expect = 0.000e+0
Identity = 402/946 (42.49%), Postives = 576/946 (60.89%), Query Frame = 1
Query:   52 STENNDKDNQRY-LFCQLNEL---EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHHNKCGIGSQLSLFRSIVDNPNKKMKQN-----------PSRKTLC-ENGNE---EDGLLEY-KFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEELEMELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGK--LYVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQN 2823
             TE++D+++  + LF +L+E+   E    +W E +RW+KFEE VE+  E WSKP+V  LSL S+   +S IL+  + L+     +E++ D++L + +   +L+      + + L   H   H N+  + +++ + RS  D   K+ + N           P     C EN N+   E+  +++ K    F KKIP G+E +NILV E+ FL   +  F+RL  + ++    EV +PTRF+ I+LG  G     HE GR   +L+ D VF   AYKA +  DL+  IDEFLD   V+PP EW+P+I+I+PPK  +P +    +  P      +   + +P       EL+ TGR FGG + D+KRK  ++ SDFRD+ +LQCLASF+FLY AC++P ITFGGLL +AT+G + A+ES+  A++ G+ YSLF GQPLTILG+TGP+LVFE ++FK C  Y   +L  R  IG W     +I+VA+D S LV Y+T FTEE FA LI +I+I +A + LFEL E YPIN + +   +   SC+C+ P+    + +L E                +  SN S    I W N+T              C    G + G  CG    YVPD+ F+S +L   T T++  LK F+ S   P KVR  +  FAV + I    LID+ IG+ +PKL VPS F+PT     R W V  LG NPWW+ I A IPA+L  ILIFMDQQIT +I+NRK +KLKKG GYHLD+ ++A+++GV S++G+PWFV +TVL++ HV SLK+ES  + PG  P FLG REQR+T LMI + +G SVF T +L+ IPMPVL+GVF YMG S L  I    RI LF++ AK +PDF YL+++P+++VHLFT IQ+ CL LL+ IK ++  ++ FP++VLA+ FVRK ++  F++ EL WLD ++P++
Sbjct:  104 GTEDDDEEHIPHDLFTELDEICWREGEDAEWRETARWLKFEEDVEDGGERWSKPYVATLSLHSLFELRSCILNGTVLLDMHANTLEEIADMVLDQQVSSGQLNEDVRHRVHEALMKQH--HHQNQKKLTNRIPIVRSFADIGKKQSEPNSMDKNAGQVVSPQSAPACVENKNDVSRENSTVDFSKVDLHFMKKIPPGAEASNILVGELEFLDRTVVAFVRLSPAVLLQGLAEVPIPTRFLFILLGPLGKGQQYHEIGRSIATLMTDEVFHDVAYKAKDRNDLVSGIDEFLDQVTVLPPGEWDPSIRIEPPKN-VPSQ--EKRKIPAVPNGTAAHGEAEPHGGHSGPELQRTGRIFGGLILDIKRKAPYFWSDFRDAFSLQCLASFLFLYCACMSPVITFGGLLGEATEGRISAIESLFGASMTGIAYSLFGGQPLTILGSTGPVLVFEKILFKFCKEYGLSYLSLRASIGLWTATLCIILVATDASSLVCYITRFTEEAFASLICIIFIYEALEKLFELSEAYPINMHNDLELLTQYSCNCVEPHNPS-NGTLKE----------------WRESNISASDII-WENLT-----------VSECKSLHGEYVGRACGHDHPYVPDVLFWSVILFFSTVTLSATLKQFKTSRYFPTKVRSIVSDFAVFLTILCMVLIDYAIGIPSPKLQVPSVFKPT--RDDRGWFVTPLGPNPWWTVIAAIIPALLCTILIFMDQQITAVIINRKEHKLKKGCGYHLDLLMVAVMLGVCSIMGLPWFVAATVLSITHVNSLKLESECSAPGEQPKFLGIREQRVTGLMIFILMGSSVFMTSILKFIPMPVLYGVFLYMGASSLKGIQFFDRIKLFWMPAKHQPDFIYLRHVPLRKVHLFTIIQMSCLGLLWIIK-VSRAAIVFPMMVLALVFVRKLMDLLFTKRELSWLDDLMPES 1012          
BLAST of slc4a-2 vs. Ensembl Human
Match: SLC4A7 (solute carrier family 4 member 7 [Source:HGNC Symbol;Acc:HGNC:11033])

HSP 1 Score: 714.531 bits (1843), Expect = 0.000e+0
Identity = 395/957 (41.27%), Postives = 585/957 (61.13%), Query Frame = 1
Query:   52 STENNDKDNQRY-LFCQLNEL---EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHHNKCGIGSQLSLFRSIVD------NP-----------------NKKMKQNPSRKTLCENGNEEDGLLEY-KFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDS--ISEKYKPTQEELEMELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCI-PPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKL--YVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQN 2823
             TE++D+++  + LF +++EL   +    +W E +RW+KFEE VE+  + WSKP+V  LSL S+   +S IL+  + L+     ++++ D++L   I   +LD S  E +++ L   H   H N+    S++ L RS  D      +P                 N    ++   K     G+ E+  +++ K    F +KIP G+E +N+LV E+ FL   +  F+RL  + ++   TEV +PTRF+ ++LG  G     HE GR   +L+ D +F   AYKA +  DL+  IDEFLD   V+PP EW+P+I+I+PPK  +P +    +  P+ H   +  + E  K        EL+ TGR FGG + D+KRK  F+LSDF+D+L+LQCLAS +FLY AC++P ITFGGLL +AT+G + A+ES+  A++ G+ YSLF+GQPLTILG+TGP+LVFE +++K C  Y+  +L  R  IG W     +++VA+D S LV Y+T FTEE FA LI +I+I +A + LF+L E Y  N + N + + + SC C  PPN +          + L +++K                    +NIT    SW      + C    G + G+ CG    Y+PD+ F+  +L   TF ++  LK F+     P KVR TI  FAV + I +   ID+++G+ +PKL VP KFEPT  +  R WI+  LG NPWW+ ++A IPA+L  ILIFMDQQIT +I+NRK +KLKKG GYHLD+ ++ +++GV S++G+PWFV +TVL+++HV SLK+ES  + PG  P FLG REQR+T LMI + +G SVF T +L+ IPMPVL+GVF YMGVS L  I +  RI LF + AK +PD  YL+Y+P+ +VH+FT IQ+ CL+LL+ IK ++  +V FP++VLA+ FVRK ++  F++ EL WLD ++P++
Sbjct:  104 GTEDDDEEHIPHDLFTEMDELCYRDGEEYEWKETARWLKFEEDVEDGGDRWSKPYVATLSLHSLFELRSCILNGTVMLDMRASTLDEIADMVLDNMIASGQLDESIRENVREALLKRHH--HQNEKRFTSRIPLVRSFADIGKKHSDPHLLERNGILASPQSAPGNLDNSKSGEIKGNGSGGSRENSTVDFSKVDMNFMRKIPTGAEASNVLVGEVDFLERPIIAFVRLAPAVLLTGLTEVPVPTRFLFLLLGPAGKAPQYHEIGRSIATLMTDEIFHDVAYKAKDRNDLLSGIDEFLDQVTVLPPGEWDPSIRIEPPKS-VPSQ--EKRKIPVFHNGSTPTLGETPKEAAHHAGPELQRTGRLFGGLILDIKRKAPFFLSDFKDALSLQCLASILFLYCACMSPVITFGGLLGEATEGRISAIESLFGASLTGIAYSLFAGQPLTILGSTGPVLVFEKILYKFCRDYQLSYLSLRTSIGLWTSFLCIVLVATDASSLVCYITRFTEEAFAALICIIFIYEALEKLFDLGETYAFNMHNNLDKLTSYSCVCTEPPNPS---------NETLAQWKK--------------------DNITAHNISWRNLTVSE-CKKLRGVFLGSACGHHGPYIPDVLFWCVILFFTTFFLSSFLKQFKTKRYFPTKVRSTISDFAVFLTIVIMVTIDYLVGVPSPKLHVPEKFEPT--HPERGWIISPLGDNPWWTLLIAAIPALLCTILIFMDQQITAVIINRKEHKLKKGAGYHLDLLMVGVMLGVCSVMGLPWFVAATVLSISHVNSLKVESECSAPGEQPKFLGIREQRVTGLMIFILMGLSVFMTSVLKFIPMPVLYGVFLYMGVSSLKGIQLFDRIKLFGMPAKHQPDLIYLRYVPLWKVHIFTVIQLTCLVLLWVIK-VSAAAVVFPMMVLALVFVRKLMDLCFTKRELSWLDDLMPES 1022          
BLAST of slc4a-2 vs. Ensembl Human
Match: SLC4A7 (solute carrier family 4 member 7 [Source:HGNC Symbol;Acc:HGNC:11033])

HSP 1 Score: 712.99 bits (1839), Expect = 0.000e+0
Identity = 395/957 (41.27%), Postives = 585/957 (61.13%), Query Frame = 1
Query:   52 STENNDKDNQRY-LFCQLNEL---EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHHNKCGIGSQLSLFRSIVD------NP-----------------NKKMKQNPSRKTLCENGNEEDGLLEY-KFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDS--ISEKYKPTQEELEMELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCI-PPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKL--YVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQN 2823
             TE++D+++  + LF +++EL   +    +W E +RW+KFEE VE+  + WSKP+V  LSL S+   +S IL+  + L+     ++++ D++L   I   +LD S  E +++ L   H   H N+    S++ L RS  D      +P                 N    ++   K     G+ E+  +++ K    F +KIP G+E +N+LV E+ FL   +  F+RL  + ++   TEV +PTRF+ ++LG  G     HE GR   +L+ D +F   AYKA +  DL+  IDEFLD   V+PP EW+P+I+I+PPK  +P +    +  P+ H   +  + E  K        EL+ TGR FGG + D+KRK  F+LSDF+D+L+LQCLAS +FLY AC++P ITFGGLL +AT+G + A+ES+  A++ G+ YSLF+GQPLTILG+TGP+LVFE +++K C  Y+  +L  R  IG W     +++VA+D S LV Y+T FTEE FA LI +I+I +A + LF+L E Y  N + N + + + SC C  PPN +          + L +++K                    +NIT    SW      + C    G + G+ CG    Y+PD+ F+  +L   TF ++  LK F+     P KVR TI  FAV + I +   ID+++G+ +PKL VP KFEPT  +  R WI+  LG NPWW+ ++A IPA+L  ILIFMDQQIT +I+NRK +KLKKG GYHLD+ ++ +++GV S++G+PWFV +TVL+++HV SLK+ES  + PG  P FLG REQR+T LMI + +G SVF T +L+ IPMPVL+GVF YMGVS L  I +  RI LF + AK +PD  YL+Y+P+ +VH+FT IQ+ CL+LL+ IK ++  +V FP++VLA+ FVRK ++  F++ EL WLD ++P++
Sbjct:  104 GTEDDDEEHIPHDLFTEMDELCYRDGEEYEWKETARWLKFEEDVEDGGDRWSKPYVATLSLHSLFELRSCILNGTVMLDMRASTLDEIADMVLDNMIASGQLDESIRENVREALLKRHH--HQNEKRFTSRIPLVRSFADIGKKHSDPHLLERNGILASPQSAPGNLDNSKSGEIKGNGSGGSRENSTVDFSKVDMNFMRKIPTGAEASNVLVGEVDFLERPIIAFVRLAPAVLLTGLTEVPVPTRFLFLLLGPAGKAPQYHEIGRSIATLMTDEIFHDVAYKAKDRNDLLSGIDEFLDQVTVLPPGEWDPSIRIEPPKS-VPSQ--EKRKIPVFHNGSTPTLGETPKEAAHHAGPELQRTGRLFGGLILDIKRKAPFFLSDFKDALSLQCLASILFLYCACMSPVITFGGLLGEATEGRISAIESLFGASLTGIAYSLFAGQPLTILGSTGPVLVFEKILYKFCRDYQLSYLSLRTSIGLWTSFLCIVLVATDASSLVCYITRFTEEAFAALICIIFIYEALEKLFDLGETYAFNMHNNLDKLTSYSCVCTEPPNPS---------NETLAQWKK--------------------DNITAHNISWRNLTVSE-CKKLRGVFLGSACGHHGPYIPDVLFWCVILFFTTFFLSSFLKQFKTKRYFPTKVRSTISDFAVFLTIVIMVTIDYLVGVPSPKLHVPEKFEPT--HPERGWIISPLGDNPWWTLLIAAIPALLCTILIFMDQQITAVIINRKEHKLKKGAGYHLDLLMVGVMLGVCSVMGLPWFVAATVLSISHVNSLKVESECSAPGEQPKFLGIREQRVTGLMIFILMGLSVFMTSVLKFIPMPVLYGVFLYMGVSSLKGIQLFDRIKLFGMPAKHQPDLIYLRYVPLWKVHIFTVIQLTCLVLLWVIK-VSAAAVVFPMMVLALVFVRKLMDLCFTKRELSWLDDLMPES 1022          
BLAST of slc4a-2 vs. Ensembl Celegans
Match: abts-1 (Anion exchange protein [Source:UniProtKB/TrEMBL;Acc:B3WFV9])

HSP 1 Score: 657.136 bits (1694), Expect = 0.000e+0
Identity = 377/960 (39.27%), Postives = 548/960 (57.08%), Query Frame = 1
Query:   67 DKDNQRYLFCQLNELEPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHHN--KCGIGSQ----LSLFRSIVDNPNK--------KMKQNPSRKTLCENGNEEDGLLEY-------------------KFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEEL------EMELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPP-NKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWN--NITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKLYVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQ 2820
            +K+N   LF ++ EL  ++ +W E +RWVKFEE VE     WSKPHV  LSL S+   +S I++     +    +I  + + ++        L     EEL+++L   H++ +    K G G +    LS  RSI D            K+++ P      +      G                       K    F KK+P G E +N+L+ E+ FL+ ++C FIRLK ++ +G  TEV +PTRFI ++LG  G      E GR   +L+ D +F   AY A +  DL+  IDEFLD   V+PP EW+PNI+I+PP ++          + L  E  S     K  +EE       +  LK TG+ FGG + D+KRK   ++SDF D+ NLQCLAS  F+YF  LAP +TFGGLL +AT   + AME++   A+ GV+Y  F+GQPLTI+G+TGP+LVFE++VF  C  +   +L FR W+  W  + + ++V +D S LV ++T FTEE FA LI++I+I +A   L ++     +  N++ +++    CSC+PP  K  +S    +H + ++K    P+   F ++      +ID+   N+TD             C   GG++ G TC  LY  D    S +L +GTF +A  LK  RNS   P  VR+ +  FAV+IAI   T +D  +G+NTPKL VPS F PT  +  R W +P    N WW+  LA +PA+LA ILIFMDQQIT +IVNRK NKLKKG GYHLD+ ++++ I +   +G+P +V +TVL++NH+ SLK+ES    PG    F+G REQR+T ++  L IG SV  T +L RIPMPVL+GVF YMG+S L  I +  R  L F+  K +PD  Y++++PI+++HLFTA Q+ CL LL+ IKSI   S+ FPI+++ M  +RK +E  F+  +LK+LD  +P 
Sbjct:   78 EKENTPALFTEMGEL--NNEEWRETARWVKFEEDVEQGGNRWSKPHVATLSLHSLFQLRSCIMNGHFMNDLAETDIPSIFNAVIENLEKSGDLPSENREELREILLRKHVHQYEQAKKNGAGGEKGGFLSTVRSISDIGKSFSHGKNLSKIEEKPEGPVTSQTAGAPSGSSNQLTLPTVESVPKDISSEESSKGNLHFLKKLPAGVEASNVLIGEVDFLTRHICCFIRLKNANQLGDLTEVPVPTRFIFLLLGPTGHGQQYREIGRAIATLMADEIFHDVAYGARDVDDLLDGIDEFLDQVTVLPPGEWDPNIRIEPPSKLPSQEKRKQIGQELLVEPSSHKHVKKVVEEEEIHSHGDDPALKRTGKLFGGLILDIKRKAPHFVSDFTDAFNLQCLASICFMYFGLLAPIVTFGGLLEEATHQRMAAMENLFGGALCGVIYHFFAGQPLTIVGSTGPVLVFETIVFDFCHRFGIVYLSFRFWVHVWTAVIIFLMVVTDASALVSFITRFTEESFATLIAVIFIYEAIMKLVKIKGQLDM-INYSRDFVEGGFCSCVPPIGKPSVSP---DHARLVIKSTGLPI--AFNDT------FIDYTAANLTD-------------CRTIGGSFDGTTCFPLY--DKLLMSILLTVGTFFLATTLKKMRNSCYFPSSVRQLLSDFAVMIAIASMTFVDIFVGVNTPKLNVPSTFRPT--WEGRGWFIPPFDANEWWTAPLAILPALLACILIFMDQQITTVIVNRKENKLKKGCGYHLDLLVLSVSILMVGFLGLPIYVAATVLSINHINSLKVESECKAPGEVAQFVGVREQRVTGIVTFLIIGLSVLATNILGRIPMPVLYGVFLYMGISALGGIQLFDRTLLLFMPMKYQPDTIYIRHVPIRKIHLFTAFQIGCLALLWVIKSIKSTSILFPIMLVVMVAIRKMMEKAFTTTDLKYLDDPMPD 1006          
BLAST of slc4a-2 vs. Ensembl Celegans
Match: abts-1 (Anion exchange protein [Source:UniProtKB/TrEMBL;Acc:B3WFV9])

HSP 1 Score: 657.136 bits (1694), Expect = 0.000e+0
Identity = 377/960 (39.27%), Postives = 548/960 (57.08%), Query Frame = 1
Query:   67 DKDNQRYLFCQLNELEPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHHN--KCGIGSQ----LSLFRSIVDNPNK--------KMKQNPSRKTLCENGNEEDGLLEY-------------------KFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEEL------EMELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPP-NKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWN--NITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKLYVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQ 2820
            +K+N   LF ++ EL  ++ +W E +RWVKFEE VE     WSKPHV  LSL S+   +S I++     +    +I  + + ++        L     EEL+++L   H++ +    K G G +    LS  RSI D            K+++ P      +      G                       K    F KK+P G E +N+L+ E+ FL+ ++C FIRLK ++ +G  TEV +PTRFI ++LG  G      E GR   +L+ D +F   AY A +  DL+  IDEFLD   V+PP EW+PNI+I+PP ++          + L  E  S     K  +EE       +  LK TG+ FGG + D+KRK   ++SDF D+ NLQCLAS  F+YF  LAP +TFGGLL +AT   + AME++   A+ GV+Y  F+GQPLTI+G+TGP+LVFE++VF  C  +   +L FR W+  W  + + ++V +D S LV ++T FTEE FA LI++I+I +A   L ++     +  N++ +++    CSC+PP  K  +S    +H + ++K    P+   F ++      +ID+   N+TD             C   GG++ G TC  LY  D    S +L +GTF +A  LK  RNS   P  VR+ +  FAV+IAI   T +D  +G+NTPKL VPS F PT  +  R W +P    N WW+  LA +PA+LA ILIFMDQQIT +IVNRK NKLKKG GYHLD+ ++++ I +   +G+P +V +TVL++NH+ SLK+ES    PG    F+G REQR+T ++  L IG SV  T +L RIPMPVL+GVF YMG+S L  I +  R  L F+  K +PD  Y++++PI+++HLFTA Q+ CL LL+ IKSI   S+ FPI+++ M  +RK +E  F+  +LK+LD  +P 
Sbjct:   36 EKENTPALFTEMGEL--NNEEWRETARWVKFEEDVEQGGNRWSKPHVATLSLHSLFQLRSCIMNGHFMNDLAETDIPSIFNAVIENLEKSGDLPSENREELREILLRKHVHQYEQAKKNGAGGEKGGFLSTVRSISDIGKSFSHGKNLSKIEEKPEGPVTSQTAGAPSGSSNQLTLPTVESVPKDISSEESSKGNLHFLKKLPAGVEASNVLIGEVDFLTRHICCFIRLKNANQLGDLTEVPVPTRFIFLLLGPTGHGQQYREIGRAIATLMADEIFHDVAYGARDVDDLLDGIDEFLDQVTVLPPGEWDPNIRIEPPSKLPSQEKRKQIGQELLVEPSSHKHVKKVVEEEEIHSHGDDPALKRTGKLFGGLILDIKRKAPHFVSDFTDAFNLQCLASICFMYFGLLAPIVTFGGLLEEATHQRMAAMENLFGGALCGVIYHFFAGQPLTIVGSTGPVLVFETIVFDFCHRFGIVYLSFRFWVHVWTAVIIFLMVVTDASALVSFITRFTEESFATLIAVIFIYEAIMKLVKIKGQLDM-INYSRDFVEGGFCSCVPPIGKPSVSP---DHARLVIKSTGLPI--AFNDT------FIDYTAANLTD-------------CRTIGGSFDGTTCFPLY--DKLLMSILLTVGTFFLATTLKKMRNSCYFPSSVRQLLSDFAVMIAIASMTFVDIFVGVNTPKLNVPSTFRPT--WEGRGWFIPPFDANEWWTAPLAILPALLACILIFMDQQITTVIVNRKENKLKKGCGYHLDLLVLSVSILMVGFLGLPIYVAATVLSINHINSLKVESECKAPGEVAQFVGVREQRVTGIVTFLIIGLSVLATNILGRIPMPVLYGVFLYMGISALGGIQLFDRTLLLFMPMKYQPDTIYIRHVPIRKIHLFTAFQIGCLALLWVIKSIKSTSILFPIMLVVMVAIRKMMEKAFTTTDLKYLDDPMPD 964          
BLAST of slc4a-2 vs. Ensembl Celegans
Match: abts-1 (Anion exchange protein [Source:UniProtKB/TrEMBL;Acc:B3WFV9])

HSP 1 Score: 603.208 bits (1554), Expect = 0.000e+0
Identity = 328/764 (42.93%), Postives = 470/764 (61.52%), Query Frame = 1
Query:  556 RFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEEL------EMELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPP-NKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWN--NITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKLYVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQ 2820
             F KK+P G E +N+L+ E+ FL+ ++C FIRLK ++ +G  TEV +PTRFI ++LG  G      E GR   +L+ D +F   AY A +  DL+  IDEFLD   V+PP EW+PNI+I+PP ++          + L  E  S     K  +EE       +  LK TG+ FGG + D+KRK   ++SDF D+ NLQCLAS  F+YF  LAP +TFGGLL +AT   + AME++   A+ GV+Y  F+GQPLTI+G+TGP+LVFE++VF  C  +   +L FR W+  W  + + ++V +D S LV ++T FTEE FA LI++I+I +A   L ++     +  N++ +++    CSC+PP  K  +S    +H + ++K    P+   F ++      +ID+   N+TD             C   GG++ G TC  LY  D    S +L +GTF +A  LK  RNS   P  VR+ +  FAV+IAI   T +D  +G+NTPKL VPS F PT  +  R W +P    N WW+  LA +PA+LA ILIFMDQQIT +IVNRK NKLKKG GYHLD+ ++++ I +   +G+P +V +TVL++NH+ SLK+ES    PG    F+G REQR+T ++  L IG SV  T +L RIPMPVL+GVF YMG+S L  I +  R  L F+  K +PD  Y++++PI+++HLFTA Q+ CL LL+ IKSI   S+ FPI+++ M  +RK +E  F+  +LK+LD  +P 
Sbjct:  326 HFLKKLPAGVEASNVLIGEVDFLTRHICCFIRLKNANQLGDLTEVPVPTRFIFLLLGPTGHGQQYREIGRAIATLMADEIFHDVAYGARDVDDLLDGIDEFLDQVTVLPPGEWDPNIRIEPPSKLPSQEKRKQIGQELLVEPSSHKHVKKVVEEEEIHSHGDDPALKRTGKLFGGLILDIKRKAPHFVSDFTDAFNLQCLASICFMYFGLLAPIVTFGGLLEEATHQRMAAMENLFGGALCGVIYHFFAGQPLTIVGSTGPVLVFETIVFDFCHRFGIVYLSFRFWVHVWTAVIIFLMVVTDASALVSFITRFTEESFATLIAVIFIYEAIMKLVKIKGQLDM-INYSRDFVEGGFCSCVPPIGKPSVSP---DHARLVIKSTGLPI--AFNDT------FIDYTAANLTD-------------CRTIGGSFDGTTCFPLY--DKLLMSILLTVGTFFLATTLKKMRNSCYFPSSVRQLLSDFAVMIAIASMTFVDIFVGVNTPKLNVPSTFRPT--WEGRGWFIPPFDANEWWTAPLAILPALLACILIFMDQQITTVIVNRKENKLKKGCGYHLDLLVLSVSILMVGFLGLPIYVAATVLSINHINSLKVESECKAPGEVAQFVGVREQRVTGIVTFLIIGLSVLATNILGRIPMPVLYGVFLYMGISALGGIQLFDRTLLLFMPMKYQPDTIYIRHVPIRKIHLFTAFQIGCLALLWVIKSIKSTSILFPIMLVVMVAIRKMMEKAFTTTDLKYLDDPMPD 1060          

HSP 2 Score: 70.0922 bits (170), Expect = 8.797e-12
Identity = 36/111 (32.43%), Postives = 59/111 (53.15%), Query Frame = 1
Query:   67 DKDNQRYLFCQLNELEPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLN 399
            +K+N   LF ++ EL  ++ +W E +RWVKFEE VE     WSKPHV  LSL S+   +S I++     +    +I  + + ++        L     EEL+++L   H++
Sbjct:   78 EKENTPALFTEMGEL--NNEEWRETARWVKFEEDVEQGGNRWSKPHVATLSLHSLFQLRSCIMNGHFMNDLAETDIPSIFNAVIENLEKSGDLPSENREELREILLRKHVH 186          
BLAST of slc4a-2 vs. Ensembl Celegans
Match: abts-4 (Anion/Bicarbonate TranSporter family [Source:UniProtKB/TrEMBL;Acc:H2L0C4])

HSP 1 Score: 221.476 bits (563), Expect = 2.201e-59
Identity = 219/930 (23.55%), Postives = 412/930 (44.30%), Query Frame = 1
Query:  130 WYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLS-----MCHLNPHHNKCGIGSQ------------LSLF-RSIVDNPNK--KMKQNPSRKTLCENGNEEDGLLEYKFCSRFKKKIPLGS-----------EVANILVAEIGFLSENLCLFI--RLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIH--ECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEW-NPN-IKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEELEMELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKLYVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLA-MCFVRKSLECFFSQEELKWLD 2805
            W + SR+ ++EE  E    H  +PHV  + + +    K +   +++    + E++++ ++ +  K +D         E++ +L++     +  + P H +    +Q            + +F RS++  PN    +  +P R+          GL   +F S F  + P+ S           E++ ++  EI  +  N+C FI  R  +++ +          R +  ++G    L N+   + GR   S++ +     +  +      + +AI+ FL   +VI P    N N ++ D  ++++  +    + + +H +D  +        EE E +     R F G   D++ + K Y SD+RD  N+       +++   + PT+TFG ++   T G L   E +++ A+ G+++S+ S QPL ++  TGP LVFE  +FK       DFL  R + G ++    ++  A++ + L+ Y+T +TE+ F  LISLI+  +  +    L E++  N   N  Y +  + +C       +++  D    R   F    ++     + F  L  +  +       ++    F+ +C ++GG +A                    +   ++AY + +F+N  +    +   +G       IF                ++PS   PT    + T  + ++      S+IL F+       LIF++ +I   +  R+  KLKKG G H D+ ++     V+S++G+PW   + V ++ H+ SL  E   + PGV        EQR++ ++  L +G        L  IP   +FGVFFY+GV  L    MI R+ L F+ +K R   K+L+  P   + ++T IQ L    +F  KS  I  + FP+ +++   FV+  L   F +E L+ LD
Sbjct:   88 WKQASRFARYEEDCEGFDNHLGRPHVPCIPMGTYDALKMVTAKSILFPKVQYESLDEFVNFLETKIVDPDVPKLG--EKIAKLINDRIAEIEKMRPLHQRNSSSTQSLDASNPQTISTVGIFPRSLLSAPNNLGSLAHHPMRRL----PTSHSGL---RFGSSFLPQQPVVSQLEPVIWDEDNEISMLVAGEIPHV--NVCRFIAIRFVETTAMEKIFPNMTNVRHLFFLIGP--ALENVTYLDLGRALASVVSNPPATTTFDQLKSPDSITKAIERFLAGTVVIAPGRIDNKNLVRSDLIRKLVNMQGEKTETKIVHPKDVDVERNATKKAEEAEDK---PFRLFSGVTSDLRNRAKHYFSDYRDGFNISIFTVVFYMFCVTVVPTLTFGAIMGAGTSGLLAVKECLVSQALSGLIWSVLSCQPLLVMSPTGPFLVFEKALFKFTDQNDMDFLEVRFYTGIFLFFISIVGAATNCAHLIHYVTIYTEDIFCALISLIFFSEVVE-FIHLQEEH--NSIENLKYYIENAANC------TVTEVKDCALSRPNTFLLQLIMVVVSIAIFHYLRQVSRS-------TFFGRTFRNLCKNFGGIFA--------------------VIAVSIAYRI-LFQNVGVAVVDIPVAVGQSRPFDGIF----------------VIPSA-PPT----ASTLTIALI------SSILLFV-------LIFVETEIPEQMALREGRKLKKGGGLHWDLIVVGFCTLVSSVLGLPWMCPAAVQSLAHITSLT-EYKKSAPGVPSRISHVIEQRVSGMVTYLLLGTFAILGHFLA-IPAATIFGVFFYLGVRNLEGSKMILRLKLCFLPSKYRGSHKFLEIAPFYTIQIYTVIQYLIAGAMFAAKSSKIGGLLFPLFIVSNAIFVKHGLSVIFDKELLEALD 928          
BLAST of slc4a-2 vs. Ensembl Celegans
Match: abts-4 (Anion/Bicarbonate TranSporter family [Source:UniProtKB/TrEMBL;Acc:H2L0C4])

HSP 1 Score: 196.823 bits (499), Expect = 1.684e-51
Identity = 212/929 (22.82%), Postives = 404/929 (43.49%), Query Frame = 1
Query:  130 WYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLS-----MCHLNPHHNKCGIGSQ------------LSLF-RSIVDNPNK--KMKQNPSRKTLCENGNEEDGLLEYKFCSRFKKKIPLGS-----------EVANILVAEIGFLSENLCLFI--RLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIH--ECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEW-NPN-IKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEELEMELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKLYVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLD 2805
            W + SR+ ++EE  E    H  +PHV  + + +    K +   +++    + E++++ ++ +  K +D         E++ +L++     +  + P H +    +Q            + +F RS++  PN    +  +P R+          GL   +F S F  + P+ S           E++ ++  EI  +  N+C FI  R  +++ +          R +  ++G    L N+   + GR   S++ +     +  +      + +AI+ FL   +VI P    N N ++ D  ++++  +    + + +H +D  +        EE E +     R F G   D++ + K Y SD+RD  N+       +++   + PT+TFG ++   T G L   E +++ A+ G+++S+ S QPL ++  TGP LVFE  +FK       DFL  R + G ++    ++  A++ + L+ Y+T +TE+ F  LISLI+  +  +    L E++  N   N  Y +  + +C       +++  D    R   F    ++     + F  L  +  +       ++    F+ +C ++GG +A                    +   ++AY + +F+N  +    +   +G       IF                ++PS   PT    + T  + ++      S+IL F+       LIF++ +I   +  R+  KLKKG G H D+ ++     V+S++G+PW   + V ++ H+ SL  E   + PGV        EQR++ ++  L +G        L  IP   +FGVFFY+GV  L    MI R+ L F+ +K R   K+L+ +        +++++    LLF +            +V    FV+  L   F +E L+ LD
Sbjct:   88 WKQASRFARYEEDCEGFDNHLGRPHVPCIPMGTYDALKMVTAKSILFPKVQYESLDEFVNFLETKIVDPDVPKLG--EKIAKLINDRIAEIEKMRPLHQRNSSSTQSLDASNPQTISTVGIFPRSLLSAPNNLGSLAHHPMRRL----PTSHSGL---RFGSSFLPQQPVVSQLEPVIWDEDNEISMLVAGEIPHV--NVCRFIAIRFVETTAMEKIFPNMTNVRHLFFLIGP--ALENVTYLDLGRALASVVSNPPATTTFDQLKSPDSITKAIERFLAGTVVIAPGRIDNKNLVRSDLIRKLVNMQGEKTETKIVHPKDVDVERNATKKAEEAEDK---PFRLFSGVTSDLRNRAKHYFSDYRDGFNISIFTVVFYMFCVTVVPTLTFGAIMGAGTSGLLAVKECLVSQALSGLIWSVLSCQPLLVMSPTGPFLVFEKALFKFTDQNDMDFLEVRFYTGIFLFFISIVGAATNCAHLIHYVTIYTEDIFCALISLIFFSEVVE-FIHLQEEH--NSIENLKYYIENAANC------TVTEVKDCALSRPNTFLLQLIMVVVSIAIFHYLRQVSRS-------TFFGRTFRNLCKNFGGIFA--------------------VIAVSIAYRI-LFQNVGVAVVDIPVAVGQSRPFDGIF----------------VIPSA-PPT----ASTLTIALI------SSILLFV-------LIFVETEIPEQMALREGRKLKKGGGLHWDLIVVGFCTLVSSVLGLPWMCPAAVQSLAHITSLT-EYKKSAPGVPSRISHVIEQRVSGMVTYLLLGTFAILGHFLA-IPAATIFGVFFYLGVRNLEGSKMILRLKLCFLPSKYRGSHKFLEIV--------SSLKICIGGLLFPL-----------FIVSNAIFVKHGLSVIFDKELLEALD 908          
BLAST of slc4a-2 vs. Ensembl Fly
Match: Ndae1 (gene:FBgn0259111 transcript:FBtr0331660)

HSP 1 Score: 719.153 bits (1855), Expect = 0.000e+0
Identity = 390/920 (42.39%), Postives = 572/920 (62.17%), Query Frame = 1
Query:   88 LFCQLNEL--EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHHNKCGIGSQLSLFRSIVDNPN-----KKMKQNPSRKTLCENGN-EEDGLLEYKFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEELEMELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKLYVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIV-PILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQ 2820
            LF ++  L  E    +W E +RW+KFEE VE     WSKPHV  LSL S+   + ++++  + L+ E +N+E + DL+    +    L    ++++K  L   H   H ++    ++L + RS+ D  N     K M ++PS +++   G+  E    ++K  + F +KIP G+E +NILV E+ FL   L  FIRL Q+ ++G  TEV +PTRF+ I+LG  G+ SN HE GR   +L+ D +F + AY+A +   L+  +DEFLD+  V+PP EW+P I+I+PP   IP +    +  P     + + E+ +  +   E  L  TGR FGG ++D+KRK  +Y+SD++D+L++QC+AS+IFLYFACL+P ITFGGLL +AT  ++ AMES+++  + G+ Y  FSGQPLTILG+TGP+LVFES++++ C    WD++ FR WIG W+    +++ A D S LV Y+T FTEE FA LI+ I+I KA +N+  + +++P+N+           C C PP                              SN S + Y  +N        W++      C  Y GT  G  CG     ++F  S +L  GTF ++  LK F+N+   P  VR+ I  F+V+IAIF  +  D+ +G+ T KL VP++ +PTL  S+R W++ P + KNPWWS I+A  PA+L  ILIFMDQQIT +IVNRK NKLKKG GYHLD+FI++ILI + S++G+PWFV +TVL++NHV SLK+ES  + PG  P FLG REQR+TH++I L IG SV  TP+L  IPMPVLFGVF YMGV+ L  +    RI + F+ AK +PD+ +L+ +PIKRVHLFT IQ+ CL++L+ IKS +  S+ FP++++ M  +RK+L+  F++ ELK LD I+P+
Sbjct:   86 LFSEMGMLVKEGDEIEWKETARWIKFEEDVEEGGNRWSKPHVATLSLHSLFELRRLLVNGSVMLDMEAQNLEVMADLVCDHMVSAGTLPPGVKDKVKDALLRRHR--HQHEYAKKTRLPIIRSLADMRNHSSSKKDMVKSPSNQSMARPGSGTELSEQQHKGNTHFMRKIPPGAEASNILVGEVDFLERTLSCFIRLSQAVVLGDLTEVPVPTRFVFILLGPPGSQSNFHEIGRAMATLMSDEIFHEVAYRARKRDHLLSGVDEFLDAVTVLPPGEWDPTIRIEPPAA-IPSQEVRKR--PPELPKEEVDEEEEEARLREENGLSRTGRLFGGLINDIKRKAPWYISDYKDALSMQCVASWIFLYFACLSPIITFGGLLAEATGKHMAAMESLVSGFVCGMGYGFFSGQPLTILGSTGPVLVFESIIYEFCLKMGWDYMTFRFWIGMWVAGICIVLTAIDASALVCYITRFTEENFATLIAFIFIYKAIENVMVIGKNFPVNQGI-------YDCVCTPPI----------------------------GSNASVIDYAKYN--------WDS------CESYNGTLVGGDCGTPPTENVFLMSVVLCAGTFLISTVLKEFKNALFFPSIVRQYISDFSVLIAIFAMSFFDYSLGVPTQKLEVPNELKPTL--STRGWLIPPFVEKNPWWSAIIAVFPALLGTILIFMDQQITAVIVNRKENKLKKGCGYHLDLFILSILIAICSMMGLPWFVAATVLSINHVNSLKLESECSAPGEKPQFLGVREQRVTHILIFLTIGVSVLLTPLLGNIPMPVLFGVFLYMGVASLKGLQFFDRILIMFMPAKYQPDYMFLRQVPIKRVHLFTMIQLACLIILWLIKSFSQTSILFPLMLVVMIGIRKALDLVFTRRELKILDDIMPE 949          
BLAST of slc4a-2 vs. Ensembl Fly
Match: Ndae1 (gene:FBgn0259111 transcript:FBtr0331659)

HSP 1 Score: 709.138 bits (1829), Expect = 0.000e+0
Identity = 388/939 (41.32%), Postives = 572/939 (60.92%), Query Frame = 1
Query:   88 LFCQLNEL--EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHHNKCGIGSQLSLFRSIVD------------------------NPNKKMKQNPSRKTLCENGN-EEDGLLEYKFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEELEMELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKLYVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIV-PILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQ 2820
            LF ++  L  E    +W E +RW+KFEE VE     WSKPHV  LSL S+   + ++++  + L+ E +N+E + DL+    +    L    ++++K  L   H   H ++    ++L + RS+ D                        +  + M ++PS +++   G+  E    ++K  + F +KIP G+E +NILV E+ FL   L  FIRL Q+ ++G  TEV +PTRF+ I+LG  G+ SN HE GR   +L+ D +F + AY+A +   L+  +DEFLD+  V+PP EW+P I+I+PP   IP +    +  P     + + E+ +  +   E  L  TGR FGG ++D+KRK  +Y+SD++D+L++QC+AS+IFLYFACL+P ITFGGLL +AT  ++ AMES+++  + G+ Y  FSGQPLTILG+TGP+LVFES++++ C    WD++ FR WIG W+    +++ A D S LV Y+T FTEE FA LI+ I+I KA +N+  + +++P+N+           C C PP                              SN S + Y  +N        W++      C  Y GT  G  CG     ++F  S +L  GTF ++  LK F+N+   P  VR+ I  F+V+IAIF  +  D+ +G+ T KL VP++ +PTL  S+R W++ P + KNPWWS I+A  PA+L  ILIFMDQQIT +IVNRK NKLKKG GYHLD+FI++ILI + S++G+PWFV +TVL++NHV SLK+ES  + PG  P FLG REQR+TH++I L IG SV  TP+L  IPMPVLFGVF YMGV+ L  +    RI + F+ AK +PD+ +L+ +PIKRVHLFT IQ+ CL++L+ IKS +  S+ FP++++ M  +RK+L+  F++ ELK LD I+P+
Sbjct:  126 LFSEMGMLVKEGDEIEWKETARWIKFEEDVEEGGNRWSKPHVATLSLHSLFELRRLLVNGSVMLDMEAQNLEVMADLVCDHMVSAGTLPPGVKDKVKDALLRRHR--HQHEYAKKTRLPIIRSLADMRNHSSSKKKKSNSKHSRPAQNLSSITEDMVKSPSNQSMARPGSGTELSEQQHKGNTHFMRKIPPGAEASNILVGEVDFLERTLSCFIRLSQAVVLGDLTEVPVPTRFVFILLGPPGSQSNFHEIGRAMATLMSDEIFHEVAYRARKRDHLLSGVDEFLDAVTVLPPGEWDPTIRIEPPAA-IPSQEVRKR--PPELPKEEVDEEEEEARLREENGLSRTGRLFGGLINDIKRKAPWYISDYKDALSMQCVASWIFLYFACLSPIITFGGLLAEATGKHMAAMESLVSGFVCGMGYGFFSGQPLTILGSTGPVLVFESIIYEFCLKMGWDYMTFRFWIGMWVAGICIVLTAIDASALVCYITRFTEENFATLIAFIFIYKAIENVMVIGKNFPVNQGI-------YDCVCTPPI----------------------------GSNASVIDYAKYN--------WDS------CESYNGTLVGGDCGTPPTENVFLMSVVLCAGTFLISTVLKEFKNALFFPSIVRQYISDFSVLIAIFAMSFFDYSLGVPTQKLEVPNELKPTL--STRGWLIPPFVEKNPWWSAIIAVFPALLGTILIFMDQQITAVIVNRKENKLKKGCGYHLDLFILSILIAICSMMGLPWFVAATVLSINHVNSLKLESECSAPGEKPQFLGVREQRVTHILIFLTIGVSVLLTPLLGNIPMPVLFGVFLYMGVASLKGLQFFDRILIMFMPAKYQPDYMFLRQVPIKRVHLFTMIQLACLIILWLIKSFSQTSILFPLMLVVMIGIRKALDLVFTRRELKILDDIMPE 1008          
BLAST of slc4a-2 vs. Ensembl Fly
Match: Ndae1 (gene:FBgn0259111 transcript:FBtr0299537)

HSP 1 Score: 708.753 bits (1828), Expect = 0.000e+0
Identity = 388/939 (41.32%), Postives = 572/939 (60.92%), Query Frame = 1
Query:   88 LFCQLNEL--EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHHNKCGIGSQLSLFRSIVD------------------------NPNKKMKQNPSRKTLCENGN-EEDGLLEYKFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEELEMELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKLYVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIV-PILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQ 2820
            LF ++  L  E    +W E +RW+KFEE VE     WSKPHV  LSL S+   + ++++  + L+ E +N+E + DL+    +    L    ++++K  L   H   H ++    ++L + RS+ D                        +  + M ++PS +++   G+  E    ++K  + F +KIP G+E +NILV E+ FL   L  FIRL Q+ ++G  TEV +PTRF+ I+LG  G+ SN HE GR   +L+ D +F + AY+A +   L+  +DEFLD+  V+PP EW+P I+I+PP   IP +    +  P     + + E+ +  +   E  L  TGR FGG ++D+KRK  +Y+SD++D+L++QC+AS+IFLYFACL+P ITFGGLL +AT  ++ AMES+++  + G+ Y  FSGQPLTILG+TGP+LVFES++++ C    WD++ FR WIG W+    +++ A D S LV Y+T FTEE FA LI+ I+I KA +N+  + +++P+N+           C C PP                              SN S + Y  +N        W++      C  Y GT  G  CG     ++F  S +L  GTF ++  LK F+N+   P  VR+ I  F+V+IAIF  +  D+ +G+ T KL VP++ +PTL  S+R W++ P + KNPWWS I+A  PA+L  ILIFMDQQIT +IVNRK NKLKKG GYHLD+FI++ILI + S++G+PWFV +TVL++NHV SLK+ES  + PG  P FLG REQR+TH++I L IG SV  TP+L  IPMPVLFGVF YMGV+ L  +    RI + F+ AK +PD+ +L+ +PIKRVHLFT IQ+ CL++L+ IKS +  S+ FP++++ M  +RK+L+  F++ ELK LD I+P+
Sbjct:   70 LFSEMGMLVKEGDEIEWKETARWIKFEEDVEEGGNRWSKPHVATLSLHSLFELRRLLVNGSVMLDMEAQNLEVMADLVCDHMVSAGTLPPGVKDKVKDALLRRHR--HQHEYAKKTRLPIIRSLADMRNHSSSKKKKSNSKHSRPAQNLSSITEDMVKSPSNQSMARPGSGTELSEQQHKGNTHFMRKIPPGAEASNILVGEVDFLERTLSCFIRLSQAVVLGDLTEVPVPTRFVFILLGPPGSQSNFHEIGRAMATLMSDEIFHEVAYRARKRDHLLSGVDEFLDAVTVLPPGEWDPTIRIEPPAA-IPSQEVRKR--PPELPKEEVDEEEEEARLREENGLSRTGRLFGGLINDIKRKAPWYISDYKDALSMQCVASWIFLYFACLSPIITFGGLLAEATGKHMAAMESLVSGFVCGMGYGFFSGQPLTILGSTGPVLVFESIIYEFCLKMGWDYMTFRFWIGMWVAGICIVLTAIDASALVCYITRFTEENFATLIAFIFIYKAIENVMVIGKNFPVNQGI-------YDCVCTPPI----------------------------GSNASVIDYAKYN--------WDS------CESYNGTLVGGDCGTPPTENVFLMSVVLCAGTFLISTVLKEFKNALFFPSIVRQYISDFSVLIAIFAMSFFDYSLGVPTQKLEVPNELKPTL--STRGWLIPPFVEKNPWWSAIIAVFPALLGTILIFMDQQITAVIVNRKENKLKKGCGYHLDLFILSILIAICSMMGLPWFVAATVLSINHVNSLKLESECSAPGEKPQFLGVREQRVTHILIFLTIGVSVLLTPLLGNIPMPVLFGVFLYMGVASLKGLQFFDRILIMFMPAKYQPDYMFLRQVPIKRVHLFTMIQLACLIILWLIKSFSQTSILFPLMLVVMIGIRKALDLVFTRRELKILDDIMPE 952          
BLAST of slc4a-2 vs. Ensembl Fly
Match: Ndae1 (gene:FBgn0259111 transcript:FBtr0299539)

HSP 1 Score: 708.753 bits (1828), Expect = 0.000e+0
Identity = 388/939 (41.32%), Postives = 572/939 (60.92%), Query Frame = 1
Query:   88 LFCQLNEL--EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHHNKCGIGSQLSLFRSIVD------------------------NPNKKMKQNPSRKTLCENGN-EEDGLLEYKFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEELEMELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKLYVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIV-PILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQ 2820
            LF ++  L  E    +W E +RW+KFEE VE     WSKPHV  LSL S+   + ++++  + L+ E +N+E + DL+    +    L    ++++K  L   H   H ++    ++L + RS+ D                        +  + M ++PS +++   G+  E    ++K  + F +KIP G+E +NILV E+ FL   L  FIRL Q+ ++G  TEV +PTRF+ I+LG  G+ SN HE GR   +L+ D +F + AY+A +   L+  +DEFLD+  V+PP EW+P I+I+PP   IP +    +  P     + + E+ +  +   E  L  TGR FGG ++D+KRK  +Y+SD++D+L++QC+AS+IFLYFACL+P ITFGGLL +AT  ++ AMES+++  + G+ Y  FSGQPLTILG+TGP+LVFES++++ C    WD++ FR WIG W+    +++ A D S LV Y+T FTEE FA LI+ I+I KA +N+  + +++P+N+           C C PP                              SN S + Y  +N        W++      C  Y GT  G  CG     ++F  S +L  GTF ++  LK F+N+   P  VR+ I  F+V+IAIF  +  D+ +G+ T KL VP++ +PTL  S+R W++ P + KNPWWS I+A  PA+L  ILIFMDQQIT +IVNRK NKLKKG GYHLD+FI++ILI + S++G+PWFV +TVL++NHV SLK+ES  + PG  P FLG REQR+TH++I L IG SV  TP+L  IPMPVLFGVF YMGV+ L  +    RI + F+ AK +PD+ +L+ +PIKRVHLFT IQ+ CL++L+ IKS +  S+ FP++++ M  +RK+L+  F++ ELK LD I+P+
Sbjct:  139 LFSEMGMLVKEGDEIEWKETARWIKFEEDVEEGGNRWSKPHVATLSLHSLFELRRLLVNGSVMLDMEAQNLEVMADLVCDHMVSAGTLPPGVKDKVKDALLRRHR--HQHEYAKKTRLPIIRSLADMRNHSSSKKKKSNSKHSRPAQNLSSITEDMVKSPSNQSMARPGSGTELSEQQHKGNTHFMRKIPPGAEASNILVGEVDFLERTLSCFIRLSQAVVLGDLTEVPVPTRFVFILLGPPGSQSNFHEIGRAMATLMSDEIFHEVAYRARKRDHLLSGVDEFLDAVTVLPPGEWDPTIRIEPPA-AIPSQEVRKR--PPELPKEEVDEEEEEARLREENGLSRTGRLFGGLINDIKRKAPWYISDYKDALSMQCVASWIFLYFACLSPIITFGGLLAEATGKHMAAMESLVSGFVCGMGYGFFSGQPLTILGSTGPVLVFESIIYEFCLKMGWDYMTFRFWIGMWVAGICIVLTAIDASALVCYITRFTEENFATLIAFIFIYKAIENVMVIGKNFPVNQGI-------YDCVCTPPI----------------------------GSNASVIDYAKYN--------WDS------CESYNGTLVGGDCGTPPTENVFLMSVVLCAGTFLISTVLKEFKNALFFPSIVRQYISDFSVLIAIFAMSFFDYSLGVPTQKLEVPNELKPTL--STRGWLIPPFVEKNPWWSAIIAVFPALLGTILIFMDQQITAVIVNRKENKLKKGCGYHLDLFILSILIAICSMMGLPWFVAATVLSINHVNSLKLESECSAPGEKPQFLGVREQRVTHILIFLTIGVSVLLTPLLGNIPMPVLFGVFLYMGVASLKGLQFFDRILIMFMPAKYQPDYMFLRQVPIKRVHLFTMIQLACLIILWLIKSFSQTSILFPLMLVVMIGIRKALDLVFTRRELKILDDIMPE 1021          
BLAST of slc4a-2 vs. Ensembl Fly
Match: Ndae1 (gene:FBgn0259111 transcript:FBtr0331658)

HSP 1 Score: 708.368 bits (1827), Expect = 0.000e+0
Identity = 388/939 (41.32%), Postives = 572/939 (60.92%), Query Frame = 1
Query:   88 LFCQLNEL--EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHHNKCGIGSQLSLFRSIVD------------------------NPNKKMKQNPSRKTLCENGN-EEDGLLEYKFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEELEMELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKLYVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIV-PILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQ 2820
            LF ++  L  E    +W E +RW+KFEE VE     WSKPHV  LSL S+   + ++++  + L+ E +N+E + DL+    +    L    ++++K  L   H   H ++    ++L + RS+ D                        +  + M ++PS +++   G+  E    ++K  + F +KIP G+E +NILV E+ FL   L  FIRL Q+ ++G  TEV +PTRF+ I+LG  G+ SN HE GR   +L+ D +F + AY+A +   L+  +DEFLD+  V+PP EW+P I+I+PP   IP +    +  P     + + E+ +  +   E  L  TGR FGG ++D+KRK  +Y+SD++D+L++QC+AS+IFLYFACL+P ITFGGLL +AT  ++ AMES+++  + G+ Y  FSGQPLTILG+TGP+LVFES++++ C    WD++ FR WIG W+    +++ A D S LV Y+T FTEE FA LI+ I+I KA +N+  + +++P+N+           C C PP                              SN S + Y  +N        W++      C  Y GT  G  CG     ++F  S +L  GTF ++  LK F+N+   P  VR+ I  F+V+IAIF  +  D+ +G+ T KL VP++ +PTL  S+R W++ P + KNPWWS I+A  PA+L  ILIFMDQQIT +IVNRK NKLKKG GYHLD+FI++ILI + S++G+PWFV +TVL++NHV SLK+ES  + PG  P FLG REQR+TH++I L IG SV  TP+L  IPMPVLFGVF YMGV+ L  +    RI + F+ AK +PD+ +L+ +PIKRVHLFT IQ+ CL++L+ IKS +  S+ FP++++ M  +RK+L+  F++ ELK LD I+P+
Sbjct:  126 LFSEMGMLVKEGDEIEWKETARWIKFEEDVEEGGNRWSKPHVATLSLHSLFELRRLLVNGSVMLDMEAQNLEVMADLVCDHMVSAGTLPPGVKDKVKDALLRRHR--HQHEYAKKTRLPIIRSLADMRNHSSSKKKKSNSKHSRPAQNLSSITEDMVKSPSNQSMARPGSGTELSEQQHKGNTHFMRKIPPGAEASNILVGEVDFLERTLSCFIRLSQAVVLGDLTEVPVPTRFVFILLGPPGSQSNFHEIGRAMATLMSDEIFHEVAYRARKRDHLLSGVDEFLDAVTVLPPGEWDPTIRIEPPA-AIPSQEVRKR--PPELPKEEVDEEEEEARLREENGLSRTGRLFGGLINDIKRKAPWYISDYKDALSMQCVASWIFLYFACLSPIITFGGLLAEATGKHMAAMESLVSGFVCGMGYGFFSGQPLTILGSTGPVLVFESIIYEFCLKMGWDYMTFRFWIGMWVAGICIVLTAIDASALVCYITRFTEENFATLIAFIFIYKAIENVMVIGKNFPVNQGI-------YDCVCTPPI----------------------------GSNASVIDYAKYN--------WDS------CESYNGTLVGGDCGTPPTENVFLMSVVLCAGTFLISTVLKEFKNALFFPSIVRQYISDFSVLIAIFAMSFFDYSLGVPTQKLEVPNELKPTL--STRGWLIPPFVEKNPWWSAIIAVFPALLGTILIFMDQQITAVIVNRKENKLKKGCGYHLDLFILSILIAICSMMGLPWFVAATVLSINHVNSLKLESECSAPGEKPQFLGVREQRVTHILIFLTIGVSVLLTPLLGNIPMPVLFGVFLYMGVASLKGLQFFDRILIMFMPAKYQPDYMFLRQVPIKRVHLFTMIQLACLIILWLIKSFSQTSILFPLMLVVMIGIRKALDLVFTRRELKILDDIMPE 1008          
BLAST of slc4a-2 vs. Ensembl Zebrafish
Match: slc4a8 (solute carrier family 4 member 8 [Source:ZFIN;Acc:ZDB-GENE-131119-88])

HSP 1 Score: 728.783 bits (1880), Expect = 0.000e+0
Identity = 403/954 (42.24%), Postives = 583/954 (61.11%), Query Frame = 1
Query:   52 STENNDKDNQRYLFCQLNEL---EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHHNKCGIGSQLSLFRSIVDNPNKKMK-------------QNPSRKTLCENG-NEEDGLLEY-KFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEM----------IPDRLANNKDEPLHHEDDSISEKYKPTQEELEMELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKL--YVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQN 2823
             TE +++     LF +L+E+   E    +W E +RW+KFEE VE+  E WSKP+V  LSL S+   +S I++  + L+ +  +IE++ DL+L K     +LD S   ++++ L   H   H N     + L + +++ +   +  +             Q P+  T  +NG   E G ++  K  + F KKIP G+E +N+LV E+ FL  ++  F+RL  + ++   TEV +PTRF+ I+LG  G     HE GR   +++ D +F   AYKA +  DL+  IDEFLD   V+PP EW+P+I+I+PPK +          +P+  A   +E LH      +E + P       EL+ TGR FGG + D+KRK  +YLSDF+D L LQC+ASF+FLY AC++P ITFGGLL +AT+G + A+ES+L A++ GV YSLF+GQPLTILG+TGP+LVFE ++FK C  Y   +L  R  IG W     L++VA+D S LV Y+T FTEE FA LI LI+I +A + LF L E YPINR+ + + +    C C  P+    +K+L+   QR                           NIT     W      + C+D  G + G +CG    Y PD+ F+SS+L  GTF M+  LK F+ S   P +VR  I  FAV + I    LID++IG+ + KL VPSKF+PT     R W++  +G+NPWW+ + A IPA+L  ILIFMDQQIT +I+NRK +KL KG GYHLD+ ++ +++ V S++G+PWFV +TVL+++HV SLK+ES ++ PG  P FLG +EQR+T L I L +G SVF T +LQ IPMPVL+GVF YMGVS L  I +  R+ LF + AK +PDF YL+++P+++VHLFT  Q+ CL+LL+ IK  +  ++ FP++VLA+ F+RK L+  FS+ EL +LD ++P+N
Sbjct:  108 GTEEDEEHVAHELFTELDEICVKEGKDAEWKETARWLKFEEDVEDGGERWSKPYVATLSLHSLFELRSCIINGTVLLDMKAGSIEEIADLVLEKQETPHELDDSVRMKVREALLKRHH--HQNDKKRNNLLPMVKTLTEANRRHSETHFMDKTGLATSPQPPTTSTDIKNGATSEIGQMDLSKVDTHFMKKIPTGAEASNVLVGELDFLERSIVAFVRLSPAVLLTGLTEVPIPTRFLFILLGPDGKAQQYHEIGRSMATIMTDEIFHDVAYKAKDRTDLLAGIDEFLDQVTVLPPGEWDPSIRIEPPKCVPSQEKRKMPGVPNGTAVTVEEELH------AEHHGP-------ELQRTGRLFGGLILDLKRKAPYYLSDFKDGLTLQCVASFLFLYCACMSPVITFGGLLGEATEGQISAIESLLGASMTGVAYSLFAGQPLTILGSTGPVLVFEKILFKFCKDYDLSYLSLRTCIGLWTAFLCLLLVATDASSLVCYITRFTEEAFAALICLIFIYEALEKLFYLGELYPINRHSDLDKLTLAYCRCAEPDNPS-NKTLEVWNQR---------------------------NITASAVPWTNLTVTE-CLDLQGQFIGPSCGHHGPYTPDVLFWSSILFFGTFLMSSFLKQFKASRYFPTRVRSMISDFAVFLTIVFMVLIDYIIGVPSQKLQVPSKFKPT--RDDRGWVMNPIGRNPWWTVLAALIPALLCTILIFMDQQITAVIINRKEHKLVKGCGYHLDLLMVGVMLAVCSMLGLPWFVAATVLSISHVNSLKLESESSAPGEQPRFLGIQEQRLTGLFIFLLMGCSVFMTGLLQFIPMPVLYGVFLYMGVSSLKGIQLFDRLKLFGMPAKHQPDFIYLRHVPLRKVHLFTLTQLTCLVLLWVIKH-SPAAIVFPMMVLALVFIRKLLDFCFSKRELSYLDDLMPEN 1014          
BLAST of slc4a-2 vs. Ensembl Zebrafish
Match: slc4a10a (solute carrier family 4 member 10a [Source:ZFIN;Acc:ZDB-GENE-100215-3])

HSP 1 Score: 711.835 bits (1836), Expect = 0.000e+0
Identity = 400/944 (42.37%), Postives = 575/944 (60.91%), Query Frame = 1
Query:   58 ENNDKDNQRYLFCQLNEL---EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHH--NKCGIGSQLSLFRSIVD-----------NPNKKM---KQNPSRKTLCENGNEEDGLLEY-KFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEELEMELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKL--YVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQN 2823
            E++++     LF +L+E+   E    +W E +RW+KFEE VE+  E WSKP+V  LSL S+   +S IL+  + L+    ++E++ D++L    D+ +      EE+++ +    L  HH  N+  + +++ + RS  D           + N +M   +  P        G+ E+  +++ K    F KKIP G+E +NILV E+ FL + +  FIRL  + ++    EV + TRF+ I+LG  G     HE GR   +L+ D VF   AYKA E  DL+  IDEFLD   V+PP EW+P I+I+PPK  +P +    K  PL +    + E+ +        EL+ TGR FGG   D+KRK   YLSD+ D+L+LQCLASF+FLY AC++P ITFGGLL +AT+G + A+ES+  A++ G+ YSLF+GQPLTILG+TGP+LVFE ++FK C  Y   +L  R+ IG W   F L++VA+D S LV Y+T FTEE FA LI +I+I +A + L  L E YP N + + N +   SC C  P                            E SN + L Y +  NIT     W   + K  CV+  G + G+ CG    Y+PD+ F+S +L   T  M+  LK F+ S   P KVR+ I  FAV I I    LID+ +G+ +PKL VP+ F+PT     R WI+  LG NPWW+ I+  IPA+L  ILIFMDQQIT +I+NRK +KLKKG GYHLD+F++ +++GV S++G+PWFV +TVL+++HV SLK+ES  + PG  P FLG REQR T LMI + +G SVF T +L+ IPMPVL+GVF YMG S L  I    R+ LF + AK +PDF YL+++P+++VH+FT IQ+ CL+LL+ IK+ +  ++ FP++VLA+ F+RK L+  FS+ +L WLD ++P++
Sbjct:  115 EDDEEHIPHALFTELDEICLKEGEDAEWKETARWLKFEEDVEDGGERWSKPYVATLSLHSLFELRSCILNGTVMLDMRASSLEEIADMVL----DQHETSGPLGEEVRKKIRNALLKQHHHQNQKKLANRIPIVRSFADIGRKQSEPHSMDKNGQMVSPQTQPINTEGRGEGSRENSAVDFSKIDLHFMKKIPPGAEASNILVGELEFLEKPVVAFIRLSPAVLLNGLAEVPITTRFLFILLGPMGKGPQYHEIGRSIATLMTDEVFHDVAYKAKERSDLVAGIDEFLDQVTVLPPGEWDPTIRIEPPKN-VPSQ-EKRKVPPLANGGADLGEEEE-HGGHGGPELQRTGRIFGGLFLDIKRKAPHYLSDYTDALSLQCLASFLFLYCACMSPVITFGGLLGEATEGRISAIESLFGASMTGIAYSLFAGQPLTILGSTGPVLVFEKILFKFCKEYGLSYLSLRVCIGLWTAFFCLLLVATDASSLVCYITRFTEEAFASLICIIFIYEALEKLIHLGETYPFNMHNDLNKLTQYSCVCTIPK---------------------------EPSN-ATLKYWEEKNITASEIDWLGLDVKG-CVENRGEFVGSACGHHGPYIPDVLFWSVVLFFSTVAMSSFLKEFKTSRYFPTKVRQIISDFAVFITIMTMVLIDYGLGVPSPKLQVPNVFKPT--RDDRGWIISPLGPNPWWTVIVTCIPALLCTILIFMDQQITAVIINRKEHKLKKGCGYHLDLFVVGVMLGVCSVMGLPWFVAATVLSISHVNSLKLESECSAPGEQPKFLGIREQRFTGLMIFVLMGSSVFMTSVLKHIPMPVLYGVFLYMGASSLRGIQFFDRLKLFGMPAKHQPDFIYLRHVPLRKVHMFTIIQLSCLVLLWVIKT-SRAAIVFPMMVLALVFIRKLLDFVFSKRDLSWLDDLMPES 1019          
BLAST of slc4a-2 vs. Ensembl Zebrafish
Match: slc4a10a (solute carrier family 4 member 10a [Source:ZFIN;Acc:ZDB-GENE-100215-3])

HSP 1 Score: 710.679 bits (1833), Expect = 0.000e+0
Identity = 400/944 (42.37%), Postives = 575/944 (60.91%), Query Frame = 1
Query:   58 ENNDKDNQRYLFCQLNEL---EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHH--NKCGIGSQLSLFRSIVD-----------NPNKKM---KQNPSRKTLCENGNEEDGLLEY-KFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEELEMELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKL--YVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQN 2823
            E++++     LF +L+E+   E    +W E +RW+KFEE VE+  E WSKP+V  LSL S+   +S IL+  + L+    ++E++ D++L    D+ +      EE+++ +    L  HH  N+  + +++ + RS  D           + N +M   +  P        G+ E+  +++ K    F KKIP G+E +NILV E+ FL + +  FIRL  + ++    EV + TRF+ I+LG  G     HE GR   +L+ D VF   AYKA E  DL+  IDEFLD   V+PP EW+P I+I+PPK  +P +    K  PL +    + E+ +        EL+ TGR FGG   D+KRK   YLSD+ D+L+LQCLASF+FLY AC++P ITFGGLL +AT+G + A+ES+  A++ G+ YSLF+GQPLTILG+TGP+LVFE ++FK C  Y   +L  R+ IG W   F L++VA+D S LV Y+T FTEE FA LI +I+I +A + L  L E YP N + + N +   SC C  P                            E SN + L Y +  NIT     W   + K  CV+  G + G+ CG    Y+PD+ F+S +L   T  M+  LK F+ S   P KVR+ I  FAV I I    LID+ +G+ +PKL VP+ F+PT     R WI+  LG NPWW+ I+  IPA+L  ILIFMDQQIT +I+NRK +KLKKG GYHLD+F++ +++GV S++G+PWFV +TVL+++HV SLK+ES  + PG  P FLG REQR T LMI + +G SVF T +L+ IPMPVL+GVF YMG S L  I    R+ LF + AK +PDF YL+++P+++VH+FT IQ+ CL+LL+ IK+ +  ++ FP++VLA+ F+RK L+  FS+ +L WLD ++P++
Sbjct:  104 EDDEEHIPHALFTELDEICLKEGEDAEWKETARWLKFEEDVEDGGERWSKPYVATLSLHSLFELRSCILNGTVMLDMRASSLEEIADMVL----DQHETSGPLGEEVRKKIRNALLKQHHHQNQKKLANRIPIVRSFADIGRKQSEPHSMDKNGQMVSPQTQPINTEGRGEGSRENSAVDFSKIDLHFMKKIPPGAEASNILVGELEFLEKPVVAFIRLSPAVLLNGLAEVPITTRFLFILLGPMGKGPQYHEIGRSIATLMTDEVFHDVAYKAKERSDLVAGIDEFLDQVTVLPPGEWDPTIRIEPPKN-VPSQ-EKRKVPPLANGGADLGEEEE-HGGHGGPELQRTGRIFGGLFLDIKRKAPHYLSDYTDALSLQCLASFLFLYCACMSPVITFGGLLGEATEGRISAIESLFGASMTGIAYSLFAGQPLTILGSTGPVLVFEKILFKFCKEYGLSYLSLRVCIGLWTAFFCLLLVATDASSLVCYITRFTEEAFASLICIIFIYEALEKLIHLGETYPFNMHNDLNKLTQYSCVCTIPK---------------------------EPSN-ATLKYWEEKNITASEIDWLGLDVKG-CVENRGEFVGSACGHHGPYIPDVLFWSVVLFFSTVAMSSFLKEFKTSRYFPTKVRQIISDFAVFITIMTMVLIDYGLGVPSPKLQVPNVFKPT--RDDRGWIISPLGPNPWWTVIVTCIPALLCTILIFMDQQITAVIINRKEHKLKKGCGYHLDLFVVGVMLGVCSVMGLPWFVAATVLSISHVNSLKLESECSAPGEQPKFLGIREQRFTGLMIFVLMGSSVFMTSVLKHIPMPVLYGVFLYMGASSLRGIQFFDRLKLFGMPAKHQPDFIYLRHVPLRKVHMFTIIQLSCLVLLWVIKT-SRAAIVFPMMVLALVFIRKLLDFVFSKRDLSWLDDLMPES 1008          
BLAST of slc4a-2 vs. Ensembl Zebrafish
Match: slc4a10a (solute carrier family 4 member 10a [Source:ZFIN;Acc:ZDB-GENE-100215-3])

HSP 1 Score: 710.679 bits (1833), Expect = 0.000e+0
Identity = 400/944 (42.37%), Postives = 575/944 (60.91%), Query Frame = 1
Query:   58 ENNDKDNQRYLFCQLNEL---EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHH--NKCGIGSQLSLFRSIVD-----------NPNKKM---KQNPSRKTLCENGNEEDGLLEY-KFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEELEMELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKL--YVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQN 2823
            E++++     LF +L+E+   E    +W E +RW+KFEE VE+  E WSKP+V  LSL S+   +S IL+  + L+    ++E++ D++L    D+ +      EE+++ +    L  HH  N+  + +++ + RS  D           + N +M   +  P        G+ E+  +++ K    F KKIP G+E +NILV E+ FL + +  FIRL  + ++    EV + TRF+ I+LG  G     HE GR   +L+ D VF   AYKA E  DL+  IDEFLD   V+PP EW+P I+I+PPK  +P +    K  PL +    + E+ +        EL+ TGR FGG   D+KRK   YLSD+ D+L+LQCLASF+FLY AC++P ITFGGLL +AT+G + A+ES+  A++ G+ YSLF+GQPLTILG+TGP+LVFE ++FK C  Y   +L  R+ IG W   F L++VA+D S LV Y+T FTEE FA LI +I+I +A + L  L E YP N + + N +   SC C  P                            E SN + L Y +  NIT     W   + K  CV+  G + G+ CG    Y+PD+ F+S +L   T  M+  LK F+ S   P KVR+ I  FAV I I    LID+ +G+ +PKL VP+ F+PT     R WI+  LG NPWW+ I+  IPA+L  ILIFMDQQIT +I+NRK +KLKKG GYHLD+F++ +++GV S++G+PWFV +TVL+++HV SLK+ES  + PG  P FLG REQR T LMI + +G SVF T +L+ IPMPVL+GVF YMG S L  I    R+ LF + AK +PDF YL+++P+++VH+FT IQ+ CL+LL+ IK+ +  ++ FP++VLA+ F+RK L+  FS+ +L WLD ++P++
Sbjct:  115 EDDEEHIPHALFTELDEICLKEGEDAEWKETARWLKFEEDVEDGGERWSKPYVATLSLHSLFELRSCILNGTVMLDMRASSLEEIADMVL----DQHETSGPLGEEVRKKIRNALLKQHHHQNQKKLANRIPIVRSFADIGRKQSEPHSMDKNGQMVSPQTQPINTEGRGEGSRENSAVDFSKIDLHFMKKIPPGAEASNILVGELEFLEKPVVAFIRLSPAVLLNGLAEVPITTRFLFILLGPMGKGPQYHEIGRSIATLMTDEVFHDVAYKAKERSDLVAGIDEFLDQVTVLPPGEWDPTIRIEPPKN-VPSQ-EKRKVPPLANGGADLGEEEE-HGGHGGPELQRTGRIFGGLFLDIKRKAPHYLSDYTDALSLQCLASFLFLYCACMSPVITFGGLLGEATEGRISAIESLFGASMTGIAYSLFAGQPLTILGSTGPVLVFEKILFKFCKEYGLSYLSLRVCIGLWTAFFCLLLVATDASSLVCYITRFTEEAFASLICIIFIYEALEKLIHLGETYPFNMHNDLNKLTQYSCVCTIPK---------------------------EPSN-ATLKYWEEKNITASEIDWLGLDVKG-CVENRGEFVGSACGHHGPYIPDVLFWSVVLFFSTVAMSSFLKEFKTSRYFPTKVRQIISDFAVFITIMTMVLIDYGLGVPSPKLQVPNVFKPT--RDDRGWIISPLGPNPWWTVIVTCIPALLCTILIFMDQQITAVIINRKEHKLKKGCGYHLDLFVVGVMLGVCSVMGLPWFVAATVLSISHVNSLKLESECSAPGEQPKFLGIREQRFTGLMIFVLMGSSVFMTSVLKHIPMPVLYGVFLYMGASSLRGIQFFDRLKLFGMPAKHQPDFIYLRHVPLRKVHMFTIIQLSCLVLLWVIKT-SRAAIVFPMMVLALVFIRKLLDFVFSKRDLSWLDDLMPES 1019          
BLAST of slc4a-2 vs. Ensembl Zebrafish
Match: slc4a10a (solute carrier family 4 member 10a [Source:ZFIN;Acc:ZDB-GENE-100215-3])

HSP 1 Score: 709.909 bits (1831), Expect = 0.000e+0
Identity = 400/944 (42.37%), Postives = 575/944 (60.91%), Query Frame = 1
Query:   58 ENNDKDNQRYLFCQLNEL---EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHH--NKCGIGSQLSLFRSIVD-----------NPNKKM---KQNPSRKTLCENGNEEDGLLEY-KFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEELEMELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKL--YVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQN 2823
            E++++     LF +L+E+   E    +W E +RW+KFEE VE+  E WSKP+V  LSL S+   +S IL+  + L+    ++E++ D++L    D+ +      EE+++ +    L  HH  N+  + +++ + RS  D           + N +M   +  P        G+ E+  +++ K    F KKIP G+E +NILV E+ FL + +  FIRL  + ++    EV + TRF+ I+LG  G     HE GR   +L+ D VF   AYKA E  DL+  IDEFLD   V+PP EW+P I+I+PPK  +P +    K  PL +    + E+ +        EL+ TGR FGG   D+KRK   YLSD+ D+L+LQCLASF+FLY AC++P ITFGGLL +AT+G + A+ES+  A++ G+ YSLF+GQPLTILG+TGP+LVFE ++FK C  Y   +L  R+ IG W   F L++VA+D S LV Y+T FTEE FA LI +I+I +A + L  L E YP N + + N +   SC C  P                            E SN + L Y +  NIT     W   + K  CV+  G + G+ CG    Y+PD+ F+S +L   T  M+  LK F+ S   P KVR+ I  FAV I I    LID+ +G+ +PKL VP+ F+PT     R WI+  LG NPWW+ I+  IPA+L  ILIFMDQQIT +I+NRK +KLKKG GYHLD+F++ +++GV S++G+PWFV +TVL+++HV SLK+ES  + PG  P FLG REQR T LMI + +G SVF T +L+ IPMPVL+GVF YMG S L  I    R+ LF + AK +PDF YL+++P+++VH+FT IQ+ CL+LL+ IK+ +  ++ FP++VLA+ F+RK L+  FS+ +L WLD ++P++
Sbjct:  115 EDDEEHIPHALFTELDEICLKEGEDAEWKETARWLKFEEDVEDGGERWSKPYVATLSLHSLFELRSCILNGTVMLDMRASSLEEIADMVL----DQHETSGPLGEEVRKKIRNALLKQHHHQNQKKLANRIPIVRSFADIGRKQSEPHSMDKNGQMVSPQTQPINTEGRGEGSRENSAVDFSKIDLHFMKKIPPGAEASNILVGELEFLEKPVVAFIRLSPAVLLNGLAEVPITTRFLFILLGPMGKGPQYHEIGRSIATLMTDEVFHDVAYKAKERSDLVAGIDEFLDQVTVLPPGEWDPTIRIEPPKN-VPSQ-EKRKVPPLANGGADLGEEEE-HGGHGGPELQRTGRIFGGLFLDIKRKAPHYLSDYTDALSLQCLASFLFLYCACMSPVITFGGLLGEATEGRISAIESLFGASMTGIAYSLFAGQPLTILGSTGPVLVFEKILFKFCKEYGLSYLSLRVCIGLWTAFFCLLLVATDASSLVCYITRFTEEAFASLICIIFIYEALEKLIHLGETYPFNMHNDLNKLTQYSCVCTIPK---------------------------EPSN-ATLKYWEEKNITASEIDWLGLDVKG-CVENRGEFVGSACGHHGPYIPDVLFWSVVLFFSTVAMSSFLKEFKTSRYFPTKVRQIISDFAVFITIMTMVLIDYGLGVPSPKLQVPNVFKPT--RDDRGWIISPLGPNPWWTVIVTCIPALLCTILIFMDQQITAVIINRKEHKLKKGCGYHLDLFVVGVMLGVCSVMGLPWFVAATVLSISHVNSLKLESECSAPGEQPKFLGIREQRFTGLMIFVLMGSSVFMTSVLKHIPMPVLYGVFLYMGASSLRGIQFFDRLKLFGMPAKHQPDFIYLRHVPLRKVHMFTIIQLSCLVLLWVIKT-SRAAIVFPMMVLALVFIRKLLDFVFSKRDLSWLDDLMPES 1019          
BLAST of slc4a-2 vs. Ensembl Xenopus
Match: tbx5 (T-box 5 [Source:Xenbase;Acc:XB-GENE-486855])

HSP 1 Score: 727.628 bits (1877), Expect = 0.000e+0
Identity = 404/949 (42.57%), Postives = 574/949 (60.48%), Query Frame = 1
Query:   52 STENNDKDNQRY-LFCQLNEL---EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHH--NKCGIGSQLSLFRSIVDNPNKKMKQNPSRKT-----------LCENGNE---EDGLLEY-KFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEELEM--ELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKL--YVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQN 2823
             TE++D+++  + LF +L+E+   E    +W E +RW+KFEE VE+  E WSKP+V  LSL S+   +S ILH  + L+     +E++ D+IL + +   +L     E+++  +    L  HH  N+  + +++ + RS  D   K+ + +   KT             E+ N+   E+  L+  KF   F KKIP G+E +NILV E+ FL   +  F+RL  + ++   TEV +P+RF+ I+LG  G     HE GR   +L+ D VF   AYKA +  DL+  IDEFLD   V+PP EW+P I+I+PPK +           P     +  +   +P +       EL+ TGR FGG V DVKRK  F+ SDF+D+ +LQCLAS +FLY AC++P ITFGGLL +AT+G + A+ES+  A++ G+ +SLF GQPLTILG+TGP+LVFE ++FK C  Y   +L  R  IG W     + +VA+D S LV Y+T FTEE FA LI +I+I +A + LF L E YPIN N N   +   SC C+ P                            EN +   L Y   +NIT    SWN       C  + G + G  CG    YVPD+ F+S +L   T  M+  LK F+ S   P KVR  +  FAV + I    L+DF IG+ +PKL VP++F+PT     R WIV  LG+NPWW+ + A IP++L  ILIFMDQQIT +I+NRK +KLKKG GYHLD+ ++ I++GV S++G+PWFV +TVL++ HV SLK+ES  + PG  P FLG REQR+T LMI + +G SVF T +LQ IPMPVL+GVF YMG S L  I    RI L+++ AK +PDF YL+++P+++VHLFT IQ+ CL+LL+ IK+ +  ++ FP++VLA+ FVRK ++ FF++ EL WLD ++P++
Sbjct:  103 GTEDDDEEHIPHDLFTELDEICLREGDDAEWREMARWLKFEEDVEDGGERWSKPYVATLSLHSLFELRSCILHGTVLLDMRANTLEEIADMILDQQVASGQLS----EDVRHRVHEALLKQHHHQNQKKLSNRIPIVRSFADIGKKQSEPHSMDKTGQLVSPQSAPSCIEHKNDVSRENSTLDVTKFDLHFMKKIPPGAEASNILVGELEFLDRAIVAFVRLSPAVLLSGLTEVPIPSRFLFILLGPLGKGQQYHEIGRSIATLMTDEVFHDVAYKAKDRNDLVAGIDEFLDQVTVLPPGEWDPTIRIEPPKNVPSQEKRKTPGVP-----NGTAALGEPEEHGGHSGPELERTGRLFGGLVLDVKRKAPFFWSDFKDAFSLQCLASILFLYCACMSPVITFGGLLGEATEGRISAIESLFGASMTGIAFSLFGGQPLTILGSTGPVLVFEKILFKFCKDYDLSYLSLRASIGLWTAFNCIFLVATDASSLVCYITRFTEEAFAALICIIFIYEALEKLFHLGETYPINMNNNLELLTQYSCGCMEP----------------------------ENPSNKTLTYWQSSNITASEISWNNLTV-DACHKFHGDFVGRACGHEGPYVPDVLFWSVILFFATVIMSSTLKQFKTSRYFPTKVRSHVSDFAVFLTILTMVLVDFCIGIPSPKLQVPNEFKPT--RDDRGWIVNPLGRNPWWTVVAAIIPSLLCTILIFMDQQITAVIINRKEHKLKKGCGYHLDLLMVGIMLGVCSVMGLPWFVAATVLSITHVNSLKLESECSAPGEQPKFLGIREQRVTGLMIFVLMGSSVFMTRILQFIPMPVLYGVFLYMGSSSLKGIQFFDRILLYWMPAKHQPDFIYLRHVPLRKVHLFTIIQLSCLILLWVIKA-SRAAIVFPMMVLALVFVRKLMDFFFTKRELSWLDDLMPES 1010          
BLAST of slc4a-2 vs. Ensembl Xenopus
Match: tbx5 (T-box 5 [Source:Xenbase;Acc:XB-GENE-486855])

HSP 1 Score: 727.628 bits (1877), Expect = 0.000e+0
Identity = 404/950 (42.53%), Postives = 574/950 (60.42%), Query Frame = 1
Query:   52 STENNDKDNQRY-LFCQLNEL---EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHH--NKCGIGSQLSLFRSIVDNPNKKMKQNPSRKTL------------CENGNE---EDGLLEY-KFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEELEM--ELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKL--YVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQN 2823
             TE++D+++  + LF +L+E+   E    +W E +RW+KFEE VE+  E WSKP+V  LSL S+   +S ILH  + L+     +E++ D+IL + +   +L     E+++  +    L  HH  N+  + +++ + RS  D   K+ + +   KT              E+ N+   E+  L+  KF   F KKIP G+E +NILV E+ FL   +  F+RL  + ++   TEV +P+RF+ I+LG  G     HE GR   +L+ D VF   AYKA +  DL+  IDEFLD   V+PP EW+P I+I+PPK +           P     +  +   +P +       EL+ TGR FGG V DVKRK  F+ SDF+D+ +LQCLAS +FLY AC++P ITFGGLL +AT+G + A+ES+  A++ G+ +SLF GQPLTILG+TGP+LVFE ++FK C  Y   +L  R  IG W     + +VA+D S LV Y+T FTEE FA LI +I+I +A + LF L E YPIN N N   +   SC C+ P                            EN +   L Y   +NIT    SWN       C  + G + G  CG    YVPD+ F+S +L   T  M+  LK F+ S   P KVR  +  FAV + I    L+DF IG+ +PKL VP++F+PT     R WIV  LG+NPWW+ + A IP++L  ILIFMDQQIT +I+NRK +KLKKG GYHLD+ ++ I++GV S++G+PWFV +TVL++ HV SLK+ES  + PG  P FLG REQR+T LMI + +G SVF T +LQ IPMPVL+GVF YMG S L  I    RI L+++ AK +PDF YL+++P+++VHLFT IQ+ CL+LL+ IK+ +  ++ FP++VLA+ FVRK ++ FF++ EL WLD ++P++
Sbjct:  103 GTEDDDEEHIPHDLFTELDEICLREGDDAEWREMARWLKFEEDVEDGGERWSKPYVATLSLHSLFELRSCILHGTVLLDMRANTLEEIADMILDQQVASGQLS----EDVRHRVHEALLKQHHHQNQKKLSNRIPIVRSFADIGKKQSEPHSMDKTAGQLVSPQSAPSCIEHKNDVSRENSTLDVTKFDLHFMKKIPPGAEASNILVGELEFLDRAIVAFVRLSPAVLLSGLTEVPIPSRFLFILLGPLGKGQQYHEIGRSIATLMTDEVFHDVAYKAKDRNDLVAGIDEFLDQVTVLPPGEWDPTIRIEPPKNVPSQEKRKTPGVP-----NGTAALGEPEEHGGHSGPELERTGRLFGGLVLDVKRKAPFFWSDFKDAFSLQCLASILFLYCACMSPVITFGGLLGEATEGRISAIESLFGASMTGIAFSLFGGQPLTILGSTGPVLVFEKILFKFCKDYDLSYLSLRASIGLWTAFNCIFLVATDASSLVCYITRFTEEAFAALICIIFIYEALEKLFHLGETYPINMNNNLELLTQYSCGCMEP----------------------------ENPSNKTLTYWQSSNITASEISWNNLTV-DACHKFHGDFVGRACGHEGPYVPDVLFWSVILFFATVIMSSTLKQFKTSRYFPTKVRSHVSDFAVFLTILTMVLVDFCIGIPSPKLQVPNEFKPT--RDDRGWIVNPLGRNPWWTVVAAIIPSLLCTILIFMDQQITAVIINRKEHKLKKGCGYHLDLLMVGIMLGVCSVMGLPWFVAATVLSITHVNSLKLESECSAPGEQPKFLGIREQRVTGLMIFVLMGSSVFMTRILQFIPMPVLYGVFLYMGSSSLKGIQFFDRILLYWMPAKHQPDFIYLRHVPLRKVHLFTIIQLSCLILLWVIKA-SRAAIVFPMMVLALVFVRKLMDFFFTKRELSWLDDLMPES 1011          
BLAST of slc4a-2 vs. Ensembl Xenopus
Match: tbx5 (T-box 5 [Source:Xenbase;Acc:XB-GENE-486855])

HSP 1 Score: 727.243 bits (1876), Expect = 0.000e+0
Identity = 404/950 (42.53%), Postives = 574/950 (60.42%), Query Frame = 1
Query:   52 STENNDKDNQRY-LFCQLNEL---EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHH--NKCGIGSQLSLFRSIVDNPNKKMKQNPSRKTL------------CENGNE---EDGLLEY-KFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEELEM--ELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKL--YVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQN 2823
             TE++D+++  + LF +L+E+   E    +W E +RW+KFEE VE+  E WSKP+V  LSL S+   +S ILH  + L+     +E++ D+IL + +   +L     E+++  +    L  HH  N+  + +++ + RS  D   K+ + +   KT              E+ N+   E+  L+  KF   F KKIP G+E +NILV E+ FL   +  F+RL  + ++   TEV +P+RF+ I+LG  G     HE GR   +L+ D VF   AYKA +  DL+  IDEFLD   V+PP EW+P I+I+PPK +           P     +  +   +P +       EL+ TGR FGG V DVKRK  F+ SDF+D+ +LQCLAS +FLY AC++P ITFGGLL +AT+G + A+ES+  A++ G+ +SLF GQPLTILG+TGP+LVFE ++FK C  Y   +L  R  IG W     + +VA+D S LV Y+T FTEE FA LI +I+I +A + LF L E YPIN N N   +   SC C+ P                            EN +   L Y   +NIT    SWN       C  + G + G  CG    YVPD+ F+S +L   T  M+  LK F+ S   P KVR  +  FAV + I    L+DF IG+ +PKL VP++F+PT     R WIV  LG+NPWW+ + A IP++L  ILIFMDQQIT +I+NRK +KLKKG GYHLD+ ++ I++GV S++G+PWFV +TVL++ HV SLK+ES  + PG  P FLG REQR+T LMI + +G SVF T +LQ IPMPVL+GVF YMG S L  I    RI L+++ AK +PDF YL+++P+++VHLFT IQ+ CL+LL+ IK+ +  ++ FP++VLA+ FVRK ++ FF++ EL WLD ++P++
Sbjct:  103 GTEDDDEEHIPHDLFTELDEICLREGDDAEWREMARWLKFEEDVEDGGERWSKPYVATLSLHSLFELRSCILHGTVLLDMRANTLEEIADMILDQQVASGQLS----EDVRHRVHEALLKQHHHQNQKKLSNRIPIVRSFADIGKKQSEPHSMDKTAGQLVSPQSAPSCIEHKNDVSRENSTLDVTKFDLHFMKKIPPGAEASNILVGELEFLDRAIVAFVRLSPAVLLSGLTEVPIPSRFLFILLGPLGKGQQYHEIGRSIATLMTDEVFHDVAYKAKDRNDLVAGIDEFLDQVTVLPPGEWDPTIRIEPPKNVPSQEKRKTPGVP-----NGTAALGEPEEHGGHSGPELERTGRLFGGLVLDVKRKAPFFWSDFKDAFSLQCLASILFLYCACMSPVITFGGLLGEATEGRISAIESLFGASMTGIAFSLFGGQPLTILGSTGPVLVFEKILFKFCKDYDLSYLSLRASIGLWTAFNCIFLVATDASSLVCYITRFTEEAFAALICIIFIYEALEKLFHLGETYPINMNNNLELLTQYSCGCMEP----------------------------ENPSNKTLTYWQSSNITASEISWNNLTV-DACHKFHGDFVGRACGHEGPYVPDVLFWSVILFFATVIMSSTLKQFKTSRYFPTKVRSHVSDFAVFLTILTMVLVDFCIGIPSPKLQVPNEFKPT--RDDRGWIVNPLGRNPWWTVVAAIIPSLLCTILIFMDQQITAVIINRKEHKLKKGCGYHLDLLMVGIMLGVCSVMGLPWFVAATVLSITHVNSLKLESECSAPGEQPKFLGIREQRVTGLMIFVLMGSSVFMTRILQFIPMPVLYGVFLYMGSSSLKGIQFFDRILLYWMPAKHQPDFIYLRHVPLRKVHLFTIIQLSCLILLWVIKA-SRAAIVFPMMVLALVFVRKLMDFFFTKRELSWLDDLMPES 1011          
BLAST of slc4a-2 vs. Ensembl Xenopus
Match: tbx5 (T-box 5 [Source:Xenbase;Acc:XB-GENE-486855])

HSP 1 Score: 726.857 bits (1875), Expect = 0.000e+0
Identity = 404/949 (42.57%), Postives = 574/949 (60.48%), Query Frame = 1
Query:   52 STENNDKDNQRY-LFCQLNEL---EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHH--NKCGIGSQLSLFRSIVDNPNKKMKQNPSRKT-----------LCENGNE---EDGLLEY-KFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEELEM--ELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKL--YVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQN 2823
             TE++D+++  + LF +L+E+   E    +W E +RW+KFEE VE+  E WSKP+V  LSL S+   +S ILH  + L+     +E++ D+IL + +   +L     E+++  +    L  HH  N+  + +++ + RS  D   K+ + +   KT             E+ N+   E+  L+  KF   F KKIP G+E +NILV E+ FL   +  F+RL  + ++   TEV +P+RF+ I+LG  G     HE GR   +L+ D VF   AYKA +  DL+  IDEFLD   V+PP EW+P I+I+PPK +           P     +  +   +P +       EL+ TGR FGG V DVKRK  F+ SDF+D+ +LQCLAS +FLY AC++P ITFGGLL +AT+G + A+ES+  A++ G+ +SLF GQPLTILG+TGP+LVFE ++FK C  Y   +L  R  IG W     + +VA+D S LV Y+T FTEE FA LI +I+I +A + LF L E YPIN N N   +   SC C+ P                            EN +   L Y   +NIT    SWN       C  + G + G  CG    YVPD+ F+S +L   T  M+  LK F+ S   P KVR  +  FAV + I    L+DF IG+ +PKL VP++F+PT     R WIV  LG+NPWW+ + A IP++L  ILIFMDQQIT +I+NRK +KLKKG GYHLD+ ++ I++GV S++G+PWFV +TVL++ HV SLK+ES  + PG  P FLG REQR+T LMI + +G SVF T +LQ IPMPVL+GVF YMG S L  I    RI L+++ AK +PDF YL+++P+++VHLFT IQ+ CL+LL+ IK+ +  ++ FP++VLA+ FVRK ++ FF++ EL WLD ++P++
Sbjct:  103 GTEDDDEEHIPHDLFTELDEICLREGDDAEWREMARWLKFEEDVEDGGERWSKPYVATLSLHSLFELRSCILHGTVLLDMRANTLEEIADMILDQQVASGQL----SEDVRHRVHEALLKQHHHQNQKKLSNRIPIVRSFADIGKKQSEPHSMDKTGQLVSPQSAPSCIEHKNDVSRENSTLDVTKFDLHFMKKIPPGAEASNILVGELEFLDRAIVAFVRLSPAVLLSGLTEVPIPSRFLFILLGPLGKGQQYHEIGRSIATLMTDEVFHDVAYKAKDRNDLVAGIDEFLDQVTVLPPGEWDPTIRIEPPKNVPSQEKRKTPGVP-----NGTAALGEPEEHGGHSGPELERTGRLFGGLVLDVKRKAPFFWSDFKDAFSLQCLASILFLYCACMSPVITFGGLLGEATEGRISAIESLFGASMTGIAFSLFGGQPLTILGSTGPVLVFEKILFKFCKDYDLSYLSLRASIGLWTAFNCIFLVATDASSLVCYITRFTEEAFAALICIIFIYEALEKLFHLGETYPINMNNNLELLTQYSCGCMEP----------------------------ENPSNKTLTYWQSSNITASEISWNNLTV-DACHKFHGDFVGRACGHEGPYVPDVLFWSVILFFATVIMSSTLKQFKTSRYFPTKVRSHVSDFAVFLTILTMVLVDFCIGIPSPKLQVPNEFKPT--RDDRGWIVNPLGRNPWWTVVAAIIPSLLCTILIFMDQQITAVIINRKEHKLKKGCGYHLDLLMVGIMLGVCSVMGLPWFVAATVLSITHVNSLKLESECSAPGEQPKFLGIREQRVTGLMIFVLMGSSVFMTRILQFIPMPVLYGVFLYMGSSSLKGIQFFDRILLYWMPAKHQPDFIYLRHVPLRKVHLFTIIQLSCLILLWVIKA-SRAAIVFPMMVLALVFVRKLMDFFFTKRELSWLDDLMPES 1010          
BLAST of slc4a-2 vs. Ensembl Xenopus
Match: tbx5 (T-box 5 [Source:Xenbase;Acc:XB-GENE-486855])

HSP 1 Score: 726.472 bits (1874), Expect = 0.000e+0
Identity = 404/949 (42.57%), Postives = 574/949 (60.48%), Query Frame = 1
Query:   52 STENNDKDNQRY-LFCQLNEL---EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHH--NKCGIGSQLSLFRSIVDNPNKKMKQNPSRKT-----------LCENGNE---EDGLLEY-KFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEELEM--ELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKL--YVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQN 2823
             TE++D+++  + LF +L+E+   E    +W E +RW+KFEE VE+  E WSKP+V  LSL S+   +S ILH  + L+     +E++ D+IL + +   +L     E+++  +    L  HH  N+  + +++ + RS  D   K+ + +   KT             E+ N+   E+  L+  KF   F KKIP G+E +NILV E+ FL   +  F+RL  + ++   TEV +P+RF+ I+LG  G     HE GR   +L+ D VF   AYKA +  DL+  IDEFLD   V+PP EW+P I+I+PPK +           P     +  +   +P +       EL+ TGR FGG V DVKRK  F+ SDF+D+ +LQCLAS +FLY AC++P ITFGGLL +AT+G + A+ES+  A++ G+ +SLF GQPLTILG+TGP+LVFE ++FK C  Y   +L  R  IG W     + +VA+D S LV Y+T FTEE FA LI +I+I +A + LF L E YPIN N N   +   SC C+ P                            EN +   L Y   +NIT    SWN       C  + G + G  CG    YVPD+ F+S +L   T  M+  LK F+ S   P KVR  +  FAV + I    L+DF IG+ +PKL VP++F+PT     R WIV  LG+NPWW+ + A IP++L  ILIFMDQQIT +I+NRK +KLKKG GYHLD+ ++ I++GV S++G+PWFV +TVL++ HV SLK+ES  + PG  P FLG REQR+T LMI + +G SVF T +LQ IPMPVL+GVF YMG S L  I    RI L+++ AK +PDF YL+++P+++VHLFT IQ+ CL+LL+ IK+ +  ++ FP++VLA+ FVRK ++ FF++ EL WLD ++P++
Sbjct:  103 GTEDDDEEHIPHDLFTELDEICLREGDDAEWREMARWLKFEEDVEDGGERWSKPYVATLSLHSLFELRSCILHGTVLLDMRANTLEEIADMILDQQVASGQL----SEDVRHRVHEALLKQHHHQNQKKLSNRIPIVRSFADIGKKQSEPHSMDKTGQLVSPQSAPSCIEHKNDVSRENSTLDVTKFDLHFMKKIPPGAEASNILVGELEFLDRAIVAFVRLSPAVLLSGLTEVPIPSRFLFILLGPLGKGQQYHEIGRSIATLMTDEVFHDVAYKAKDRNDLVAGIDEFLDQVTVLPPGEWDPTIRIEPPKNVPSQEKRKTPGVP-----NGTAALGEPEEHGGHSGPELERTGRLFGGLVLDVKRKAPFFWSDFKDAFSLQCLASILFLYCACMSPVITFGGLLGEATEGRISAIESLFGASMTGIAFSLFGGQPLTILGSTGPVLVFEKILFKFCKDYDLSYLSLRASIGLWTAFNCIFLVATDASSLVCYITRFTEEAFAALICIIFIYEALEKLFHLGETYPINMNNNLELLTQYSCGCMEP----------------------------ENPSNKTLTYWQSSNITASEISWNNLTV-DACHKFHGDFVGRACGHEGPYVPDVLFWSVILFFATVIMSSTLKQFKTSRYFPTKVRSHVSDFAVFLTILTMVLVDFCIGIPSPKLQVPNEFKPT--RDDRGWIVNPLGRNPWWTVVAAIIPSLLCTILIFMDQQITAVIINRKEHKLKKGCGYHLDLLMVGIMLGVCSVMGLPWFVAATVLSITHVNSLKLESECSAPGEQPKFLGIREQRVTGLMIFVLMGSSVFMTRILQFIPMPVLYGVFLYMGSSSLKGIQFFDRILLYWMPAKHQPDFIYLRHVPLRKVHLFTIIQLSCLILLWVIKA-SRAAIVFPMMVLALVFVRKLMDFFFTKRELSWLDDLMPES 1010          
BLAST of slc4a-2 vs. Ensembl Mouse
Match: Slc4a10 (solute carrier family 4, sodium bicarbonate cotransporter-like, member 10 [Source:MGI Symbol;Acc:MGI:2150150])

HSP 1 Score: 730.324 bits (1884), Expect = 0.000e+0
Identity = 406/946 (42.92%), Postives = 577/946 (60.99%), Query Frame = 1
Query:   52 STENNDKDNQRY-LFCQLNEL---EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHHNKCGIGSQLSLFRSIVDNPNKKMKQN-----------PSRKTLC-ENGNE---EDGLLEY-KFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEELEMELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGK--LYVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQN 2823
             TE++D+++  + LF +L+E+   E    +W E +RW+KFEE VE+  E WSKP+V  LSL S+   +S IL+  + L+     IE++ D++L + +   +L+      + + L   H   H N+  + +++ + RS  D   K+ + N           P     C EN N+   E+  +++ K    F KKIP G+E +NILV E+ FL   +  F+RL  + ++    EV +P+RF+ I+LG  G     HE GR   +L+ D VF   AYKA +  DL+  IDEFLD   V+PP EW+P+I+I+PPK  +P +    +  P      +   + +P       EL+ TGR FGG + D+KRK  F+ SDFRD+ +LQCLASF+FLY AC++P ITFGGLL +AT+G + A+ES+  A++ G+ YSLF GQPLTILG+TGP+LVFE ++FK C  Y   +L  R  IG W     +I+VA+D S LV Y+T FTEE FA LI +I+I +A + LFEL E YPIN + +   +   SC+C+ P+    S S D              L  +  SN S    I W N+T              C    G + G  CG    YVPD+ F+S +L   T TM+  LK F+ S   P KVR  +  FAV + I    LID+ IG+ +PKL VPS F+PT     R W V  LG NPWW+ I A IPA+L  ILIFMDQQIT +I+NRK +KLKKG GYHLD+ ++A+++GV S++G+PWFV +TVL++ HV SLK+ES  + PG  P FLG REQR+T LMI + +G SVF T +L+ IPMPVL+GVF YMG S L  I +  RI LF++ AK +PDF YL+++P+++VHLFT IQ+ CL LL+ IK ++  ++ FP++VLA+ FVRK ++  F++ EL WLD ++P++
Sbjct:  104 GTEDDDEEHLPHDLFTELDEICWREGEDAEWRETARWLKFEEDVEDGGERWSKPYVATLSLHSLFELRSCILNGTVLLDMHANTIEEIADMVLDQQVSSGQLNEDVRHRVHEALMKQHH--HQNQKKLANRIPIVRSFADIGKKQSEPNSMDKNAGQVVSPQSAPACAENKNDVSRENSTVDFSKVDLHFMKKIPPGAEASNILVGELEFLDRTVVAFVRLSPAVLLQGLAEVPIPSRFLFILLGPLGKGQQYHEIGRSIATLMTDEVFHDVAYKAKDRNDLVSGIDEFLDQVTVLPPGEWDPSIRIEPPKN-VPSQ--EKRKIPAVPNGTAAHGEAEPHGGHSGPELQRTGRIFGGLILDIKRKAPFFWSDFRDAFSLQCLASFLFLYCACMSPVITFGGLLGEATEGRISAIESLFGASMTGIAYSLFGGQPLTILGSTGPVLVFEKILFKFCKEYGLSYLSLRASIGLWTATLCIILVATDASSLVCYITRFTEEAFASLICIIFIYEALEKLFELSETYPINMHNDLELLTQYSCNCMEPH----SPSND-------------TLKEWRESNLSASDII-WGNLT-----------VSECRSLHGEYVGRACGHGHPYVPDVLFWSVILFFSTVTMSATLKQFKTSRYFPTKVRSIVSDFAVFLTILCMVLIDYAIGIPSPKLQVPSVFKPT--RDDRGWFVTPLGPNPWWTIIAAIIPALLCTILIFMDQQITAVIINRKEHKLKKGCGYHLDLLMVAVMLGVCSIMGLPWFVAATVLSITHVNSLKLESECSAPGEQPKFLGIREQRVTGLMIFILMGSSVFMTSILKFIPMPVLYGVFLYMGASSLKGIQLFDRIKLFWMPAKHQPDFIYLRHVPLRKVHLFTVIQMSCLGLLWIIK-VSRAAIVFPMMVLALVFVRKLMDFLFTKRELSWLDDLMPES 1012          
BLAST of slc4a-2 vs. Ensembl Mouse
Match: Slc4a10 (solute carrier family 4, sodium bicarbonate cotransporter-like, member 10 [Source:MGI Symbol;Acc:MGI:2150150])

HSP 1 Score: 729.554 bits (1882), Expect = 0.000e+0
Identity = 406/946 (42.92%), Postives = 577/946 (60.99%), Query Frame = 1
Query:   52 STENNDKDNQRY-LFCQLNEL---EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHHNKCGIGSQLSLFRSIVDNPNKKMKQN-----------PSRKTLC-ENGNE---EDGLLEY-KFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEELEMELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGK--LYVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQN 2823
             TE++D+++  + LF +L+E+   E    +W E +RW+KFEE VE+  E WSKP+V  LSL S+   +S IL+  + L+     IE++ D++L + +   +L+      + + L   H   H N+  + +++ + RS  D   K+ + N           P     C EN N+   E+  +++ K    F KKIP G+E +NILV E+ FL   +  F+RL  + ++    EV +P+RF+ I+LG  G     HE GR   +L+ D VF   AYKA +  DL+  IDEFLD   V+PP EW+P+I+I+PPK  +P +    +  P      +   + +P       EL+ TGR FGG + D+KRK  F+ SDFRD+ +LQCLASF+FLY AC++P ITFGGLL +AT+G + A+ES+  A++ G+ YSLF GQPLTILG+TGP+LVFE ++FK C  Y   +L  R  IG W     +I+VA+D S LV Y+T FTEE FA LI +I+I +A + LFEL E YPIN + +   +   SC+C+ P+    S S D              L  +  SN S    I W N+T              C    G + G  CG    YVPD+ F+S +L   T TM+  LK F+ S   P KVR  +  FAV + I    LID+ IG+ +PKL VPS F+PT     R W V  LG NPWW+ I A IPA+L  ILIFMDQQIT +I+NRK +KLKKG GYHLD+ ++A+++GV S++G+PWFV +TVL++ HV SLK+ES  + PG  P FLG REQR+T LMI + +G SVF T +L+ IPMPVL+GVF YMG S L  I +  RI LF++ AK +PDF YL+++P+++VHLFT IQ+ CL LL+ IK ++  ++ FP++VLA+ FVRK ++  F++ EL WLD ++P++
Sbjct:  104 GTEDDDEEHLPHDLFTELDEICWREGEDAEWRETARWLKFEEDVEDGGERWSKPYVATLSLHSLFELRSCILNGTVLLDMHANTIEEIADMVLDQQVSSGQLNEDVRHRVHEALMKQH--HHQNQKKLANRIPIVRSFADIGKKQSEPNSMDKNAGQVVSPQSAPACAENKNDVSRENSTVDFSKVDLHFMKKIPPGAEASNILVGELEFLDRTVVAFVRLSPAVLLQGLAEVPIPSRFLFILLGPLGKGQQYHEIGRSIATLMTDEVFHDVAYKAKDRNDLVSGIDEFLDQVTVLPPGEWDPSIRIEPPKN-VPSQ--EKRKIPAVPNGTAAHGEAEPHGGHSGPELQRTGRIFGGLILDIKRKAPFFWSDFRDAFSLQCLASFLFLYCACMSPVITFGGLLGEATEGRISAIESLFGASMTGIAYSLFGGQPLTILGSTGPVLVFEKILFKFCKEYGLSYLSLRASIGLWTATLCIILVATDASSLVCYITRFTEEAFASLICIIFIYEALEKLFELSETYPINMHNDLELLTQYSCNCMEPH----SPSND-------------TLKEWRESNLSASDII-WGNLT-----------VSECRSLHGEYVGRACGHGHPYVPDVLFWSVILFFSTVTMSATLKQFKTSRYFPTKVRSIVSDFAVFLTILCMVLIDYAIGIPSPKLQVPSVFKPT--RDDRGWFVTPLGPNPWWTIIAAIIPALLCTILIFMDQQITAVIINRKEHKLKKGCGYHLDLLMVAVMLGVCSIMGLPWFVAATVLSITHVNSLKLESECSAPGEQPKFLGIREQRVTGLMIFILMGSSVFMTSILKFIPMPVLYGVFLYMGASSLKGIQLFDRIKLFWMPAKHQPDFIYLRHVPLRKVHLFTVIQMSCLGLLWIIK-VSRAAIVFPMMVLALVFVRKLMDFLFTKRELSWLDDLMPES 1012          
BLAST of slc4a-2 vs. Ensembl Mouse
Match: Slc4a10 (solute carrier family 4, sodium bicarbonate cotransporter-like, member 10 [Source:MGI Symbol;Acc:MGI:2150150])

HSP 1 Score: 717.227 bits (1850), Expect = 0.000e+0
Identity = 406/976 (41.60%), Postives = 577/976 (59.12%), Query Frame = 1
Query:   52 STENNDKDNQRY-LFCQLNEL---EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHHNKCGIGSQLSLFRSIVDNPNKKMKQN-----------PSRKTLC-ENGNE---EDGLLEYKF------------CS-------------------RFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEELEMELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGK--LYVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQN 2823
             TE++D+++  + LF +L+E+   E    +W E +RW+KFEE VE+  E WSKP+V  LSL S+   +S IL+  + L+     IE++ D++L + +   +L+      + + L   H   H N+  + +++ + RS  D   K+ + N           P     C EN N+   E+  +++              C                     F KKIP G+E +NILV E+ FL   +  F+RL  + ++    EV +P+RF+ I+LG  G     HE GR   +L+ D VF   AYKA +  DL+  IDEFLD   V+PP EW+P+I+I+PPK  +P +    +  P      +   + +P       EL+ TGR FGG + D+KRK  F+ SDFRD+ +LQCLASF+FLY AC++P ITFGGLL +AT+G + A+ES+  A++ G+ YSLF GQPLTILG+TGP+LVFE ++FK C  Y   +L  R  IG W     +I+VA+D S LV Y+T FTEE FA LI +I+I +A + LFEL E YPIN + +   +   SC+C+ P+    S S D              L  +  SN S    I W N+T              C    G + G  CG    YVPD+ F+S +L   T TM+  LK F+ S   P KVR  +  FAV + I    LID+ IG+ +PKL VPS F+PT     R W V  LG NPWW+ I A IPA+L  ILIFMDQQIT +I+NRK +KLKKG GYHLD+ ++A+++GV S++G+PWFV +TVL++ HV SLK+ES  + PG  P FLG REQR+T LMI + +G SVF T +L+ IPMPVL+GVF YMG S L  I +  RI LF++ AK +PDF YL+++P+++VHLFT IQ+ CL LL+ IK ++  ++ FP++VLA+ FVRK ++  F++ EL WLD ++P++
Sbjct:  104 GTEDDDEEHLPHDLFTELDEICWREGEDAEWRETARWLKFEEDVEDGGERWSKPYVATLSLHSLFELRSCILNGTVLLDMHANTIEEIADMVLDQQVSSGQLNEDVRHRVHEALMKQHH--HQNQKKLANRIPIVRSFADIGKKQSEPNSMDKNAGQVVSPQSAPACAENKNDVSRENSTVDFSKGLGGQQKGHTSPCGMKQRLDKGPPHQQEREVDLHFMKKIPPGAEASNILVGELEFLDRTVVAFVRLSPAVLLQGLAEVPIPSRFLFILLGPLGKGQQYHEIGRSIATLMTDEVFHDVAYKAKDRNDLVSGIDEFLDQVTVLPPGEWDPSIRIEPPKN-VPSQ--EKRKIPAVPNGTAAHGEAEPHGGHSGPELQRTGRIFGGLILDIKRKAPFFWSDFRDAFSLQCLASFLFLYCACMSPVITFGGLLGEATEGRISAIESLFGASMTGIAYSLFGGQPLTILGSTGPVLVFEKILFKFCKEYGLSYLSLRASIGLWTATLCIILVATDASSLVCYITRFTEEAFASLICIIFIYEALEKLFELSETYPINMHNDLELLTQYSCNCMEPH----SPSND-------------TLKEWRESNLSASDII-WGNLT-----------VSECRSLHGEYVGRACGHGHPYVPDVLFWSVILFFSTVTMSATLKQFKTSRYFPTKVRSIVSDFAVFLTILCMVLIDYAIGIPSPKLQVPSVFKPT--RDDRGWFVTPLGPNPWWTIIAAIIPALLCTILIFMDQQITAVIINRKEHKLKKGCGYHLDLLMVAVMLGVCSIMGLPWFVAATVLSITHVNSLKLESECSAPGEQPKFLGIREQRVTGLMIFILMGSSVFMTSILKFIPMPVLYGVFLYMGASSLKGIQLFDRIKLFWMPAKHQPDFIYLRHVPLRKVHLFTVIQMSCLGLLWIIK-VSRAAIVFPMMVLALVFVRKLMDFLFTKRELSWLDDLMPES 1042          
BLAST of slc4a-2 vs. Ensembl Mouse
Match: Slc4a4 (solute carrier family 4 (anion exchanger), member 4 [Source:MGI Symbol;Acc:MGI:1927555])

HSP 1 Score: 712.99 bits (1839), Expect = 0.000e+0
Identity = 385/937 (41.09%), Postives = 567/937 (60.51%), Query Frame = 1
Query:   58 ENNDKDNQRYLFCQLNEL---EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHHNK---------CGIGSQLSLFRSIVDNPNKKMKQNPSRKTLCENGNE-EDGLLEYKFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEM-IPDRLAN--NKDEPLHHEDDSISEKYKPTQEELEME-LKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKLYVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILP 2817
            E +D      LF +L+EL   +    +W E +RW+KFEE VE   E WSKPHV  LSL S+   ++ +    I L+ E  ++  ++++I    I+   L    + +LK  ++   L  H ++           IG  +S    +  NP+        R     + N+  D   + +  ++F KK+P  +E +N+LV E+ FL      F+RL+Q+ ++GA TEV +PTRF+ I+LG KG   + HE GR   +L+ D VF   AYKA +  DLI  IDEFLD  +V+PP EW+P I+I+PPK +   D+  N  +  E +    D+  +         + E L+ TGRF GG + D+KRK  F+ SDF D+LN+Q L++ +F+Y A +   ITFGGLL  ATD   G +ES L  A+ G ++ LF+GQPLTIL +TGP+LVFE ++F     + +D+L FR+WIG W     L++VA+D S LV+Y T FTEE F+ LIS I+I  AF+ + +L + YPIN ++   Y  + SC+C+PP+   LS S D           P  LP   +++    +  DW      Y S      K+ CV YGG   GN C   +VPDI   S +L +GT+T +  +K F+ S   P   R+ I  FA++++I +F +ID ++G++TPKLIVPS+F+PT    +R W VP  G NPWW  + A IPA+L  ILIFMDQQIT +IVNRK +KLKKG GYHLD+F +AIL+ V S + +PW+V +TV+++ H+ SLK+E+  + PG  P FLG REQR+T  ++ +  G SVF  P+L+ IPMPVL+GVF YMGV+ L+ +  + R+ L  +  K +PDF YL+++P++RVHLFT +QVLCL LL+ +KS  + ++ FP+++LA+  VRK ++  FSQ +L +LD ++P
Sbjct:   98 EEDDSPAPPQLFTELDELLAVDGQEMEWKETARWIKFEEKVEQGGERWSKPHVATLSLHSLFELRTCMEKGSIMLDREASSLPQLVEMIADHQIETGLL----KPDLKDKVTYTLLRKHRHQTKKSNLRSLADIGKTVSSASRMFSNPDNGSPAMTHRNLTSSSLNDISDKPEKDQLKNKFMKKLPRDAEASNVLVGEVDFLDTPFIAFVRLQQAVMLGALTEVPVPTRFLFILLGPKGKAKSYHEIGRAIATLMSDEVFHDIAYKAKDRHDLIAGIDEFLDEVIVLPPGEWDPTIRIEPPKSLPSSDKRKNMYSGGENVQMNGDTPHDGGHGGGGHGDCEELQRTGRFCGGLIKDIKRKAPFFASDFYDALNIQALSAILFIYLATVTNAITFGGLLGDATDNMQGVLESFLGTAVSGAIFCLFAGQPLTILSSTGPVLVFERLLFNFSKDHNFDYLEFRLWIGLWSAFMCLVLVATDASFLVQYFTRFTEEGFSSLISFIFIYDAFKKMIKLADYYPINSDFKVGYNTHFSCACLPPDPVNLSVSNDTTLA-------PEDLPTISSTDMYHNVTFDW-----AYLS------KKECVKYGGKLVGNNCD--FVPDITLMSFILFLGTYTSSMAMKKFKTSRYFPTTARKLISDFAIILSILIFCVIDALVGVDTPKLIVPSEFKPT--SPNRGWFVPPFGGNPWWVCLAAAIPALLVTILIFMDQQITAVIVNRKEHKLKKGAGYHLDLFWVAILMVVCSFMALPWYVAATVISIAHIDSLKMETETSAPGEQPKFLGVREQRVTGTLVFILTGLSVFMAPILKFIPMPVLYGVFLYMGVASLNGVQFMDRLKLLLMPLKHQPDFIYLRHVPLRRVHLFTFLQVLCLALLWILKS-TVAAIIFPVMILALVAVRKGMDYLFSQHDLSFLDDVIP 1007          
BLAST of slc4a-2 vs. Ensembl Mouse
Match: Slc4a4 (solute carrier family 4 (anion exchanger), member 4 [Source:MGI Symbol;Acc:MGI:1927555])

HSP 1 Score: 712.22 bits (1837), Expect = 0.000e+0
Identity = 385/937 (41.09%), Postives = 567/937 (60.51%), Query Frame = 1
Query:   58 ENNDKDNQRYLFCQLNEL---EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHHNK---------CGIGSQLSLFRSIVDNPNKKMKQNPSRKTLCENGNE-EDGLLEYKFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEM-IPDRLAN--NKDEPLHHEDDSISEKYKPTQEELEME-LKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKLYVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILP 2817
            E +D      LF +L+EL   +    +W E +RW+KFEE VE   E WSKPHV  LSL S+   ++ +    I L+ E  ++  ++++I    I+   L    + +LK  ++   L  H ++           IG  +S    +  NP+        R     + N+  D   + +  ++F KK+P  +E +N+LV E+ FL      F+RL+Q+ ++GA TEV +PTRF+ I+LG KG   + HE GR   +L+ D VF   AYKA +  DLI  IDEFLD  +V+PP EW+P I+I+PPK +   D+  N  +  E +    D+  +         + E L+ TGRF GG + D+KRK  F+ SDF D+LN+Q L++ +F+Y A +   ITFGGLL  ATD   G +ES L  A+ G ++ LF+GQPLTIL +TGP+LVFE ++F     + +D+L FR+WIG W     L++VA+D S LV+Y T FTEE F+ LIS I+I  AF+ + +L + YPIN ++   Y  + SC+C+PP+   LS S D           P  LP   +++    +  DW      Y S      K+ CV YGG   GN C   +VPDI   S +L +GT+T +  +K F+ S   P   R+ I  FA++++I +F +ID ++G++TPKLIVPS+F+PT    +R W VP  G NPWW  + A IPA+L  ILIFMDQQIT +IVNRK +KLKKG GYHLD+F +AIL+ V S + +PW+V +TV+++ H+ SLK+E+  + PG  P FLG REQR+T  ++ +  G SVF  P+L+ IPMPVL+GVF YMGV+ L+ +  + R+ L  +  K +PDF YL+++P++RVHLFT +QVLCL LL+ +KS  + ++ FP+++LA+  VRK ++  FSQ +L +LD ++P
Sbjct:   54 EEDDSPAPPQLFTELDELLAVDGQEMEWKETARWIKFEEKVEQGGERWSKPHVATLSLHSLFELRTCMEKGSIMLDREASSLPQLVEMIADHQIETGLL----KPDLKDKVTYTLLRKHRHQTKKSNLRSLADIGKTVSSASRMFSNPDNGSPAMTHRNLTSSSLNDISDKPEKDQLKNKFMKKLPRDAEASNVLVGEVDFLDTPFIAFVRLQQAVMLGALTEVPVPTRFLFILLGPKGKAKSYHEIGRAIATLMSDEVFHDIAYKAKDRHDLIAGIDEFLDEVIVLPPGEWDPTIRIEPPKSLPSSDKRKNMYSGGENVQMNGDTPHDGGHGGGGHGDCEELQRTGRFCGGLIKDIKRKAPFFASDFYDALNIQALSAILFIYLATVTNAITFGGLLGDATDNMQGVLESFLGTAVSGAIFCLFAGQPLTILSSTGPVLVFERLLFNFSKDHNFDYLEFRLWIGLWSAFMCLVLVATDASFLVQYFTRFTEEGFSSLISFIFIYDAFKKMIKLADYYPINSDFKVGYNTHFSCACLPPDPVNLSVSNDTTLA-------PEDLPTISSTDMYHNVTFDW-----AYLS------KKECVKYGGKLVGNNCD--FVPDITLMSFILFLGTYTSSMAMKKFKTSRYFPTTARKLISDFAIILSILIFCVIDALVGVDTPKLIVPSEFKPT--SPNRGWFVPPFGGNPWWVCLAAAIPALLVTILIFMDQQITAVIVNRKEHKLKKGAGYHLDLFWVAILMVVCSFMALPWYVAATVISIAHIDSLKMETETSAPGEQPKFLGVREQRVTGTLVFILTGLSVFMAPILKFIPMPVLYGVFLYMGVASLNGVQFMDRLKLLLMPLKHQPDFIYLRHVPLRRVHLFTFLQVLCLALLWILKS-TVAAIIFPVMILALVAVRKGMDYLFSQHDLSFLDDVIP 963          
BLAST of slc4a-2 vs. UniProt/SwissProt
Match: sp|Q5DTL9|S4A10_MOUSE (Sodium-driven chloride bicarbonate exchanger OS=Mus musculus OX=10090 GN=Slc4a10 PE=1 SV=2)

HSP 1 Score: 717.227 bits (1850), Expect = 0.000e+0
Identity = 406/976 (41.60%), Postives = 577/976 (59.12%), Query Frame = 1
Query:   52 STENNDKDNQRY-LFCQLNEL---EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHHNKCGIGSQLSLFRSIVDNPNKKMKQN-----------PSRKTLC-ENGNE---EDGLLEYKF------------CS-------------------RFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEELEMELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGK--LYVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQN 2823
             TE++D+++  + LF +L+E+   E    +W E +RW+KFEE VE+  E WSKP+V  LSL S+   +S IL+  + L+     IE++ D++L + +   +L+      + + L   H   H N+  + +++ + RS  D   K+ + N           P     C EN N+   E+  +++              C                     F KKIP G+E +NILV E+ FL   +  F+RL  + ++    EV +P+RF+ I+LG  G     HE GR   +L+ D VF   AYKA +  DL+  IDEFLD   V+PP EW+P+I+I+PPK  +P +    +  P      +   + +P       EL+ TGR FGG + D+KRK  F+ SDFRD+ +LQCLASF+FLY AC++P ITFGGLL +AT+G + A+ES+  A++ G+ YSLF GQPLTILG+TGP+LVFE ++FK C  Y   +L  R  IG W     +I+VA+D S LV Y+T FTEE FA LI +I+I +A + LFEL E YPIN + +   +   SC+C+ P+    S S D              L  +  SN S    I W N+T              C    G + G  CG    YVPD+ F+S +L   T TM+  LK F+ S   P KVR  +  FAV + I    LID+ IG+ +PKL VPS F+PT     R W V  LG NPWW+ I A IPA+L  ILIFMDQQIT +I+NRK +KLKKG GYHLD+ ++A+++GV S++G+PWFV +TVL++ HV SLK+ES  + PG  P FLG REQR+T LMI + +G SVF T +L+ IPMPVL+GVF YMG S L  I +  RI LF++ AK +PDF YL+++P+++VHLFT IQ+ CL LL+ IK ++  ++ FP++VLA+ FVRK ++  F++ EL WLD ++P++
Sbjct:  104 GTEDDDEEHLPHDLFTELDEICWREGEDAEWRETARWLKFEEDVEDGGERWSKPYVATLSLHSLFELRSCILNGTVLLDMHANTIEEIADMVLDQQVSSGQLNEDVRHRVHEALMKQHH--HQNQKKLANRIPIVRSFADIGKKQSEPNSMDKNAGQVVSPQSAPACAENKNDVSRENSTVDFSKGLGGQQKGHTSPCGMKQRLDKGPPHQQEREVDLHFMKKIPPGAEASNILVGELEFLDRTVVAFVRLSPAVLLQGLAEVPIPSRFLFILLGPLGKGQQYHEIGRSIATLMTDEVFHDVAYKAKDRNDLVSGIDEFLDQVTVLPPGEWDPSIRIEPPKN-VPSQ--EKRKIPAVPNGTAAHGEAEPHGGHSGPELQRTGRIFGGLILDIKRKAPFFWSDFRDAFSLQCLASFLFLYCACMSPVITFGGLLGEATEGRISAIESLFGASMTGIAYSLFGGQPLTILGSTGPVLVFEKILFKFCKEYGLSYLSLRASIGLWTATLCIILVATDASSLVCYITRFTEEAFASLICIIFIYEALEKLFELSETYPINMHNDLELLTQYSCNCMEPH----SPSND-------------TLKEWRESNLSASDII-WGNLT-----------VSECRSLHGEYVGRACGHGHPYVPDVLFWSVILFFSTVTMSATLKQFKTSRYFPTKVRSIVSDFAVFLTILCMVLIDYAIGIPSPKLQVPSVFKPT--RDDRGWFVTPLGPNPWWTIIAAIIPALLCTILIFMDQQITAVIINRKEHKLKKGCGYHLDLLMVAVMLGVCSIMGLPWFVAATVLSITHVNSLKLESECSAPGEQPKFLGIREQRVTGLMIFILMGSSVFMTSILKFIPMPVLYGVFLYMGASSLKGIQLFDRIKLFWMPAKHQPDFIYLRHVPLRKVHLFTVIQMSCLGLLWIIK-VSRAAIVFPMMVLALVFVRKLMDFLFTKRELSWLDDLMPES 1042          
BLAST of slc4a-2 vs. UniProt/SwissProt
Match: sp|Q9GL77|S4A4_BOVIN (Electrogenic sodium bicarbonate cotransporter 1 OS=Bos taurus OX=9913 GN=SLC4A4 PE=1 SV=1)

HSP 1 Score: 713.375 bits (1840), Expect = 0.000e+0
Identity = 386/937 (41.20%), Postives = 564/937 (60.19%), Query Frame = 1
Query:   58 ENNDKDNQRYLFCQLNEL---EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHHNK---------CGIGSQLSLFRSIVDNPNKKMKQNPSRKTLCENGNE-EDGLLEYKFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEM-IPDRLAN--NKDEPLHHEDDSISEKYKPTQEELEME-LKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKLYVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILP 2817
            E +D      LF +L+EL   +    +W E +RW+KFEE VE   E WSKPHV  LSL S+   ++ +    I L+ E  ++  ++++I+   I+   L    + +LK  ++   L  H ++           IG  +S    +  NP+        R     + N+  D   + +  ++F KK+P  +E +N+LV E+ FL      F+RL+Q+ ++GA TEV +PTRF+ I+LG KG   + HE GR   +L+ D VF   AYKA + +DLI  IDEFLD  +V+PP EW+P I+I+PPK +   D+  N  +  E +    D+  +         + E L+ TGRF GG + D+KRK  F+ SDF D+LN+Q L++ +F+Y A +   ITFGGLL  ATD   G +ES L  A+ G ++ LF+GQPLTIL +TGP+LVFE ++F     + +D+L FR+WIG W     LI+VA+D S LV+Y T FTEE F+ LIS I+I  AF+ + +L + YPIN N+   Y    SC C+PP+   +S S D           P  LP   +SN       DW  +T            + C+ YGG   GN CG  +VPDI   S +L +GT+T +  LK F+ S   P   R+ I  FA+++ I +F +ID ++G++TPKLIVPS+F+PT    +R W V   G NPWW  + A IPA+L  ILIFMDQQIT +IVNRK +KLKKG GYHLD+F +AIL+ V S + +PW+V +TV+++ H+ SLK+E+  + PG  P FLG REQR+T  ++ +  G SVF  P+L+ IPMPVL+GVF YMGV+ L+ +  + R+ L  +  K +PDF YL+++P++RVHLFT +QVLCL LL+ +KS  + ++ FP+++LA+  VRK ++  FSQ +L +LD ++P
Sbjct:   98 EEDDSPAPPQLFTELDELLAVDGQEMEWKETARWIKFEEKVEQGGERWSKPHVATLSLHSLFELRTCMEKGSIMLDREASSLPQLVEMIVDHQIETGLL----KPDLKDKVTYTLLRKHRHQTKKSNLRSLADIGKTVSSASRMFTNPDNGSPAMTHRNLTSSSLNDISDKPEKDQLKNKFMKKLPRDAEASNVLVGEVDFLDSPFIAFVRLQQAVMLGALTEVPVPTRFLFILLGPKGKAKSYHEIGRAIATLMSDEVFHDIAYKAKDRQDLIAGIDEFLDEVIVLPPGEWDPAIRIEPPKSLPSSDKRKNMYSGGENVQMNGDTPPDGGHGGGGHADCEELQRTGRFCGGLIKDIKRKAPFFASDFYDALNIQALSAILFIYLATVTNAITFGGLLGDATDNMQGVLESFLGTAVSGAIFCLFAGQPLTILSSTGPVLVFERLLFNFSKDHNFDYLEFRLWIGLWSAFLCLILVATDASFLVQYFTRFTEEGFSSLISFIFIYDAFKKMIKLADYYPINSNFKVGYNTQFSCVCMPPDPVNISVSNDTTLA-------PEDLPTISSSNMYHNATFDWAFLT-----------TKECLKYGGKLVGNNCG--FVPDITLMSFILFLGTYTSSMALKKFKTSPYFPTTARKLISDFAIILPILIFCVIDALVGVDTPKLIVPSEFKPT--SPNRGWFVAPFGGNPWWVYLAAAIPALLVTILIFMDQQITAVIVNRKEHKLKKGAGYHLDLFWVAILMVVCSFMALPWYVAATVISIAHIDSLKMETETSAPGEQPKFLGVREQRVTGTLVFILTGLSVFMAPILKFIPMPVLYGVFLYMGVASLNGVQFMDRLKLLLMPLKHQPDFIYLRHVPLRRVHLFTFLQVLCLALLWILKS-TVAAIIFPVMILALVAVRKGMDYLFSQHDLSFLDDVIP 1007          
BLAST of slc4a-2 vs. UniProt/SwissProt
Match: sp|Q9JI66|S4A4_RAT (Electrogenic sodium bicarbonate cotransporter 1 OS=Rattus norvegicus OX=10116 GN=Slc4a4 PE=1 SV=1)

HSP 1 Score: 711.835 bits (1836), Expect = 0.000e+0
Identity = 385/937 (41.09%), Postives = 567/937 (60.51%), Query Frame = 1
Query:   58 ENNDKDNQRYLFCQLNEL---EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHHNK---------CGIGSQLSLFRSIVDNPNKKMKQNPSRKTLCENGNE-EDGLLEYKFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEM-IPDRLAN--NKDEPLHHEDDSISEKYKPTQEELEME-LKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKLYVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILP 2817
            E +D      LF +L+EL   +    +W E +RW+KFEE VE   E WSKPHV  LSL S+   ++ +    I L+ E  ++  ++++I    I+   L    + +LK  ++   L  H ++           IG  +S    +  NP+        R     + N+  D   + +  ++F KK+P  +E +N+LV E+ FL      F+RL+Q+ ++GA TEV +PTRF+ I+LG KG   + HE GR   +L+ D VF   AYKA +  DLI  IDEFLD  +V+PP EW+P I+I+PPK +   D+  N  +  E +    D+  +         + E L+ TGRF GG + D+KRK  F+ SDF D+LN+Q L++ +F+Y A +   ITFGGLL  ATD   G +ES L  A+ G ++ LF+GQPLTIL +TGP+LVFE ++F     + +D+L FR+WIG W     LI+VA+D S LV+Y T FTEE F+ LIS I+I  AF+ + +L + YPIN ++   Y  + SC+C+PP+   LS S D           P  LP   +++       DW      Y S      K+ CV +GG   GN C   +VPDI   S +L +GT+T +  +K F+ S   P   R+ I  FA++++I +F +ID ++G++TPKLIVPS+F+PT  +  R W VP  G NPWW  + A IPA+L  ILIFMDQQIT +IVNRK +KLKKG GYHLD+F +AIL+ V S + +PW+V +TV+++ H+ SLK+E+  + PG  P FLG REQR+T  ++ +  G SVF  P+L+ IPMPVL+GVF YMGV+ L+ +  + R+ L  +  K +PDF YL+++P++RVHLFT++QVLCL LL+ +KS  + ++ FP+++LA+  VRK ++  FSQ +L +LD ++P
Sbjct:   98 EEDDSPAPPQLFTELDELLAVDGQEMEWKETARWIKFEEKVEQGGERWSKPHVATLSLHSLFELRTCMEKGSIMLDREASSLPQLVEMIADHQIETGLL----KPDLKDKVTYTLLRKHRHQTKKSNLRSLADIGKTVSSASRMFSNPDNGSPAMTHRNLTSSSLNDISDKPEKDQLKNKFMKKLPRDAEASNVLVGEVDFLDTPFIAFVRLQQAVMLGALTEVPVPTRFLFILLGPKGKAKSYHEIGRAIATLMSDEVFHDIAYKAKDRHDLIAGIDEFLDEVIVLPPGEWDPAIRIEPPKSLPSSDKRKNMYSGGENVQMNGDTPHDGGHGGGGHGDCEELQRTGRFCGGLIKDIKRKAPFFASDFYDALNIQALSAILFIYLATVTNAITFGGLLGDATDNMQGVLESFLGTAVSGAIFCLFAGQPLTILSSTGPVLVFERLLFNFSKDHSFDYLEFRLWIGLWSAFMCLILVATDASFLVQYFTRFTEEGFSSLISFIFIYDAFKKMIKLADYYPINSDFRVGYNTHFSCACLPPDPVNLSVSNDTTLA-------PEDLPTVSSTDMYHNATFDW-----AYLS------KKECVKFGGKLVGNNCD--FVPDITLMSFILFLGTYTSSMAMKKFKTSRYFPTTARKLISDFAIILSILIFCVIDALVGVDTPKLIVPSEFKPTSPH--RGWFVPPFGGNPWWVCLAAAIPALLVTILIFMDQQITAVIVNRKEHKLKKGAGYHLDLFWVAILMVVCSFMALPWYVAATVISIAHIDSLKMETETSAPGEQPKFLGVREQRVTGTLVFILTGLSVFMAPILKFIPMPVLYGVFLYMGVASLNGVQFMDRLKLLLMPLKHQPDFIYLRHVPLRRVHLFTSLQVLCLALLWILKS-TVAAIIFPVMILALVAVRKGMDYLFSQHDLSFLDDVIP 1007          
BLAST of slc4a-2 vs. UniProt/SwissProt
Match: sp|O88343|S4A4_MOUSE (Electrogenic sodium bicarbonate cotransporter 1 OS=Mus musculus OX=10090 GN=Slc4a4 PE=1 SV=2)

HSP 1 Score: 711.835 bits (1836), Expect = 0.000e+0
Identity = 385/937 (41.09%), Postives = 567/937 (60.51%), Query Frame = 1
Query:   58 ENNDKDNQRYLFCQLNEL---EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHHNK---------CGIGSQLSLFRSIVDNPNKKMKQNPSRKTLCENGNE-EDGLLEYKFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEM-IPDRLAN--NKDEPLHHEDDSISEKYKPTQEELEME-LKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKLYVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILP 2817
            E +D      LF +L+EL   +    +W E +RW+KFEE VE   E WSKPHV  LSL S+   ++ +    I L+ E  ++  ++++I    I+   L    + +LK  ++   L  H ++           IG  +S    +  NP+        R     + N+  D   + +  ++F KK+P  +E +N+LV E+ FL      F+RL+Q+ ++GA TEV +PTRF+ I+LG KG   + HE GR   +L+ D VF   AYKA +  DLI  IDEFLD  +V+PP EW+P I+I+PPK +   D+  N  +  E +    D+  +         + E L+ TGRF GG + D+KRK  F+ SDF D+LN+Q L++ +F+Y A +   ITFGGLL  ATD   G +ES L  A+ G ++ LF+GQPLTIL +TGP+LVFE ++F     + +D+L FR+WIG W     L++VA+D S LV+Y T FTEE F+ LIS I+I  AF+ + +L + YPIN ++   Y  + SC+C+PP+   LS S D           P  LP   +++    +  DW      Y S      K+ CV YGG   GN C   +VPDI   S +L +GT+T +  +K F+ S   P   R+ I  FA++++I +F +ID ++G++TPKLIVPS+F+PT    +R W VP  G NPWW  + A IPA+L  ILIFMDQQIT +IVNRK +KLKKG GYHLD+F +AIL+ V S + +PW+V +TV+++ H+ SLK+E+  + PG  P FLG REQR+T  ++ +  G SVF  P+L+ IPMPVL+GVF YMGV+ L+ +  + R+ L  +  K +PDF YL+++P++RVHLFT +QVLCL LL+ +KS  + ++ FP+++LA+  VRK ++  FSQ +L +LD ++P
Sbjct:   98 EEDDSPAPPQLFTELDELLAVDGQEMEWKETARWIKFEEKVEQGGERWSKPHVATLSLHSLFELRTCMEKGSIMLDREASSLPQLVEMIADHQIETGLL----KPDLKDKVTYTLLRKHRHQTKKSNLRSLADIGKTVSSASRMFSNPDNGSPAMTHRNLTSSSLNDISDKPEKDQLKNKFMKKLPRDAEASNVLVGEVDFLDTPFIAFVRLQQAVMLGALTEVPVPTRFLFILLGPKGKAKSYHEIGRAIATLMSDEVFHDIAYKAKDRHDLIAGIDEFLDEVIVLPPGEWDPTIRIEPPKSLPSSDKRKNMYSGGENVQMNGDTPHDGGHGGGGHGDCEELQRTGRFCGGLIKDIKRKAPFFASDFYDALNIQALSAILFIYLATVTNAITFGGLLGDATDNMQGVLESFLGTAVSGAIFCLFAGQPLTILSSTGPVLVFERLLFNFSKDHNFDYLEFRLWIGLWSAFMCLVLVATDASFLVQYFTRFTEEGFSSLISFIFIYDAFKKMIKLADYYPINSDFKVGYNTHFSCACLPPDPVNLSVSNDTTLA-------PEDLPTISSTDMYHNVTFDW-----AYLS------KKECVKYGGKLVGNNCD--FVPDITLMSFILFLGTYTSSMAMKKFKTSRYFPTTARKLISDFAIILSILIFCVIDALVGVDTPKLIVPSEFKPT--SPNRGWFVPPFGGNPWWVCLAAAIPALLVTILIFMDQQITAVIVNRKEHKLKKGAGYHLDLFWVAILMVVCSFMALPWYVAATVISIAHIDSLKMETETSAPGEQPKFLGVREQRVTGTLVFILTGLSVFMAPILKFIPMPVLYGVFLYMGVASLNGVQFMDRLKLLLMPLKHQPDFIYLRHVPLRRVHLFTFLQVLCLALLWILKS-TVAAIIFPVMILALVAVRKGMDYLFSQHDLSFLDDVIP 1007          
BLAST of slc4a-2 vs. UniProt/SwissProt
Match: sp|Q80ZA5|S4A10_RAT (Sodium-driven chloride bicarbonate exchanger OS=Rattus norvegicus OX=10116 GN=Slc4a10 PE=1 SV=1)

HSP 1 Score: 711.835 bits (1836), Expect = 0.000e+0
Identity = 404/979 (41.27%), Postives = 577/979 (58.94%), Query Frame = 1
Query:   52 STENNDKDNQRY-LFCQLNEL---EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHHNKC--GIGSQLSLFRSIVDNPNKKMKQN----------PSRKTLC-ENGNE---EDGLLEYKF------------CS-------------------RFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEELEM--ELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGK--LYVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQN 2823
             TE++D+++  + LF +L+E+   E    +W E +RW+KFEE VE+  E WSKP+V  LSL S+   +S IL+  + L+     +E++ D++L + +   +L+    E+++  +    +  HH++    + +++ + RS  D   K+ + N          P     C EN N+   E+  +++              C                     F KKIP G+E +NILV E+ FL   +  F+RL  + ++    EV +P+RF+ I+LG  G     HE GR   +L+ D VF   AYKA +  DL+  IDEFLD   V+PP EW+P+I+I+PPK +           P     +  +    P Q       EL+ TGR FGG + D+KRK  F+ SDFRD+ +LQCLASF+FLY AC++P ITFGGLL +AT+G + A+ES+  A++ G+ YSLF GQPLTILG+TGP+LVFE ++FK C  Y   +L  R  IG W     +I+VA+D S LV Y+T FTEE FA LI +I+I +A + LFEL E YPIN + +   +   SC+C+ P+    S S D              L  +  SN S    I W N+T              C    G + G  CG    YVPD+ F+S +L   T TM+  LK F+ S   P KVR  +  FAV + I    LID+ IG+ +PKL VPS F+PT     R W V  LG NPWW+ I A IPA+L  ILIFMDQQIT +I+NRK +KLKKG GYHLD+ ++A+++GV S++G+PWFV +TVL++ HV SLK+ES  + PG  P FLG REQR+T LMI + +G SVF T +L+ IPMPVL+GVF YMG S L  I +  RI LF++ AK +PDF YL+++P+++VHLFT IQ+ CL LL+ IK ++  ++ FP++VLA+ FVRK ++  F++ EL WLD ++P++
Sbjct:  104 GTEDDDEEHIPHDLFTELDEICWREGEDAEWRETARWLKFEEDVEDGGERWSKPYVATLSLHSLFELRSCILNGTVLLDMHANTLEEIADMVLDQQVSSGQLN----EDVRHRVHEALMKQHHHQSQKKLTNRIPIVRSFADIGKKQSEPNSMDKNGQVVSPQSAPACAENKNDVSRENSTVDFSKGLGGQQKGHTSPCGMKQRLDKGPPHQQEREVDLHFMKKIPPGAEASNILVGELEFLDRTVVAFVRLSPAVLLQGLAEVPIPSRFLFILLGPLGKGQQYHEIGRSIATLMTDEVFHDVAYKAKDRNDLVSGIDEFLDQVTVLPPGEWDPSIRIEPPKNVPSQEKRKTPSLP-----NGTAAHGGPEQHGGHSGPELQRTGRIFGGLILDIKRKAPFFWSDFRDAFSLQCLASFLFLYCACMSPVITFGGLLGEATEGRISAIESLFGASMTGIAYSLFGGQPLTILGSTGPVLVFEKILFKFCKEYGLSYLSLRASIGLWTATLCIILVATDASSLVCYITRFTEEAFASLICIIFIYEALEKLFELSESYPINMHNDLELLTQYSCNCMEPH----SPSND-------------TLKEWRESNISASDII-WGNLT-----------VSECRSLHGEYVGRACGHGHPYVPDVLFWSVILFFSTVTMSATLKQFKTSRYFPTKVRSIVSDFAVFLTILCMVLIDYAIGIPSPKLQVPSVFKPT--RDDRGWFVTPLGPNPWWTIIAAIIPALLCTILIFMDQQITAVIINRKEHKLKKGCGYHLDLLMVAVMLGVCSIMGLPWFVAATVLSITHVNSLKLESECSAPGEQPKFLGIREQRVTGLMIFILMGSSVFMTSILKFIPMPVLYGVFLYMGASSLKGIQLFDRIKLFWMPAKHQPDFIYLRHVPLRKVHLFTVIQMSCLGLLWIIK-VSRAAIVFPMMVLALVFVRKLMDFLFTKRELSWLDDLMPES 1041          
BLAST of slc4a-2 vs. TrEMBL
Match: A0A0H3YJZ6 (Anion exchange protein OS=Schmidtea mediterranea OX=79327 GN=slc4a-2 PE=2 SV=1)

HSP 1 Score: 1910.96 bits (4949), Expect = 0.000e+0
Identity = 968/968 (100.00%), Postives = 968/968 (100.00%), Query Frame = 1
Query:   37 MFNLSSTENNDKDNQRYLFCQLNELEPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHHNKCGIGSQLSLFRSIVDNPNKKMKQNPSRKTLCENGNEEDGLLEYKFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEELEMELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKLYVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQNXXXXXXXXXXXXXXXXXXXQPELTLEIMSPEDKEKEDRP 2940
            MFNLSSTENNDKDNQRYLFCQLNELEPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHHNKCGIGSQLSLFRSIVDNPNKKMKQNPSRKTLCENGNEEDGLLEYKFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEELEMELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQPLTILGTTGPLLVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKLYVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQNKSKNKKSKPCSSCCFKSKSQPELTLEIMSPEDKEKEDRP
Sbjct:    1 MFNLSSTENNDKDNQRYLFCQLNELEPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHHNKCGIGSQLSLFRSIVDNPNKKMKQNPSRKTLCENGNEEDGLLEYKFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEELEMELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQPLTILGTTGPLLVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKLYVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQNKSKNKKSKPCSSCCFKSKSQPELTLEIMSPEDKEKEDRP 968          
BLAST of slc4a-2 vs. TrEMBL
Match: A0A0H3YF38 (Anion exchange protein OS=Schmidtea mediterranea OX=79327 GN=slc4a-1 PE=2 SV=1)

HSP 1 Score: 916.376 bits (2367), Expect = 0.000e+0
Identity = 481/997 (48.24%), Postives = 655/997 (65.70%), Query Frame = 1
Query:   37 MFNLSSTENNDKDNQRYLFCQLNEL---EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPH---HNKCGIGSQLSLFRSIVDNPNKKMKQNPSRKTLCENGNE-------------------------------------EDGLLEYKFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPK-----EMIPDRLANNKDEPLHHEDD-----------------SISEKYKPTQEELEME--LKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLY-IDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKLYVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQN 2823
            MF L   E+ +  N   LFC+++EL   +    +W E +RW+KFEE VE   E WSKPHV  LSL S+   ++ I  AV   N E  N E +I++IL K + EKK+   Q E++K++L   H++ H   H     GSQL L RS+ D   K   +   +  L    ++                                      D L   KF   F KKIPLG+E +NI+V E  FL++ + +FIRLK++ I+G  TEV +PTRF+ ++LG +G+    HE GR   +L+ D VF   AYKA    DL+  IDEFL +  V+PP EW+P+I+I+PPK       +P  + N     L    D                 S+  K +P +EE   +  L+ TGR FGG ++DVKRK  FYLSDF+D++++QC ASF FLYFACL P ITFGGLLV+AT GYLGA+ESIL+  IVGV+YSLFSGQPLTI+G+TGP+LVFES+V+ IC   +WD+LPFR+WIG WI  +L ++VA DLS LV+Y+T FTEE FA LI+LI++V+AF+ LF +++ YPI+  WN + I NR+C C P N T +     ++ +    +  P + P   NS+   ++  IDW NI++ +F+W+   ++ +C  +GG W G+ CG  ++PD+FFFS +L IGTF ++YGLK+ RN+   P  VR  I  FAV+IAI   TL+D+ +G +TPKL VP+KFEPTLGY  R W++P LGKNPWW+ I+A  PA+LAVILIFMDQQIT +IVNRK NKLKKG GYHLD+ ++AILI VNS++G+PWFV +TVL++NHVMSLK ES N  PG  PVFLGCREQR+T  +I L IG SVF TP+L+RIPM VL+GVF +MGV+ L  + ++QRI LFF+ AK +PD+ +L+Y+P++RVHLFT IQ++ L+LL+ IK+IN++S+ FPI+VLA+CFVRK LE  F+  ELKWLD I+P +
Sbjct:   91 MFLLGEDEDEETHN---LFCEMDELRLDDEGEPEWKETARWIKFEEDVEEGGERWSKPHVASLSLYSLFEVRNCITSAVNMFNVEANNFETIIEIILNKIVSEKKISPDQREKVKEMLQRKHVHLHERRHKSNAKGSQLPLIRSLADIGKKYSSKEVDKVQLQRRNSDYPTKFTRFDANSSQPSIIKSSSSIYVDKNRIDVDQCGSDNLASQKFDLHFFKKIPLGAETSNIMVGETDFLNQMVVVFIRLKEAVILGELTEVPVPTRFVFVMLGPQGSAVKNHEIGRSMATLMSDDVFHDVAYKARNLDDLLAGIDEFLSNCTVLPPAEWDPSIRIEPPKSGPIARKVPS-MPNGAQALLTASGDGRGGNNNGTPSSGTGPASVVNKLQPVEEESHADPTLRRTGRLFGGLIEDVKRKAPFYLSDFKDAIHVQCFASFFFLYFACLTPIITFGGLLVQATGGYLGAIESILSGTIVGVVYSLFSGQPLTIMGSTGPVLVFESIVYNICERMRWDYLPFRLWIGVWIAAYLFLMVAFDLSALVRYITRFTEESFAALIALIFMVEAFKKLFLIVDYYPIDTRWNIDMIKNRTCECFPRNATAMDAFFQKNNKPSNVYMPPMLYPVPLNSSVIDIVNNIDWQNISNYHFTWDYKKYRLICTKWGGIWTGSGCGNYFIPDVFFFSCLLFIGTFVLSYGLKMMRNAQFFPNWVRSLISDFAVMIAISSMTLLDWSLGFHTPKLNVPAKFEPTLGYKMRGWVIPALGKNPWWTIIIAMGPALLAVILIFMDQQITAVIVNRKENKLKKGSGYHLDLLVVAILILVNSILGIPWFVAATVLSINHVMSLKKESENTAPGERPVFLGCREQRVTGTIIFLVIGLSVFLTPLLKRIPMAVLYGVFLFMGVASLKGVQLMQRISLFFMPAKYQPDYIFLRYVPLRRVHLFTIIQIILLVLLWVIKTINVMSICFPIMVLALCFVRKGLEYLFTYNELKWLDDIMPNH 1083          
BLAST of slc4a-2 vs. TrEMBL
Match: A4K8Z4 (Anion exchange protein OS=Doryteuthis pealeii OX=1051067 PE=2 SV=1)

HSP 1 Score: 755.747 bits (1950), Expect = 0.000e+0
Identity = 419/952 (44.01%), Postives = 587/952 (61.66%), Query Frame = 1
Query:   64 NDKDNQRYLFCQLNELEPSSNK--WYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHHNK---------------------CGIGSQLS-LFRSIVDNPNKKMKQNPSRKTLCENGNEE--DGLLEY-----KFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEELEMELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFE-NSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKLYVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIV-PILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQ 2820
            +++ N  Y+FCQ++ L  ++ +  W E +RWVK+EE VE   E WSKPHV  LSL S+   +S +L   + L+ +  N+   IDL++   ++ K L+ +  ++L+ ++   H + H  +                       IG Q S  FR    N     K   S +    + N E  +G L       K   +F +K+P GSEVANILV E+  L   +  FIRL+ + ++    EV LPTRFI + LG  G+ S ++E GR   +++VD VF + AYKA   +DL+  IDEFLD   V+PP EW+PNI+I+PP   +P + A    +P    +D   E+ +      +  L  TGR FGG V DVKRK ++Y+SDF+D+L+LQC+AS +FLY A L P +TFGGLL +ATD Y+G ME IL AAI GVL++LF+GQPL ILG+TGP+LV E +++ +C    +DFLP R WIG W  + LL+IV  DLS LV+Y+T FTEE FA LI++I+IV+AF+  F + + YP+  +   ++     C C+P N ++ ++S    T     +  P + P     SN +QL                  +F + CV  GG   G  C   +VPD+FF S +L IGTFT+A GL+ F+ S   P  VR+ +  F+V+++I +   ID ++G+ TPKL VP KF+PT    +R W + P+  KNPWW    A IPA+LAVILIFMDQQIT +IVNRK NKLKKG GYHLDMF++A+ I + SL+G+PW+V +TV A+ HVMSLK ES    PG  P FLG REQR+T LM+ L  G SV FT +L  IPM VL+GVF YMGV+ L  + ++ RI LFF+ +K +PD  YL+++PIKRVHLFT IQ  CL++L+ IK+I  +S+ FPI+VL  CFVRK+++  F+Q ELKWLD I+P+
Sbjct:   87 DNEHNHHYIFCQMDMLHNNNGEYEWRESARWVKYEEDVEEGGERWSKPHVASLSLHSLFELRSSMLSGAVMLDMDAHNMAQAIDLLMDNLVNAKLLEENMRDKLRVMIVRPHFHQHMKRKKSFAPTDDPQKFRKSMKRTFSEIGRQFSGSFRQGASNSMLSSKTETSLRGNNSSPNMESLNGALPESPSLCKLNEQFMRKLPGGSEVANILVGEVESLKYQVTAFIRLRAARLMD-IAEVPLPTRFIFLCLGPAGSQSKLYEIGRSISTIMVDEVFGEVAYKARGRQDLLAGIDEFLDQVTVLPPGEWDPNIRIEPPA-AVPSQGARKSIKP---PNDPNKEEEEEEASHCDPTLVRTGRLFGGLVADVKRKAQWYISDFKDALHLQCVASIVFLYLATLTPNVTFGGLLGQATDQYMGTMECILTAAITGVLFALFAGQPLNILGSTGPMLVLEMILYNVCKEKGFDFLPMRCWIGIWTTVLLLVIVMFDLSALVRYITRFTEESFASLIAIIFIVEAFKKTFGIAKKYPVQTHVELDHSFQ--CECLPINHSLFNESNPNMT-----YAMPTLSPPLNITSNGTQL------------------SFLEDCVQRGGELVGPDCK--FVPDVFFLSILLFIGTFTVANGLQSFKTSRFFPTWVRQNLSDFSVLLSIIIMVGIDMLLGIPTPKLNVPRKFKPT--RPNREWFINPVSEKNPWWVIPAAIIPALLAVILIFMDQQITAVIVNRKENKLKKGSGYHLDMFVVAVCILICSLLGLPWYVAATVSALAHVMSLKKESECTAPGERPAFLGVREQRVTALMVGLLSGLSVLFTSILSVIPMAVLYGVFLYMGVAALKGMQLVDRILLFFMPSKYQPDHMYLRHVPIKRVHLFTVIQSFCLIVLWVIKTIKSVSIVFPIMVLGTCFVRKAMDYLFTQRELKWLDDIMPE 1004          
BLAST of slc4a-2 vs. TrEMBL
Match: K1R554 (Anion exchange protein OS=Crassostrea gigas OX=29159 GN=CGI_10027254 PE=3 SV=1)

HSP 1 Score: 736.873 bits (1901), Expect = 0.000e+0
Identity = 402/944 (42.58%), Postives = 572/944 (60.59%), Query Frame = 1
Query:   58 ENNDKDNQRYLFCQLNELEPSSN--KWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHHNKCGIGSQLSLFRSIVDNPNKKMKQNPSRKTLCENGNE-----------EDGLLEYKFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEELEME-------LKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKL-YVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIV-PILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQN 2823
            EN+D  N   +FCQ++ L  + N  +W E +RWVK+EE VE+  E WSKPHV  LSL S+   +S +L   + L+ +  +I  V DLI+ + I+ K L+ +  + ++  ++  H +  H K       +   S+ D   + MK+N S  +   N N             D     K   +F KKIP GSE ANILV E+  L   +  F+RL ++  IG  TEV LPT+FI ++LG  G+ +   E GR   +++VD VFR+ AY+A   +D++  IDEFLD   V+PP EW+P I+I+PP + +P +      +P   ++  + E  K   E++E E       L  TGR FGG V D+KRK  +Y SDF+D L++QC+AS ++LY A L P +TFGGLL  AT+ Y+G ME IL AAIVG+L++LF+GQPL ILG+TGP+LV E +V+  C    WD++PFR W G W  + ++++VA DLS LV+Y+T FTEE FA LI++I+I +A + +  + + YP+N N    Y  N  C+C PP        +D  T            P +     + + Y + ++I    FS  T +   MC  Y GT  G  CG   Y  D+FF S +L  GT+ +A  LK F+ S   P  VR+    FAV++AI +   +D  IG+ TPKL VP  F PT     R W + PI  KNPWW  +++ IPA L+ ILIF+DQQIT +IVNRK NKLKKG GYHLDMF++ I + + SL+G+PW+V +TV A+ H+MSLK ES  + PG  PVFLGCREQR+T L++ +  G SVF T +L+ IPMPVL+GVF +MGV+ L  +  + R+ L F+  K +PD  YL+++PIKRVHLFT  Q++CL +L+ +K I  +S+ FP++VL  C VRK  +  F Q ELKWLD ++P++
Sbjct:   63 ENDDTHN---VFCQMDTLYTALNEYQWRETARWVKYEEDVEDGGERWSKPHVASLSLHSLFELRSSLLMGAVMLDMDAYHITQVADLIIDQLINAKLLESNLRDNVRAAITANHAH-QHQKRRRSMMPTQQESMADFRKRSMKRNFSNSSAKLNRNPNSVPENIGDLLSDSASSAKLNQQFMKKIPDGSEAANILVGEMDCLKYQITAFVRLTEARSIGDLTEVPLPTKFIFLLLGPPGSHNKNVEMGRSMSTMMVDEVFREVAYRAKSRQDILSGIDEFLDQVTVLPPGEWDPKIRIEPP-DKVPSQ------DPRRQQNAKVPEGPKVAAEQIEEEESHIDPTLVRTGRLFGGLVADIKRKIPWYASDFKDCLHIQCVASTLYLYLATLTPNVTFGGLLGLATNQYMGTMECILTAAIVGILFALFAGQPLNILGSTGPMLVLEMIVYSFCIDQGWDYMPFRAWTGIWTTVIIMLVVAFDLSALVRYITRFTEESFACLIAIIFIYEAIKKVIGITKKYPVNLNPEHEYFFN--CTCTPP--------IDNSTYFNATNLTMAAGPTYAVQEMTTMSYANSSSID---FSTLTED---MCEMYNGTMVGPDCGHHPYAADVFFLSVILFFGTYVIATSLKDFKTSGYFPSFVRQIFSDFAVLLAIILMVGLDMAIGIPTPKLEVPENFAPT--KPGRPWFINPISDKNPWWVILVSAIPAFLSTILIFLDQQITAVIVNRKENKLKKGNGYHLDMFVVGICVLICSLLGLPWYVAATVSALAHIMSLKKESECSAPGEKPVFLGCREQRVTALVVGILSGLSVFMTKILKVIPMPVLYGVFLFMGVAALKGMQFVDRLALIFMPKKYQPDHMYLRHVPIKRVHLFTLFQIVCLAILWVVKMIKSISILFPVMVLGTCIVRKLFDYIFEQRELKWLDDLMPED 977          
BLAST of slc4a-2 vs. TrEMBL
Match: A0A0C9RDR5 (Anion exchange protein (Fragment) OS=Fopius arisanus OX=64838 GN=SLC4A10_0 PE=3 SV=1)

HSP 1 Score: 735.332 bits (1897), Expect = 0.000e+0
Identity = 414/1001 (41.36%), Postives = 583/1001 (58.24%), Query Frame = 1
Query:   40 FNLSSTENNDKDNQRYLFCQLNELEPSSNK--WYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFS---------------QEEELKQ--------LLSMCHLNPHHNK---CGI--GSQLSLFRSIVDNPNKKMKQNPSRKTLCEN------------------------------------------GNEEDGLLEYKFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEELEMELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGK-LYVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQN 2823
            F L     +D      LF ++ EL    ++  W E +RW+KFEE VE     WSKPHV  LSL S+   +S++L+  + L+ E  ++E + DL+L   I +  L                  Q E  K         + S+  +  +H+    C I  G +  L   +   P+        R T C N                                          G  ++G   +K  + F +KIP G+E +NILV E+ FL + L  FIRL Q+S++G  TEV +PTRFI I+LG  G +S  HE GR   +L+ D VF   AYKA     L+  IDEFLD+  V+PP EW+P I+I+PP   IP +    + +    ++D + E+    +   E  L  TGR FGG ++D+KRK  FY+SDF+D++ LQC+ASFIFLYFACL+P ITFGGLL +AT   + A+ES+++  + G+ Y  FSGQPLTILG+TGP+LVFE++VF+ C    W+++ FR WIG WI   L+++VA D S LV Y+T FTEE FA LI+ I+I KA +N+F +   YP+N N +   +L+ +C C PPN T                    +LPG  +S       ++W  +            K  C +  GT  G+ C    YVPD+F  S +L +GTF ++  LK F+N+   P KVR+ +  FAV+IAIF  +++D+  G+ TPKL VPS+F+PTL    R WI+    +NPWWS I+A +PA+L  ILIFMDQQIT +IVNRK NKLKKG GYHLD+F++AILI + S++G+PWFV +TVL++NHV SLK+ES    PG  P FLG REQR+TH++I L IG SV  TPML  IPMPVLFGVF YMGV+ L  +    RI +  +  K +PD+ +L+ +P+KRVH+FT IQ+ CL+ L+TIKS +  S+ FP++++ M  +RKSL+  F++ ELK LD ++P++
Sbjct:   52 FILGEEVGDDAHESHPLFSEMEELVKDGDEMEWKETARWIKFEEDVEEGGNRWSKPHVATLSLHSLFELRSLLLNGTVMLDMEASSLEQIADLVLDNMISKGVLPIDTREKVREALLVRHRHQHERRKDNNMSRLPIIRSLADIGRNHSSSKNCDITCGMRGLLTSDLQARPDDAYSPAVPRSTSCPNPNTALITKDSKDLKGPYLLVPGQEPTIDRSPSSISISRNHSSGGLDNGDGNHKVNTHFMRKIPAGAEASNILVGEVDFLEKTLPAFIRLSQASMMGDLTEVPVPTRFIFILLGPMGGISGFHEIGRAMATLMSDEVFHDVAYKARNRNHLLAGIDEFLDAVTVLPPGEWDPTIRIEPPA-AIPSQDTRKRPKEEKPKED-VDEEADEQKLREESGLSRTGRLFGGLINDIKRKAPFYVSDFKDAVALQCIASFIFLYFACLSPIITFGGLLSEATGKNMAALESLVSGFVCGIGYGFFSGQPLTILGSTGPVLVFETIVFEFCKKIAWNYMSFRFWIGSWIAGILIVLVAIDASALVCYITRFTEENFATLIAFIFIYKAVENVFAIGRKYPLNMNGD--ELLDTNCLCRPPNST-------------------SILPGSYSS-------VNWTALD-----------KVSCQNLNGTLVGDGCTTPQYVPDVFLMSIILFMGTFLLSVELKDFKNALFFPSKVRQIVSDFAVIIAIFSMSILDYCTGIATPKLEVPSEFKPTL--DGRGWIIWPFQENPWWSAIVAGLPALLGTILIFMDQQITAVIVNRKENKLKKGCGYHLDLFVLAILIEICSVMGLPWFVAATVLSINHVNSLKLESECAAPGEKPQFLGVREQRVTHILIFLMIGCSVLLTPMLSHIPMPVLFGVFLYMGVASLKGLQFFDRILIMLMPVKYQPDYMFLRQVPLKRVHMFTLIQLACLVCLWTIKSFSSTSILFPLMLVVMIGIRKSLDLLFTRRELKILDDVMPES 1009          
BLAST of slc4a-2 vs. Ensembl Cavefish
Match: slc4a10b (solute carrier family 4 member 10 [Source:NCBI gene;Acc:103025302])

HSP 1 Score: 724.931 bits (1870), Expect = 0.000e+0
Identity = 400/958 (41.75%), Postives = 589/958 (61.48%), Query Frame = 1
Query:    7 SIAF*TSLFKMFNLSSTENNDKDNQRY-LFCQLNEL---EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHHNKCGIGSQLSLFRSIVDNPNKKMKQN------------PSRKTLCENGNEEDGLLEY-KFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEELEMELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKL--YVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQN 2823
            S A+ T   ++  L  TE++D+++  + LF +L+E+   +   ++W E +RW+KFEE VE+  E WSKP+V  L+L S+   +S I++  + L+    ++E++ D++L +     +L     ++++Q L   H   H N+  + +++ + RS  D   K+ + N            P    L    + E+  +++ K    F KKIP G+E +NILV E+ FL + +  FIRL  + ++    EV + TRF+ I+LG  G     HE GR   +L+ D VF   AYKA +  DL+  IDEFLD   V+PP EW+P+I+I+PPK  +P +    K   + + + + +E++         EL+ TGR FGGF  D+KRK   YLSD+ D+L+LQC+ASF+FLY AC++P ITFGGLL +AT+G + A+ES+  A++ G+ YSLF+GQPLTILG+TGP+LVFE ++FK C  Y   +L  R  IG W     +++VA+D S LV Y+T FTEE FA LI +I+I +A + L  L E YPIN N N + +   SC+CI P                             N + + L Y + NNIT     W     +  C++  G + G+ CG    Y+PD+ F+S +L   T  M+  LK F+ S   P KVR  I  FAV   I    L+D+ +G+ +PKL VPSKF+PT     R W +  LG NPWW+ I+  IPA+L  ILIFMDQQIT +I+NRK +KLKKG GYHLD+F++A+++GV SL+G+PWFV +TVL+++HV SLK+ES ++ PG  P FLG REQR T LMI L +G SVF T +L+ IPMPVL+GVF YMG S L  I    R+ LF + AK +PDF YL+++P+++VHLFT +Q+ CL+LL+ IK+ +  ++ FP++VLA+ F+RK L+ FF++ EL WLD ++P++
Sbjct:  134 SPAYDTPSQRVQFLLGTEDDDEEHIPHDLFTELDEICLRDGEDSEWRETARWLKFEEDVEDGGERWSKPYVATLTLHSLFELRSCIINGTVMLDMRASSLEEIADMVLDQQEGLDELGDEVRKKIRQALLKQHH--HQNQKKLANRIPIVRSFADIGKKQSESNSMDKNGQMIPPQPCAPELKPEVSRENSSVDFSKIDLHFMKKIPAGAEASNILVGELEFLEKPVVAFIRLSPAVLLNGLAEVPITTRFLFILLGPLGKGPQYHEIGRSIATLMTDEVFHDVAYKAKDRNDLVAGIDEFLDQVTVLPPGEWDPSIRIEPPKN-VPSQ-EKRKIPAVPNGELAETEEHGGHGGP---ELQRTGRLFGGFFLDIKRKAPHYLSDYTDALSLQCVASFLFLYCACMSPVITFGGLLGEATEGRISAIESLFGASMTGIAYSLFAGQPLTILGSTGPVLVFEKILFKFCKEYGLSYLSLRTCIGLWTAFLCILLVATDASSLVCYITRFTEEAFASLICIIFIYEALEKLIHLGETYPINMNNNLDKLTTYSCACIEPV----------------------------NPSNATLQYWEQNNITASEIYWEALEVED-CIEKKGVFVGSACGPHGPYIPDVLFWSVVLFFSTVAMSAFLKEFKTSRYFPTKVRAIISDFAVFFTILTMVLVDYALGVPSPKLQVPSKFKPT--RDDRGWFINPLGPNPWWTCIITVIPALLCTILIFMDQQITAVIINRKEHKLKKGCGYHLDLFVVAVMLGVCSLMGLPWFVAATVLSISHVNSLKLESESSAPGEQPKFLGIREQRFTGLMIFLLMGCSVFMTSVLKFIPMPVLYGVFLYMGASSLRGIQFFDRLRLFGMPAKHQPDFIYLRHVPLRKVHLFTIVQLSCLILLWVIKT-SRAAIVFPMMVLALVFIRKLLDFFFTKRELSWLDDLMPES 1052          
BLAST of slc4a-2 vs. Ensembl Cavefish
Match: slc4a10b (solute carrier family 4 member 10 [Source:NCBI gene;Acc:103025302])

HSP 1 Score: 724.161 bits (1868), Expect = 0.000e+0
Identity = 400/958 (41.75%), Postives = 589/958 (61.48%), Query Frame = 1
Query:    7 SIAF*TSLFKMFNLSSTENNDKDNQRY-LFCQLNEL---EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHHNKCGIGSQLSLFRSIVDNPNKKMKQN------------PSRKTLCENGNEEDGLLEY-KFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEELEMELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKL--YVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQN 2823
            S A+ T   ++  L  TE++D+++  + LF +L+E+   +   ++W E +RW+KFEE VE+  E WSKP+V  L+L S+   +S I++  + L+    ++E++ D++L +     +L     ++++Q L   H   H N+  + +++ + RS  D   K+ + N            P    L    + E+  +++ K    F KKIP G+E +NILV E+ FL + +  FIRL  + ++    EV + TRF+ I+LG  G     HE GR   +L+ D VF   AYKA +  DL+  IDEFLD   V+PP EW+P+I+I+PPK  +P +    K   + + + + +E++         EL+ TGR FGGF  D+KRK   YLSD+ D+L+LQC+ASF+FLY AC++P ITFGGLL +AT+G + A+ES+  A++ G+ YSLF+GQPLTILG+TGP+LVFE ++FK C  Y   +L  R  IG W     +++VA+D S LV Y+T FTEE FA LI +I+I +A + L  L E YPIN N N + +   SC+CI P                             N + + L Y + NNIT     W     +  C++  G + G+ CG    Y+PD+ F+S +L   T  M+  LK F+ S   P KVR  I  FAV   I    L+D+ +G+ +PKL VPSKF+PT     R W +  LG NPWW+ I+  IPA+L  ILIFMDQQIT +I+NRK +KLKKG GYHLD+F++A+++GV SL+G+PWFV +TVL+++HV SLK+ES ++ PG  P FLG REQR T LMI L +G SVF T +L+ IPMPVL+GVF YMG S L  I    R+ LF + AK +PDF YL+++P+++VHLFT +Q+ CL+LL+ IK+ +  ++ FP++VLA+ F+RK L+ FF++ EL WLD ++P++
Sbjct:   82 SPAYDTPSQRVQFLLGTEDDDEEHIPHDLFTELDEICLRDGEDSEWRETARWLKFEEDVEDGGERWSKPYVATLTLHSLFELRSCIINGTVMLDMRASSLEEIADMVLDQQEGLDELGDEVRKKIRQALLKQH--HHQNQKKLANRIPIVRSFADIGKKQSESNSMDKNGQMIPPQPCAPELKPEVSRENSSVDFSKIDLHFMKKIPAGAEASNILVGELEFLEKPVVAFIRLSPAVLLNGLAEVPITTRFLFILLGPLGKGPQYHEIGRSIATLMTDEVFHDVAYKAKDRNDLVAGIDEFLDQVTVLPPGEWDPSIRIEPPKN-VPSQ-EKRKIPAVPNGELAETEEHGGHGGP---ELQRTGRLFGGFFLDIKRKAPHYLSDYTDALSLQCVASFLFLYCACMSPVITFGGLLGEATEGRISAIESLFGASMTGIAYSLFAGQPLTILGSTGPVLVFEKILFKFCKEYGLSYLSLRTCIGLWTAFLCILLVATDASSLVCYITRFTEEAFASLICIIFIYEALEKLIHLGETYPINMNNNLDKLTTYSCACIEPV----------------------------NPSNATLQYWEQNNITASEIYWEALEVED-CIEKKGVFVGSACGPHGPYIPDVLFWSVVLFFSTVAMSAFLKEFKTSRYFPTKVRAIISDFAVFFTILTMVLVDYALGVPSPKLQVPSKFKPT--RDDRGWFINPLGPNPWWTCIITVIPALLCTILIFMDQQITAVIINRKEHKLKKGCGYHLDLFVVAVMLGVCSLMGLPWFVAATVLSISHVNSLKLESESSAPGEQPKFLGIREQRFTGLMIFLLMGCSVFMTSVLKFIPMPVLYGVFLYMGASSLRGIQFFDRLRLFGMPAKHQPDFIYLRHVPLRKVHLFTIVQLSCLILLWVIKT-SRAAIVFPMMVLALVFIRKLLDFFFTKRELSWLDDLMPES 1000          
BLAST of slc4a-2 vs. Ensembl Cavefish
Match: slc4a10a (sodium-driven chloride bicarbonate exchanger-like [Source:NCBI gene;Acc:103033693])

HSP 1 Score: 720.694 bits (1859), Expect = 0.000e+0
Identity = 399/950 (42.00%), Postives = 584/950 (61.47%), Query Frame = 1
Query:   40 FNLSSTENNDKDNQRYLFCQLNEL---EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHH--NKCGIGSQLSLFRSIVDNPNKK-----MKQN-----PSRKTLC----ENGNEEDGLLEY-KFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEELEMELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKL--YVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQN 2823
            F L   + +++     LF +L+E+   E    +W E +RW+KFEE VE+  E WSKP+V  LSL S+   +S IL+ ++ L+    ++E++ D++L    D+++   +  EE+++ +    L  HH  N+  + +++ + RS  D   K+     M +N     P  +  C     +G+ E+  +++ K    F KKIP G+E +NILV E+ FL + +  F+RL  + ++    EV + TRF+ I+LG  G     HE GR   +++ D VF   AYKA +  DL+  IDEFLD   V+PP EW+P I+I+PPK  +P +    K  PL +    + E+ +        EL+ TG+FFGGF  D+KRK   YLSD+ D+++LQCLASF+FLY AC++P ITFGGLL +AT+G + A+ES+  A++ G+ YSLF+GQPLTILG+TGP+LVFE ++FK C  Y   +L  R+ IG W   F L++VA+D S LV Y+T FTEE FA LI +I+I +A + L  L E YP N + + N +   SC C  P                            ++ + + L Y    NIT     W   + K  C+ Y G + G+ CG    Y+PD+ F+S +L   T  M+  LK F+ S   P KVR+ I  FAV I I     IDF +G+ +PKL VP++F+PT     R WI+  LG NPWW+TI+  IPA+L  ILIFMDQQIT +I+NRK +KLKKG GYHLD+F++ +++GV S++G+PWFV +TVL+++HV SLK+ES  + PG  P FLG REQR T LMI L +G SVF T +L+ IPMPVL+GVF YMG S L  I    R+ LF + AK +PDF YL+++P+++VHLFT +Q+ CL +L+ IK+ +  ++ FP++VLA+ F+RK L+ FF++ EL WLD ++P++
Sbjct:  110 FLLGMEDEDEEHIPHALFTELDEICLREGEDAEWKETARWLKFEEDVEDGGERWSKPYVATLSLHSLFELRSCILNGIVMLDMRANSLEEIADMVL----DQQETSIALGEEVRKKIRNALLKQHHHQNQKKLANRIPIVRSFADIGKKQSEPHSMDKNGQMVSPQSQPPCTESRSDGSRENSAVDFSKIDLHFMKKIPPGAEASNILVGELEFLEKPVVAFVRLSPAVLLNGLAEVPITTRFLFILLGPMGKGPQYHEIGRSIATIMTDEVFHDVAYKAKDRSDLVAGIDEFLDQVTVLPPGEWDPTIRIEPPKN-VPSQ-EKRKIPPLPNGVTDLGEEGEHGGHGGP-ELQRTGKFFGGFFMDIKRKAPHYLSDYTDAISLQCLASFLFLYCACMSPVITFGGLLGEATEGRISAIESLFGASMTGIAYSLFAGQPLTILGSTGPVLVFEKILFKFCKEYGLSYLSLRVCIGLWTAFFCLLLVATDASSLVCYITRFTEEAFASLICIIFIYEALEKLVHLGEHYPFNMHGDLNKLTQYSCVCTEP----------------------------KDPSNATLRYWQEKNITTSEVDWLGLDVKG-CMMYRGEFQGSACGHHGPYIPDVLFWSVILFFATVAMSSFLKEFKTSRYFPTKVRQIISDFAVFITIVTMVGIDFALGVPSPKLQVPNEFKPT--RDDRGWIISPLGPNPWWTTIITSIPALLCTILIFMDQQITAVIINRKEHKLKKGCGYHLDLFVVGVMLGVCSVMGLPWFVAATVLSISHVNSLKLESECSAPGEQPKFLGIREQRFTGLMIFLLMGCSVFMTSVLKFIPMPVLYGVFLYMGASSLRGIQFFDRLKLFGMPAKHQPDFIYLRHVPLRKVHLFTIVQLSCLAMLWIIKT-SRAAIVFPMMVLALVFIRKLLDFFFTKRELSWLDDLMPES 1020          
BLAST of slc4a-2 vs. Ensembl Cavefish
Match: slc4a10a (sodium-driven chloride bicarbonate exchanger-like [Source:NCBI gene;Acc:103033693])

HSP 1 Score: 720.694 bits (1859), Expect = 0.000e+0
Identity = 399/950 (42.00%), Postives = 584/950 (61.47%), Query Frame = 1
Query:   40 FNLSSTENNDKDNQRYLFCQLNEL---EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHH--NKCGIGSQLSLFRSIVDNPNKK-----MKQN-----PSRKTLC----ENGNEEDGLLEY-KFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEELEMELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKL--YVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQN 2823
            F L   + +++     LF +L+E+   E    +W E +RW+KFEE VE+  E WSKP+V  LSL S+   +S IL+ ++ L+    ++E++ D++L    D+++   +  EE+++ +    L  HH  N+  + +++ + RS  D   K+     M +N     P  +  C     +G+ E+  +++ K    F KKIP G+E +NILV E+ FL + +  F+RL  + ++    EV + TRF+ I+LG  G     HE GR   +++ D VF   AYKA +  DL+  IDEFLD   V+PP EW+P I+I+PPK  +P +    K  PL +    + E+ +        EL+ TG+FFGGF  D+KRK   YLSD+ D+++LQCLASF+FLY AC++P ITFGGLL +AT+G + A+ES+  A++ G+ YSLF+GQPLTILG+TGP+LVFE ++FK C  Y   +L  R+ IG W   F L++VA+D S LV Y+T FTEE FA LI +I+I +A + L  L E YP N + + N +   SC C  P                            ++ + + L Y    NIT     W   + K  C+ Y G + G+ CG    Y+PD+ F+S +L   T  M+  LK F+ S   P KVR+ I  FAV I I     IDF +G+ +PKL VP++F+PT     R WI+  LG NPWW+TI+  IPA+L  ILIFMDQQIT +I+NRK +KLKKG GYHLD+F++ +++GV S++G+PWFV +TVL+++HV SLK+ES  + PG  P FLG REQR T LMI L +G SVF T +L+ IPMPVL+GVF YMG S L  I    R+ LF + AK +PDF YL+++P+++VHLFT +Q+ CL +L+ IK+ +  ++ FP++VLA+ F+RK L+ FF++ EL WLD ++P++
Sbjct:  110 FLLGMEDEDEEHIPHALFTELDEICLREGEDAEWKETARWLKFEEDVEDGGERWSKPYVATLSLHSLFELRSCILNGIVMLDMRANSLEEIADMVL----DQQETSIALGEEVRKKIRNALLKQHHHQNQKKLANRIPIVRSFADIGKKQSEPHSMDKNGQMVSPQSQPPCTESRSDGSRENSAVDFSKIDLHFMKKIPPGAEASNILVGELEFLEKPVVAFVRLSPAVLLNGLAEVPITTRFLFILLGPMGKGPQYHEIGRSIATIMTDEVFHDVAYKAKDRSDLVAGIDEFLDQVTVLPPGEWDPTIRIEPPKN-VPSQ-EKRKIPPLPNGVTDLGEEGEHGGHGGP-ELQRTGKFFGGFFMDIKRKAPHYLSDYTDAISLQCLASFLFLYCACMSPVITFGGLLGEATEGRISAIESLFGASMTGIAYSLFAGQPLTILGSTGPVLVFEKILFKFCKEYGLSYLSLRVCIGLWTAFFCLLLVATDASSLVCYITRFTEEAFASLICIIFIYEALEKLVHLGEHYPFNMHGDLNKLTQYSCVCTEP----------------------------KDPSNATLRYWQEKNITTSEVDWLGLDVKG-CMMYRGEFQGSACGHHGPYIPDVLFWSVILFFATVAMSSFLKEFKTSRYFPTKVRQIISDFAVFITIVTMVGIDFALGVPSPKLQVPNEFKPT--RDDRGWIISPLGPNPWWTTIITSIPALLCTILIFMDQQITAVIINRKEHKLKKGCGYHLDLFVVGVMLGVCSVMGLPWFVAATVLSISHVNSLKLESECSAPGEQPKFLGIREQRFTGLMIFLLMGCSVFMTSVLKFIPMPVLYGVFLYMGASSLRGIQFFDRLKLFGMPAKHQPDFIYLRHVPLRKVHLFTIVQLSCLAMLWIIKT-SRAAIVFPMMVLALVFIRKLLDFFFTKRELSWLDDLMPES 1020          
BLAST of slc4a-2 vs. Ensembl Cavefish
Match: slc4a10a (sodium-driven chloride bicarbonate exchanger-like [Source:NCBI gene;Acc:103033693])

HSP 1 Score: 720.309 bits (1858), Expect = 0.000e+0
Identity = 399/950 (42.00%), Postives = 584/950 (61.47%), Query Frame = 1
Query:   40 FNLSSTENNDKDNQRYLFCQLNEL---EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHH--NKCGIGSQLSLFRSIVDNPNKK-----MKQN-----PSRKTLC----ENGNEEDGLLEY-KFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEELEMELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKL--YVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQN 2823
            F L   + +++     LF +L+E+   E    +W E +RW+KFEE VE+  E WSKP+V  LSL S+   +S IL+ ++ L+    ++E++ D++L    D+++   +  EE+++ +    L  HH  N+  + +++ + RS  D   K+     M +N     P  +  C     +G+ E+  +++ K    F KKIP G+E +NILV E+ FL + +  F+RL  + ++    EV + TRF+ I+LG  G     HE GR   +++ D VF   AYKA +  DL+  IDEFLD   V+PP EW+P I+I+PPK  +P +    K  PL +    + E+ +        EL+ TG+FFGGF  D+KRK   YLSD+ D+++LQCLASF+FLY AC++P ITFGGLL +AT+G + A+ES+  A++ G+ YSLF+GQPLTILG+TGP+LVFE ++FK C  Y   +L  R+ IG W   F L++VA+D S LV Y+T FTEE FA LI +I+I +A + L  L E YP N + + N +   SC C  P                            ++ + + L Y    NIT     W   + K  C+ Y G + G+ CG    Y+PD+ F+S +L   T  M+  LK F+ S   P KVR+ I  FAV I I     IDF +G+ +PKL VP++F+PT     R WI+  LG NPWW+TI+  IPA+L  ILIFMDQQIT +I+NRK +KLKKG GYHLD+F++ +++GV S++G+PWFV +TVL+++HV SLK+ES  + PG  P FLG REQR T LMI L +G SVF T +L+ IPMPVL+GVF YMG S L  I    R+ LF + AK +PDF YL+++P+++VHLFT +Q+ CL +L+ IK+ +  ++ FP++VLA+ F+RK L+ FF++ EL WLD ++P++
Sbjct:  101 FLLGMEDEDEEHIPHALFTELDEICLREGEDAEWKETARWLKFEEDVEDGGERWSKPYVATLSLHSLFELRSCILNGIVMLDMRANSLEEIADMVL----DQQETSIALGEEVRKKIRNALLKQHHHQNQKKLANRIPIVRSFADIGKKQSEPHSMDKNGQMVSPQSQPPCTESRSDGSRENSAVDFSKIDLHFMKKIPPGAEASNILVGELEFLEKPVVAFVRLSPAVLLNGLAEVPITTRFLFILLGPMGKGPQYHEIGRSIATIMTDEVFHDVAYKAKDRSDLVAGIDEFLDQVTVLPPGEWDPTIRIEPPKN-VPSQ-EKRKIPPLPNGVTDLGEEGEHGGHGGP-ELQRTGKFFGGFFMDIKRKAPHYLSDYTDAISLQCLASFLFLYCACMSPVITFGGLLGEATEGRISAIESLFGASMTGIAYSLFAGQPLTILGSTGPVLVFEKILFKFCKEYGLSYLSLRVCIGLWTAFFCLLLVATDASSLVCYITRFTEEAFASLICIIFIYEALEKLVHLGEHYPFNMHGDLNKLTQYSCVCTEP----------------------------KDPSNATLRYWQEKNITTSEVDWLGLDVKG-CMMYRGEFQGSACGHHGPYIPDVLFWSVILFFATVAMSSFLKEFKTSRYFPTKVRQIISDFAVFITIVTMVGIDFALGVPSPKLQVPNEFKPT--RDDRGWIISPLGPNPWWTTIITSIPALLCTILIFMDQQITAVIINRKEHKLKKGCGYHLDLFVVGVMLGVCSVMGLPWFVAATVLSISHVNSLKLESECSAPGEQPKFLGIREQRFTGLMIFLLMGCSVFMTSVLKFIPMPVLYGVFLYMGASSLRGIQFFDRLKLFGMPAKHQPDFIYLRHVPLRKVHLFTIVQLSCLAMLWIIKT-SRAAIVFPMMVLALVFIRKLLDFFFTKRELSWLDDLMPES 1011          
BLAST of slc4a-2 vs. Ensembl Sea Lamprey
Match: slc4a7 (solute carrier family 4 member 7 [Source:ZFIN;Acc:ZDB-GENE-140106-104])

HSP 1 Score: 650.973 bits (1678), Expect = 0.000e+0
Identity = 348/779 (44.67%), Postives = 495/779 (63.54%), Query Frame = 1
Query:  502 LCENGNEEDGLLEY-KFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEELEM--ELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKL--YVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQN 2823
            +CE    E   +++ K    F +KIP G+E +N+LV E+ FL   +  F+RL  + ++    EV +PTRF+ I+LG  G  +  HE GR   +L+ D +F   AYKA + KDL+  IDEFLD   V+PP EW+P+I+I+PPK      + + +   L    +  S+  +P  E      EL+ TGR FGG V D+KRK  FY SD+RDSLNLQC+ASF+FLY AC++P ITFGGLL +AT+G + A+ES+  A++ G+ YSLF+GQPLTILG+TGP+LVFE +++K C  Y   +L  R  IG W     L++VA+D S LV Y+T FTEE FA LI +I+I +A + L  L E Y +N + +P  +   SC C+ P+    +++LD                 + N N S    I W N+T              C++  G + G  CG    Y+PD+ F+S +L   TF ++  LK F+     P KVR T+  FAV + I    +ID+ +G+ +PKL VPS+F+PT     R WIV  +G NPWW+ + A IPA+L  IL+FMDQQIT +I+NRK +KLKKG GYHLD+  +AI++ V S++G+PWFV +TVL+++HV SLK+ES  + PG  P FLG REQR+T LMI + +G SVF T +L+ IPMPVL+GVF YMG S L  I    RI LF + AK +PDF YL+++P+++VHLFTA+Q  CL+LL+ IK+ +  ++ FP++VLA+ F+RK L+  F++ EL WLD ++P++
Sbjct:  304 VCEGRAGESSTVDFSKVDLNFLRKIPQGAEASNVLVGEVDFLERPVIAFVRLSPAVLLSGLAEVPIPTRFLFILLGPSGKATQYHEIGRSIATLMSDEIFSDVAYKAKDRKDLLSGIDEFLDQVTVLPPGEWDPSIRIEPPKN-----VPSQEKRKLPSLVNGASQALEPEHESHGAGPELQRTGRIFGGLVRDIKRKIPFYWSDYRDSLNLQCIASFLFLYCACMSPVITFGGLLGEATEGRISAIESLFGASMTGIAYSLFAGQPLTILGSTGPVLVFEKILYKFCKDYNLSYLSLRACIGLWTAFLCLLLVATDASSLVCYITRFTEEAFASLICIIFIYEALEKLVHLGETYEVNMHADPELLTQYSCVCVEPS-VPSNETLD----------------AWSNMNRSAD-SIPWGNLT-----------VSKCLELHGQFVGTACGHHGPYIPDVLFWSIILFFATFFLSGFLKQFKTMRYFPTKVRSTVSDFAVFLTILSMVVIDYFLGIPSPKLQVPSEFKPT--RDDRGWIVDPIGPNPWWTILAAAIPALLCTILVFMDQQITAVIINRKEHKLKKGCGYHLDLLWVAIMLAVCSIMGLPWFVAATVLSISHVNSLKVESECSAPGEQPKFLGIREQRVTGLMIFVLMGCSVFMTGVLKFIPMPVLYGVFLYMGASSLKGIQFFDRIKLFVMPAKHQPDFIYLRHVPLRKVHLFTAVQFTCLVLLWVIKA-SPAAIVFPMMVLALVFIRKLLDFCFTKRELSWLDDLMPES 1045          

HSP 2 Score: 85.5001 bits (210), Expect = 4.182e-17
Identity = 44/142 (30.99%), Postives = 82/142 (57.75%), Query Frame = 1
Query:   58 ENNDKDNQRY-LFCQLNEL---EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHHNKCGIGSQLSLFRSIVDNPNK 471
            E++D+++  + LF +++EL   +    +W E +RW+KFEE VE+  E WSKP+V  LSL S+   +S I++  + L+ +   +E++ DL+L   I   +LD +  + ++Q L   H   H ++  +  ++ + RS+ D   K
Sbjct:   14 EDDDEEHVSHDLFTEMDELCMRDGEECEWRETARWLKFEEDVEDGGERWSKPYVATLSLHSLFELRSCIMNGTVMLDMKATTLEEIADLVLDSQIASGQLDVAVRDRVRQALLKRHH--HQSEKKLSHRIPIVRSLADMGKK 153          
BLAST of slc4a-2 vs. Ensembl Sea Lamprey
Match: slc4a7 (solute carrier family 4 member 7 [Source:ZFIN;Acc:ZDB-GENE-140106-104])

HSP 1 Score: 432.18 bits (1110), Expect = 1.133e-135
Identity = 239/572 (41.78%), Postives = 340/572 (59.44%), Query Frame = 1
Query:  559 FKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEELEM--ELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKL--YVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDM 2262
            F +KIP G+E +N+LV E+ FL   L  F+RL  + ++   TEV +PTRF+  +LG  G     HE GR   +L+ D +F   AYKA +  DL+  IDEFLD   V+PP EW+P+I+I+PPK      + + +   + +  +  +   +P  E   M  EL+ TGR FGG V D+KRK  +Y SD+RD+L+LQC+ASF+FLY AC++P ITFGGLL +AT+  + A+ES+  A++ G+ +SLF+GQPLTILG+TGP+LVFE +++K C  Y   +L  R  IG W     L++VA+D S LV Y+T FTEE FA LI +I+I +A + L  L E Y +N + +   + + SCSC+ P         D   + LL ++   + P            I W N+T              C    G + G+ CG    +VPD+ F+S +L   T  ++   K F+     P KVR T+  FAV + I    L+D+ +G+ +PKL VPS+F+PT     R W V  +G NPWW+   A +PA+L  ILIFMDQQIT +I+NRK +KLKKG GYHLD+
Sbjct:  413 FMRKIPPGAEASNVLVGEVDFLERPLIAFVRLSPAVLLTGITEVPIPTRFLFFLLGPPGKAQQYHEIGRSIATLMADEIFHDVAYKAKDRNDLLAGIDEFLDQVTVLPPGEWDPSIRIEPPKS-----VPSQEKRKMPNVPNGGAPGAEPEHEGHGMGPELQRTGRLFGGLVVDIKRKLPWYWSDYRDALSLQCVASFLFLYCACMSPVITFGGLLGEATENRISAIESLFGASMTGIAFSLFAGQPLTILGSTGPVLVFEKILYKFCKDYGLSYLSLRASIGLWTAFLCLLLVATDASSLVCYITRFTEEAFASLICIIFIYEALEKLVHLGETYEVNSHGDLEQLTHYSCSCVEPQ--------DPSNKTLLLWQNLNVTPD----------SIPWANLT-----------VSTCQQLHGDFVGSACGHHGPFVPDVLFWSVILFFCTVFLSAFFKQFKTMRYFPTKVRSTVSDFAVFLTILSMVLVDYALGIPSPKLKVPSEFKPT--RDDRGWFVNPIGTNPWWTFPAALVPALLCTILIFMDQQITAVIINRKEHKLKKGCGYHLDL 948          

HSP 2 Score: 88.9669 bits (219), Expect = 2.964e-18
Identity = 49/180 (27.22%), Postives = 96/180 (53.33%), Query Frame = 1
Query:   52 STENNDKDNQRY-LFCQLNEL---EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHHNKCGIGSQLSLFRSIVDNPNKKMKQNPSRKTLCENGNEEDGLLEYKFCSRFKKKIPL 579
             TE++D+++  + LF +++E+   +   ++W E +RW+KFEE VE+  E WSKP+V  LSL S+   +S I+   + L+ +   ++++ D++L   +    LD S  + ++  L   H   H N   + +++ + RS+ D   K    +       ++ N+E GLL ++  S    ++ L
Sbjct:   99 GTEDDDEEHIPHDLFTEMDEICMRDGDESEWRETARWLKFEEDVEDGGERWSKPYVATLSLHSLFELRSCIMSGTVMLDMKASTLDEIADMVLDNQVSSGLLDESVRDRMRDALLRKHR--HQNDSKLSNKIPIVRSLADMGKKYSDVH------VQDKNDEAGLLAFRHSSLTASRLSL 270          
BLAST of slc4a-2 vs. Ensembl Sea Lamprey
Match: SLC4A4 (solute carrier family 4 member 4 [Source:HGNC Symbol;Acc:HGNC:11030])

HSP 1 Score: 395.971 bits (1016), Expect = 1.748e-127
Identity = 216/497 (43.46%), Postives = 310/497 (62.37%), Query Frame = 1
Query: 1030 ELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKT--ILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFS----WNTHNFKQMCVDYGGTWAGNTCGKLYVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMP 2502
            EL+ TGR FGG   D+KRK  F+ SD  D+L++Q L++ +F+Y A +   ITFGGLL  ATD   G +ES L  A+ G ++ LF+GQPL IL +TGP+LVFE ++F       +D+L FR+WIG W     LI+VA+D S LV+Y T FTEE F+ LIS I+I  A + +  L   YPIN ++ P+YI   SC+C  P+     ++ +L   T             G  ++ FS         ++D YFS    W+  + K+ C  YGG+ +G  C   +VPD+   S +L +GT+     LK F+     P  VR+ I  F+++ +I +F  +D ++G+ TPKL+VPS+F+PT   + R W VP  G NPWW  +++ +PAIL  IL+FMDQQIT IIVNRK NKLKKG GYHLD+F +A+L+   S +G+PW+V +TVL++ H+ SLK+E+  + PG  P FLG REQR+T +++ +  G SVF  P+L++IP P
Sbjct:   26 ELQRTGRLFGGLFKDIKRKLPFFCSDIYDALSIQSLSATLFIYLATITNAITFGGLLGDATDNMQGVLESFLGTALSGAVFCLFAGQPLIILSSTGPVLVFERLLFNFSKENDFDYLEFRLWIGLWSAFMSLILVATDASYLVQYFTRFTEEGFSALISFIFIYDAIKKMLGLFNYYPINLDYKPDYITLYSCTCQAPDPVNYFVNGTLTVATTL-----------GPNDTIFS---------LSDQYFSVRPDWSALS-KKECSKYGGSLSGKACK--FVPDVALVSLLLFMGTYYTTMALKRFKTGRYFPTTVRKLISDFSIIFSILLFCGLDALVGLETPKLLVPSEFKPT--SAKRGWFVPPFGGNPWWVYLVSAVPAILITILVFMDQQITAIIVNRKENKLKKGSGYHLDLFWVAVLMATCSFLGLPWYVAATVLSIAHIDSLKMETETSAPGEQPKFLGVREQRITGVLVFVLTGVSVFLAPILKKIPRP 497          
BLAST of slc4a-2 vs. Ensembl Sea Lamprey
Match: SLC4A4 (solute carrier family 4 member 4 [Source:HGNC Symbol;Acc:HGNC:11030])

HSP 1 Score: 389.423 bits (999), Expect = 1.170e-125
Identity = 207/485 (42.68%), Postives = 298/485 (61.44%), Query Frame = 1
Query: 1048 RFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKLYVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMP 2502
            R FGG   D+KRK  F+ SD  D+L++Q L++ +F+Y A +   ITFGGLL  ATD   G +ES L  A+ G ++ LF+GQPL IL +TGP+LVFE ++F       +D+L FR+WIG W     LI+VA+D S LV+Y T FTEE F+ LIS I+I  A + +  L   YPIN ++ P+YI   SC+C  P+  ++ K                  P   N+        DW+ ++           K+ C  YGG+ +G  C   +VPD+   S +L +GT+     LK F+     P  +R+ I  F+++++IF F  +D +IG+ TPKL+VP++F+PT   + R W VP  G NPWW  +++ +PAIL  IL+FMDQQIT IIVNRK NKLKKG GYHLD+F +A+L+   S +G+PW+V +TVL++ H+ SLK+E+  + PG  P FLG REQR+T +++ +  G SVF  P+L++IP P
Sbjct:    1 RLFGGLFKDIKRKLPFFCSDIYDALSIQSLSATLFIYLATITNAITFGGLLGDATDNMQGVLESFLGTALSGAVFCLFAGQPLIILSSTGPVLVFERLLFNFSKENDFDYLEFRLWIGLWSAFMSLILVATDASYLVQYFTRFTEEGFSALISFIFIYDAIKKMLGLFNYYPINLDYKPDYITLYSCTCQAPDPVLMIK------------------PDLGNATGP-----DWSALS-----------KKECSKYGGSLSGKACK--FVPDVALVSLLLFMGTYYTTMALKRFKTGRYFPTTIRKLISDFSIILSIFTFVGLDILIGLETPKLVVPTEFKPT--SAKRGWFVPPFGGNPWWVYLVSAVPAILITILVFMDQQITAIIVNRKENKLKKGSGYHLDLFWVAVLMATCSFLGLPWYVAATVLSIAHIDSLKMETETSAPGEQPKFLGVREQRITGVLVFVLTGVSVFLAPILKKIPRP 447          
BLAST of slc4a-2 vs. Ensembl Sea Lamprey
Match: SLC4A4 (solute carrier family 4 member 4 [Source:HGNC Symbol;Acc:HGNC:11030])

HSP 1 Score: 380.948 bits (977), Expect = 1.820e-122
Identity = 206/485 (42.47%), Postives = 295/485 (60.82%), Query Frame = 1
Query: 1048 RFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKLYVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMP 2502
            R FGG   D+KRK  F+ SD  D+L++Q L++ +F+Y A +   ITFGGLL  ATD   G +ES L  A+ G ++ LF+GQPL IL +TGP+LVFE ++F       +D+L FR+WIG W     LI+VA+D S LV+Y T FTEE F+ LIS I+I  A + +  L   YPIN ++ P+YI   SC+C  P+         E  ++L              +  +  LY                  K+ C  YGG+ +G  C   +VPD+   S +L +GT+     LK F+     P  +R+ I  F+++++IF F  +D +IG+ TPKL+VP++F+PT   + R W VP  G NPWW  +++ +PAIL  IL+FMDQQIT IIVNRK NKLKKG GYHLD+F +A+L+   S +G+PW+V +TVL++ H+ SLK+E+  + PG  P FLG REQR+T +++ +  G SVF  P+L++IP P
Sbjct:    1 RLFGGLFKDIKRKLPFFCSDIYDALSIQSLSATLFIYLATITNAITFGGLLGDATDNMQGVLESFLGTALSGAVFCLFAGQPLIILSSTGPVLVFERLLFNFSKENDFDYLEFRLWIGLWSAFMSLILVATDASYLVQYFTRFTEEGFSALISFIFIYDAIKKMLGLFNYYPINLDYKPDYITLYSCTCQAPDP--------EWGKKL------------NTAVINAALYN-----------------KKECSKYGGSLSGKACK--FVPDVALVSLLLFMGTYYTTMALKRFKTGRYFPTTIRKLISDFSIILSIFTFVGLDILIGLETPKLVVPTEFKPT--SAKRGWFVPPFGGNPWWVYLVSAVPAILITILVFMDQQITAIIVNRKENKLKKGSGYHLDLFWVAVLMATCSFLGLPWYVAATVLSIAHIDSLKMETETSAPGEQPKFLGVREQRITGVLVFVLTGVSVFLAPILKKIPRP 444          
BLAST of slc4a-2 vs. Ensembl Yeast
Match: BOR1 (Boron efflux transporter of the plasma membrane; binds HCO3-, I-, Br-, NO3- and Cl-; has similarity to the characterized boron efflux transporter A. thaliana BOR1 [Source:SGD;Acc:S000005219])

HSP 1 Score: 84.7297 bits (208), Expect = 2.383e-17
Identity = 53/156 (33.97%), Postives = 88/156 (56.41%), Query Frame = 1
Query: 1072 DVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNL 1539
            D+K +  +Y SD+ D+ N + + S +  YF  L P I F   +   TD   G  E +L++A+ G+++ +  GQPL I+G TGP+ +F   V++I       +  F  WI  W MIF L++  ++   L++Y+TTF  + F + I+++YI K  Q L
Sbjct:   65 DLKDRIPYYKSDWVDAFNYRVIPSIVDTYFNNLLPAIAFAQDMFDRTDNSYGVNEVLLSSAMAGIVFGVLGGQPLCIVGVTGPISIFNYTVYEIIKPLNTSYFGFMFWICMWSMIFHLVLAFTNAVCLLQYVTTFPCDIFGLFINVVYIQKGIQIL 220          

HSP 2 Score: 72.7886 bits (177), Expect = 1.481e-13
Identity = 82/318 (25.79%), Postives = 137/318 (43.08%), Query Frame = 1
Query: 1906 AYGL--KIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIG----MNTPKLIVPSKFEPT--LGYSSRTWIV--PILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPM---LQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQ 2820
            A+GL  K+F    L   ++R  I  ++  +++  ++      G    +   KL +   F PT  +     TW+   PI    P     +A    I   IL + D  ++ ++  R   KLKK   +H D  ++ +   ++ ++G+P   G    A  H  +L +  SN         + C EQR T+    L I       P+   L  IP  VL G+FF MG++ L    +IQR+   F +  +R +   L  +  K + +F +  +      F I +  I ++ FP+++L    V  S    F  EELK LD  + Q
Sbjct:  248 AFGLFFKLFHYYPLFSHRIRTFISDYSTALSVLFWSSFTHFGGYLHDVKFKKLPITKAFFPTSKVNRPQNTWLAYEPI----PVKDVFIALPFGIFLTILFYFDHNVSSLMAQRHQYKLKKPSSFHYDFALLGLTTCISGVLGIPAPNGLIPQAPLHTETLLVRDSNQ------KVISCVEQRFTNTFQGLMI-LGTMTRPLLVCLGEIPQAVLSGLFFIMGINGLMTNSIIQRLVFLFSDPNRRDNTSPLMKVSKKSMLIFLSFSLTGFAGEFAITN-TIAAIGFPLVLLLSVLVSFSFAYIFPTEELKILDTNVAQ 553          
BLAST of slc4a-2 vs. Ensembl Nematostella
Match: EDO45844 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRK7])

HSP 1 Score: 301.982 bits (772), Expect = 1.347e-87
Identity = 178/517 (34.43%), Postives = 276/517 (53.38%), Query Frame = 1
Query:   91 FCQLNELEPSSN--KWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHHNKCGIGSQLSLFRSIVDNPNKKMKQNPSRKTLCE-------NGNEEDGLLEYKFC------------SRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKD-EPLHHEDDSISEKYKPTQEELEMELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRN 1575
            F +L EL       +W E +RW+KFEE VE++   WSKPHV  LS  S+L  +  +    + L+ E  +++ + + I+   +   +L     + +   L + H + +     +  + S +      PN   + N   K   +         +EE  ++  K              S  K ++P  +E  N+LV  +  L   +  F+RL +   +G  TEV +P RF+ ++LG +      HE GR   +L+ D VF   AY +   +D++ AI+EFLD  +V+PP EW+  +       +IP  L+ +K       +   I+       EE +  LK TGRF GG + D+K + K Y+SDF+D  N QCL   +FLYFA  AP + FGGLL + TD +LG  E I A+   G+L++LFSGQPL I+G TGP++VFE  +FK C     +FLP+R WIGFW+++ L ++VA +   LV+Y T FTEE FA LISLI+I +A   L+++ +  P++R+
Sbjct:   56 FIELQELTGKDQDMRWKETARWIKFEEDVEDSNR-WSKPHVASLSFHSLLELRKGLERGTVLLDLEQFDLQSIAEAIVDNMVITDQLCKEDSDRVLSALLVKHKHQYQEAGNLPRRPSFYNLKTFTPNLSRRNNEEDKNSVKMVVTQKVPVDEETDMIRLKIDDNIDVGSHTNQESDVKARVPEDAEATNVLVGTLDCLKNPVTAFVRLAKGCYLGNVTEVAIPVRFLFVMLGPETQSDTYHEIGRSIATLMSDQVFHDLAYYSESREDILMAINEFLDDTVVLPPGEWDKQL-------LIPVLLSQSKTMAKRRKQAKEINAIATQAAEEEDNPLKRTGRFCGGLIQDIKHRSKTYISDFKDGFNWQCLLVTVFLYFAVFAPNVAFGGLLAEKTDQWLGVSEVIFASCFCGLLFALFSGQPLIIIGATGPVMVFEQTIFKFCEQSNIEFLPWRCWIGFWVLVILFLVVAFEGCFLVRYFTRFTEELFACLISLIFIYEAINFLYKVFKKNPLSRD 564          

HSP 2 Score: 190.274 bits (482), Expect = 1.262e-49
Identity = 109/322 (33.85%), Postives = 188/322 (58.39%), Query Frame = 1
Query: 1855 PDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVI--GMNTPKL----IVPSKFEPTLGYSSRTWIVPILG-----KNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQE 2787
            P+     ++LM GT+ +A+ ++ FRNS     K R  +  F + IA+    +ID  I   + TPK+    +    F PTL  + R W +  +G     K  W     A IPA+   IL+FM+ ++T +++N+K N L+K  GY++D+ ++ ++  + SL G+PW   +TV +++H  +L + S+++ PG  P  +  REQR+T+++I +  G S+   P+L  +P+PVLFGV  Y+G+S LS + +I R+ +  +  K  PD +Y++ +P  ++H +T IQ+ CLL+L  +K + IL+ SFP  ++ +  VR+ L   FSQ 
Sbjct:  587 PNTALLCAILMFGTYFVAFYMRKFRNSHFFGKKARRLVSDFGIAIAMITMVIIDVAIRDTVITPKISIGDVTKVGFHPTLK-TKRGWFINPMGLVDSMKAGW--VFAAIIPALFVGILLFMETELTGVLINKKENCLQKRPGYNMDLLLMGVITLICSLFGLPWMCPATVRSVSHFNALSVWSTSHAPGEKPYLVEVREQRITNILIHVLTGMSILLAPVLHHVPVPVLFGVLLYLGLSSLSNLQLINRLIMMLMPPKHHPDVRYVRKVPTAKIHGYTLIQLACLLVLMAVK-LTILAPSFPFFIICLIPVRRLLGKVFSQH 904          
BLAST of slc4a-2 vs. Ensembl Nematostella
Match: EDO31793 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWX4])

HSP 1 Score: 266.159 bits (679), Expect = 3.171e-75
Identity = 178/532 (33.46%), Postives = 273/532 (51.32%), Query Frame = 1
Query:   91 FCQLNELEPSSNK--WYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHHN-----KCGIG-SQLSLFRSIVDNPNKKMKQNP--------------SRKTLCENGNEEDGL----LEYKFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKID--PPKEMIPDRLANNKDEPLHHEDDSIS--EKYKPTQEELEME---LKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPN 1587
            F +L EL  S +K  W E +RW+KFEE VE     W KPH+  L   S    +++  +  + L+ + + +  + + +  K I + KL    E+E    LS+  L PH +     + G G  +LS    I     +   QN               + K        +D L    ++ K  S    +IP  +E   +LV     LS     F+RL +   +    EV++P RF+ I+LG      + HE GR   +L+ D +F   AY A E +DL  A+D FL   ++IPP EW+ N+     P       + A  +   L  +    S  E  +   E LE+E   LK TG F GG + DVKR+  +Y SD  DS N +C+ + I +Y ACLAP I+FGGLL K T G++G  E I++ A+ GV+++LF+GQPL I+G TGPLL+FE+ VF +   + ++++P+R W+G W+M+    +VA +   L++Y T FTEE FA +ISLI+I    + ++++   YP+      N
Sbjct:   16 FVELEELSCSDDKLIWKETARWIKFEEDVEKNANRWGKPHIPCLGFHSCQEVRTVFQNGCLLLDLDEDQLPSIAEAVASKLISDGKL---SEKEHDAFLSIL-LTPHEHQFQKQRSGGGIRKLSTIHPIGKEQGRNTNQNDFFSILFSSIPHVEIATKPGGNTSRAQDSLAVDTIDNK-VSSIDARIPKDAEATTVLVGGHKHLSAPEGAFVRLARGCRLRNLAEVNIPVRFLFILLGPDDKSIDYHEVGRCVATLMSDRLFLDCAYDAEELQDLYDAMDSFLSDTVIIPPGEWDRNVLAQSLPSLAKETKKTALRRRGALLRKQRHFSDLETQETVTESLELEDDPLKRTGLFCGGLLRDVKRRFPYYKSDMTDSFNWRCVMATILVYVACLAPAISFGGLLYKKTKGWMGVAEMIVSTALSGVIFALFAGQPLIIIGATGPLLLFETNVFNLSESFDFEYMPWRAWVGIWVMLICWALVAMEGCFLIRYFTRFTEEIFACMISLIFIYDGIKYIYDIFGLYPLTSGTTEN 542          

HSP 2 Score: 198.749 bits (504), Expect = 2.009e-52
Identity = 105/316 (33.23%), Postives = 188/316 (59.49%), Query Frame = 1
Query: 1852 VPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDF-VIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWST---ILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQE 2787
            V +   F+++L  GTF +A+ ++  R+S  L   +R  I  F V+IAI    L++     +   +L VP  F+ T  +  R W V  +G            A +PAIL  IL+FM+ +   +I+++K N+LKKG GY+LD+F++  L+G+ S++G+PW   + V  ++H+ +L + S+N+ PG  P  L  +EQR+T+++I + IG ++   P+++  P+ VLFGVF ++G S LS +  ++R  L F++    PD +Y++ +   +++ FT +QV+CLL L  IK + +++  FP  V+ +  +R+ LE F++ +
Sbjct:  548 VSNTALFTTILFFGTFFVAHIIRDVRHSRFLNHTLRRVISDFGVLIAIVAMILVELSAQSIYVQRLNVPDGFDVTSPHL-RGWYVNPMGTERRLGADAIFGALVPAILVSILVFMEVEFCNVILDKKDNQLKKGPGYNLDLFVVGFLMGMCSVLGLPWMCATPVHTVSHLHALMVHSTNHAPGEHPQLLEVKEQRVTNIIIHVLIGLTMLLAPVIRLTPVVVLFGVFVHLGFSSLSHLQFVERFKLLFVSPNHHPDRRYVRSVSTGKMNAFTLVQVVCLLFLVAIK-VTVVAPFFPFFVICLVPLRRMLERFYTDQ 861          
BLAST of slc4a-2 vs. Ensembl Nematostella
Match: EDO27089 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TA82])

HSP 1 Score: 109.383 bits (272), Expect = 2.894e-28
Identity = 62/114 (54.39%), Postives = 84/114 (73.68%), Query Frame = 1
Query: 1228 AMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPIN 1569
            AME +L  AI G+L++LFSGQPL ILG TGP+LVFE +V+  C     ++L FR+WIG W M+F LI+V +D S ++ Y T FTEE FA LI++IYI + F+ LF +L+DYPI+
Sbjct:    1 AMEQMLGGAIGGILFALFSGQPLIILGATGPMLVFEEIVYTFCERVGLEYLSFRLWIGIWTMLFCLILVVTDASAMICYFTRFTEETFATLIAIIYIYEGFKKLFHILDDYPIH 114          
BLAST of slc4a-2 vs. Ensembl Nematostella
Match: EDO40610 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6T5])

HSP 1 Score: 110.923 bits (276), Expect = 2.180e-26
Identity = 81/277 (29.24%), Postives = 137/277 (49.46%), Query Frame = 1
Query: 1924 FRNSDLLPCKVRETIGTFAVVIAIFMFTLID--FVIG--MNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSL-KIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPM-LQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLL--FTIKSINILSVSFPI 2730
            F+ S  L    RE +  +A+ +A+  F+ I   F  G  ++T K       +P+         V       + +  L F  ++L     FMDQ I+  +VN   N+LKKG  +HLD+ ++AI+ G+ S  G+PW  G+   +  HV +L  +E   +   V  + +  RE R+T L+  + IG S+   P  L  IP  VL G+F ++ V+ L +  M +R+ LF       P   Y++ +P +++H +T +Q+L L +L  F    +  L + FP+
Sbjct:   29 FKKSPFLDANKREALADYALPVAVLFFSFIGTYFFSGESLHTFKSSGAVTLKPSSLSLLSAGAV-------FGACGLGFCLSLL----FFMDQNISSAMVNNPGNRLKKGSAFHLDLLVVAIINGILSAFGLPWIHGALPHSPLHVRALADVEERVDQGHVFDIIVKVRETRLTTLIAHILIGLSLLMLPTPLDYIPTAVLDGLFLFVAVTSLDDNQMFERLLLFVTEQSAYPPNHYIRRVPQRKMHAYTGMQMLQLGILCGFGFSPMPYLKMVFPV 294          
BLAST of slc4a-2 vs. Ensembl Nematostella
Match: EDO40611 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6T6])

HSP 1 Score: 73.1738 bits (178), Expect = 3.830e-13
Identity = 52/186 (27.96%), Postives = 95/186 (51.08%), Query Frame = 1
Query: 2185 DQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSL-KIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPM-LQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLL--FTIKSINILSVSFPI 2730
            D  + V+  +    +LKKG  +HLD+ ++AI+ G+ S  G+PW  G+   +  HV +L  +E   +   V  + +  RE R+T L+  + IG S+   P  L  IP  VL G    +  S  +++  +     F + +   P+  Y++ +P +++H +T +Q+L L +L  F    +  L + FP+
Sbjct:  469 DIVVVVLCSSTHIQELKKGSAFHLDLLVVAIINGILSAFGLPWIHGALPHSPLHVRALADVEERVDQGHVFDIIVKVRETRLTTLIAHILIGLSLLMLPTPLDYIPTAVLDG----LASSHNAQVFALLENNCFLLQSAYPPN-HYIRRVPQRKMHAYTGMQMLQLGILCGFGFSPMPYLKMVFPV 649          

HSP 2 Score: 70.0922 bits (170), Expect = 3.474e-12
Identity = 64/247 (25.91%), Postives = 114/247 (46.15%), Query Frame = 1
Query:  586 EVANILVA--EIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILG---TKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHED--DSISEKYKPTQEELEMELKITGRFFGGFVDDVKRKKKFYLSDFRDSLN-----LQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQ 1290
            E  N LVA  ++  + ++     RL+ ++ +G   +    T  +++IL    TK T +++ E GR   +LL D  FR+S  +A   ++ ++ + E                 K D         L+NN+++P  +     S S+ + P       +   T +   G  DD  R+   YLSDF+D +       + +++ IFLYFAC+ P++ FG L  K T G +   + +++    G+ +SL  GQ
Sbjct:  110 ETQNWLVAMADLPSIQQSHIAMSRLRHATNLGRTLQ---GTHLVVLILSPVKTKKTKNSL-ELGRTFATLLSDIDFRQSLLEAESKEEFVKVLAER----------------KSD---------LSNNRNKPEINSKLVRSASKGFNPYHCVFNFQETSTMKPCRGIRDDFMRRMPHYLSDFKDGVVGHRTLFKLVSTVIFLYFACILPSVAFGVLNSKNTKGKMDVQKVLVSQVFGGLFFSLLGGQ 327          
BLAST of slc4a-2 vs. Ensembl Medaka
Match: slc4a8 (electroneutral sodium bicarbonate exchanger 1 [Source:NCBI gene;Acc:101162907])

HSP 1 Score: 716.457 bits (1848), Expect = 0.000e+0
Identity = 392/950 (41.26%), Postives = 564/950 (59.37%), Query Frame = 1
Query:   52 STENNDKDNQRYLFCQLNEL---EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHHNKCGIGSQLSLFRSIVDNPNKKMKQ------NPSRKTLCE-----------NGNEEDGLLEYKFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANN-----KDEPLHHEDDSISEKYKPTQEELEMELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKL--YVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQ 2820
             TE + +     LF +L+E+   +    +W E +RW+KFEE VE+  E WSKP+V  LSL S+   +S I++  + L+   + IE++ D++L       +LD +    +++ L   H   HH      + + + RSI +   K+ +       +P+    C+            G +   +   K    F KKIP G+E +N+LV  + FL   +  F+RL  + ++   TEV +PTRF+ I+LG  G     HE GR   +++ D +F   AYKA +  DL+  IDEFLD   V+PP EW+P+I+I+PPK  +P +            P   E++  +E++ P       EL+ TGR FGG + D+KRK  FYLSDF+D L+LQC+ASF+FLY AC++P ITFGGLL +AT+G++ A+ES+  A++ G++YSLF+GQPLTILG+TGP+LVFE ++FK C  Y   +L  R  IG W     LI+VA+D S LV Y+T FTEE FA LI LI+I +A + LF L E YP N + + + +    C C  P+                            N     L      NI+    SW+    K+ C+   G + G  CG    Y PD+ F+S++L   TF M+  LK F+ S   P KVR  I  FAV + I +  L+DFVIG+ T KL VPSKF+PT     R W +  LG NPWW+ I+A  PA+L  ILIFMDQQIT +I+NRK +KL KG GYHLD+ ++ +++ V S++G+PWFV +TVL+++HV SLK+ES +  PG  P FLG REQR+T L+I L +G SVF T  LQ IPMPVL+GVF YMG S L  I    R+ LF + AK +PDF YL+++P+++VHLFT  Q+ CL+LL+ IK+ +  ++ FP++VLA+ F+RK L+  FS+ EL +LD ++P+
Sbjct:  101 GTEEDAEHVSHELFTELDEICVKDGKDAEWKETARWLKFEEDVEDGGERWSKPYVATLSLHSLFELRSCIINGSVLLDMHADCIEEIADMVLDHQEASHELDDTVRVRVREALLKRH---HHQNMKKKNLIPIVRSITEGTRKQSEAFLSATLHPAGSVTCQPPPASEPAKNVAGQDSSQVDLSKVDLHFMKKIPEGAEASNVLVGVLDFLERPVVAFVRLSPAVVLTGLTEVPIPTRFLFILLGPDGKAQQYHEIGRSMATIMTDEIFHNVAYKAKDRSDLLAGIDEFLDQVTVLPPGEWDPSIRIEPPKS-VPSQEKRKMPGVPNGTPCEVEEELHAEQHGP-------ELQRTGRLFGGLILDIKRKVPFYLSDFKDGLSLQCVASFLFLYCACMSPVITFGGLLGEATEGHISAIESLFGASMTGMVYSLFAGQPLTILGSTGPVLVFEKILFKFCKEYDLSYLSLRTCIGLWTAFLCLILVATDASSLVCYITRFTEEAFAALICLIFIFEALEKLFYLGEQYPYNAHSDLDRLTLAHCRCAEPD----------------------------NPRNETLKMWSDRNISASSVSWDNLTVKE-CISLHGQFVGTACGHHGPYTPDVLFWSAILFFSTFFMSASLKQFKTSRYFPTKVRSVISDFAVFLTIVIMVLLDFVIGVQTQKLKVPSKFQPT--RDDRGWFISPLGPNPWWTAIVACFPALLCTILIFMDQQITAVIINRKEHKLLKGCGYHLDLLMVGVMLAVCSIMGLPWFVAATVLSISHVNSLKLESESAAPGEQPRFLGIREQRLTGLLIFLLMGCSVFMTKALQFIPMPVLYGVFLYMGASSLKGIQFFDRLKLFGMPAKHQPDFIYLRHVPLRKVHLFTVTQLTCLVLLWVIKT-SPAAIVFPMMVLALVFIRKLLDLCFSKRELSYLDDLMPE 1007          
BLAST of slc4a-2 vs. Ensembl Medaka
Match: slc4a10b (solute carrier family 4 member 10 [Source:NCBI gene;Acc:101174961])

HSP 1 Score: 705.671 bits (1820), Expect = 0.000e+0
Identity = 397/949 (41.83%), Postives = 579/949 (61.01%), Query Frame = 1
Query:   40 FNLSSTENNDKDNQRYLFCQLNEL---EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHH--NKCGIGSQLSLFRSIVD--------NPNKKMKQNPSRKTL-CENG----NEEDGLLEY-KFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEELEMELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKL--YVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQN 2823
            F L + +++++     LF +++E+       ++W E +RW+KFEE VE+  E WSKP+V  LSL S+   +S I+++ + L+     IE++ D++L    D ++L     +EL+Q +    L  HH  N+  + ++L + RSI D        N +K  +   S+  L C +G    + E+  +++ K    F KKIP G+E  N+LV E+ FL++ +  F+RL  + ++    EV + TRF+ I+LG  G  +  HE GR   +L+ D VF   AYKA +  DLI  IDEFLD   V+PP EW+P I+I+PPK  +P +    K   L   +  +  + +        EL+ TGR FGG + D+KRK   YLSD+ D++NLQC+ASF+FLY AC++P ITFGGLL +AT+G + A+ES+  A++ G+ YSLF+GQPLTILG+TGP+LVFE ++FK C  Y   +L  R  IG W     L++VA+D S LV Y+T FTEE FA LI +I+I +A + L  L E +P N+N N N +   SC+CI P+         + T   LKF                    + NN+T     W     K  C++  G + G+ CG    YVPD+ F+  +L   T  M+  LK F+ S+  P KVR  I  FAV   I    L+D+ +G+ +PKL VPS F+PT     R W +  LG NPWW+ I+  +PA+L  ILIFMDQQIT +I+NRK NKLKKG GYHLD+F++ +++GV SL+G+PWFV +TVL++ HV SLK+ES  + PG  P FLG REQR T LMI   +G SVF T +L+ IPMPVL+GVF YMG S L  I    R+ LF +  K +PDF YL+++P++++HLFT IQ+ CL+LL+ IK+ +  ++ FP++VLA+ F+RK ++C F++ EL WLD ++P++
Sbjct:  108 FLLGAEDDDEEHIPHDLFTEMDEICVKNGEDSEWRESARWLKFEEDVEDGGERWSKPYVATLSLHSLFELRSCIINSTVLLDMRANTIEEIADMVL----DHQELYSPLGDELRQKVRETLLKKHHHQNQKKLANRLPIVRSIADMGRRASDFNLDKNGQMMASQSQLACPDGKADVSRENSSVDFSKIDLHFMKKIPPGAEACNVLVGELEFLNKPVVAFVRLSPAMLLNGLAEVPIATRFLFILLGPFGRAAQYHEIGRSIATLMTDEVFHDVAYKAKDRNDLIAGIDEFLDQVTVLPPGEWDPTIRIEPPKN-VPSQEKRKKSNIL--SNGLVDGEEEEAHGHGGPELQRTGRLFGGLILDIKRKVPHYLSDYTDAINLQCIASFLFLYCACMSPVITFGGLLGEATEGRISAIESLFGASLTGIAYSLFAGQPLTILGSTGPVLVFEKILFKFCKEYGLSYLSLRTCIGLWTAFLCLLLVATDASSLVCYITRFTEEAFASLICIIFIYEALEKLTHLGEHFPFNKNNNLNKLTTYSCTCIEPS---------DPTNETLKF-------------------WEINNVTASEIYWEAMEAKD-CIEKQGEFVGSACGPHGPYVPDVLFWCVILFFSTVFMSAFLKEFKFSNYFPTKVRSIISDFAVFFTILTMVLVDYALGVPSPKLKVPSVFKPT--RDDRGWFINPLGPNPWWTVIITVVPALLCTILIFMDQQITAVIINRKENKLKKGCGYHLDLFMVGLMLGVCSLMGLPWFVAATVLSITHVNSLKLESECSAPGEQPKFLGIREQRFTGLMIFTLMGCSVFMTSVLKFIPMPVLYGVFLYMGASSLRGIQFFDRLTLFGMPPKHQPDFIYLRHVPLRKIHLFTIIQLSCLVLLWIIKT-SRAAIVFPMMVLALVFIRKLMDCIFTKRELSWLDDLMPES 1017          
BLAST of slc4a-2 vs. Ensembl Medaka
Match: slc4a10b (solute carrier family 4 member 10 [Source:NCBI gene;Acc:101174961])

HSP 1 Score: 705.286 bits (1819), Expect = 0.000e+0
Identity = 397/949 (41.83%), Postives = 579/949 (61.01%), Query Frame = 1
Query:   40 FNLSSTENNDKDNQRYLFCQLNEL---EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHH--NKCGIGSQLSLFRSIVD--------NPNKKMKQNPSRKTL-CENG----NEEDGLLEY-KFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEELEMELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKL--YVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQN 2823
            F L + +++++     LF +++E+       ++W E +RW+KFEE VE+  E WSKP+V  LSL S+   +S I+++ + L+     IE++ D++L    D ++L     +EL+Q +    L  HH  N+  + ++L + RSI D        N +K  +   S+  L C +G    + E+  +++ K    F KKIP G+E  N+LV E+ FL++ +  F+RL  + ++    EV + TRF+ I+LG  G  +  HE GR   +L+ D VF   AYKA +  DLI  IDEFLD   V+PP EW+P I+I+PPK  +P +    K   L   +  +  + +        EL+ TGR FGG + D+KRK   YLSD+ D++NLQC+ASF+FLY AC++P ITFGGLL +AT+G + A+ES+  A++ G+ YSLF+GQPLTILG+TGP+LVFE ++FK C  Y   +L  R  IG W     L++VA+D S LV Y+T FTEE FA LI +I+I +A + L  L E +P N+N N N +   SC+CI P+         + T   LKF                    + NN+T     W     K  C++  G + G+ CG    YVPD+ F+  +L   T  M+  LK F+ S+  P KVR  I  FAV   I    L+D+ +G+ +PKL VPS F+PT     R W +  LG NPWW+ I+  +PA+L  ILIFMDQQIT +I+NRK NKLKKG GYHLD+F++ +++GV SL+G+PWFV +TVL++ HV SLK+ES  + PG  P FLG REQR T LMI   +G SVF T +L+ IPMPVL+GVF YMG S L  I    R+ LF +  K +PDF YL+++P++++HLFT IQ+ CL+LL+ IK+ +  ++ FP++VLA+ F+RK ++C F++ EL WLD ++P++
Sbjct:   94 FLLGAEDDDEEHIPHDLFTEMDEICVKNGEDSEWRESARWLKFEEDVEDGGERWSKPYVATLSLHSLFELRSCIINSTVLLDMRANTIEEIADMVL----DHQELYSPLGDELRQKVRETLLKKHHHQNQKKLANRLPIVRSIADMGRRASDFNLDKNGQMMASQSQLACPDGKADVSRENSSVDFSKIDLHFMKKIPPGAEACNVLVGELEFLNKPVVAFVRLSPAMLLNGLAEVPIATRFLFILLGPFGRAAQYHEIGRSIATLMTDEVFHDVAYKAKDRNDLIAGIDEFLDQVTVLPPGEWDPTIRIEPPKN-VPSQEKRKKSNIL--SNGLVDGEEEEAHGHGGPELQRTGRLFGGLILDIKRKVPHYLSDYTDAINLQCIASFLFLYCACMSPVITFGGLLGEATEGRISAIESLFGASLTGIAYSLFAGQPLTILGSTGPVLVFEKILFKFCKEYGLSYLSLRTCIGLWTAFLCLLLVATDASSLVCYITRFTEEAFASLICIIFIYEALEKLTHLGEHFPFNKNNNLNKLTTYSCTCIEPS---------DPTNETLKF-------------------WEINNVTASEIYWEAMEAKD-CIEKQGEFVGSACGPHGPYVPDVLFWCVILFFSTVFMSAFLKEFKFSNYFPTKVRSIISDFAVFFTILTMVLVDYALGVPSPKLKVPSVFKPT--RDDRGWFINPLGPNPWWTVIITVVPALLCTILIFMDQQITAVIINRKENKLKKGCGYHLDLFMVGLMLGVCSLMGLPWFVAATVLSITHVNSLKLESECSAPGEQPKFLGIREQRFTGLMIFTLMGCSVFMTSVLKFIPMPVLYGVFLYMGASSLRGIQFFDRLTLFGMPPKHQPDFIYLRHVPLRKIHLFTIIQLSCLVLLWIIKT-SRAAIVFPMMVLALVFIRKLMDCIFTKRELSWLDDLMPES 1003          
BLAST of slc4a-2 vs. Ensembl Medaka
Match: slc4a10a (sodium-driven chloride bicarbonate exchanger [Source:NCBI gene;Acc:101167104])

HSP 1 Score: 704.901 bits (1818), Expect = 0.000e+0
Identity = 391/946 (41.33%), Postives = 576/946 (60.89%), Query Frame = 1
Query:   46 LSSTENNDKDN-QRYLFCQLNEL---EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHHNKCGIGSQLSLFRSIVD-----------NPNKKMKQNPSRKTLCENGNE---EDGLLEY-KFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEELEMELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKL--YVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQ 2820
            L  TE+ D+D+    LF +L+E+   E    +W E +RW+KFEE VE+  E WSKP+V  LSL S+   +S I++  + L+    ++E++ D++L +      L       +++ L   H + +H K  + +++ + RS  D           + N +    PS+ ++ E   +   E+  +++ K    F KKIP G+E +N+LV E+ FL   +  F+RL  + ++    EV + TRF+ I+LG  G     HE GR   +L+ D +F   AYKA +  DL+  IDEFLD   V+PP EW+P+I+I+PPK  +P +    K  P+ +    + E  +P       EL+ TG+FFGGF+ D+KRK   YLSD+ D+++LQCLASF+FLY AC++P ITFGGLL +AT+G + A+ES+  A++ G+ YSLF+GQPLTILG+TGP+LVFE ++FK C  Y   +L  R  IG W     L++VA+D S LV Y+T FTEE FA LI +I+I +A + L  L   YPIN+N N   +    C C  P+           +   L+F        +E+SN           IT    +W + +  + C    G + G  CG    ++PD+ F+  +L   T  M+  LK F+ S   P KVR  I  FAV I I    L+D+ +G+ +PKL VP+KF+PT     R W++  +G NPWW+TI+  IPA+L  ILIFMDQQIT +I+NRK +KLKKG GYHLD+F++ +++GV S++G+PWFV +TVL+++HV SLK+ES  + PG  P FLG REQR T LMI   +G SVF T +L+ IPMPVL+GVF YMG S L  I    R+ LF + AK +PDF YL+++P+++VHLFT +Q+ CL+LL+ IK+ +  ++ FP++VLA+ F+RK L+  FS+ EL WLD ++P+
Sbjct:  113 LLGTEDADEDHIPHALFTELDEICLREGEDAEWRETARWLKFEEDVEDGGERWSKPYVATLSLHSLFELRSCIMNGTVMLDMRANSLEEIADMVLDQHELSGPLGPDARNRVREALLKQHHHQNHKK--LANRIPIVRSFADIGKKQSEPHSMDKNGQTVSPPSQPSINEGKQDVSRENSSVDFSKIDLHFMKKIPPGAEASNVLVGELEFLDRPVVAFVRLSPAVLLNGLAEVPITTRFLFILLGPLGKGPQYHEIGRSIATLMTDEIFHDVAYKAKDRSDLVAGIDEFLDQVTVLPPGEWDPSIRIEPPKN-VPSQ-EKRKIPPVPNGVTDLGESPEPGGHG-GPELQRTGKFFGGFILDIKRKAPHYLSDYTDAISLQCLASFLFLYCACMSPVITFGGLLGEATEGRVSAIESLFGASMTGIAYSLFAGQPLTILGSTGPVLVFEKILFKFCKEYGLSYLSLRACIGLWTAFLCLLLVATDASSLVCYITRFTEEAFAALICIIFIYEALEKLVHLGVHYPINKNNNIQKLTQYWCLCEEPHSP---------SNETLRF--------WEDSN-----------ITASEVNWTSLDVNE-CEKLHGHFEGRACGPHGPFIPDVLFWCVILFFSTVFMSAFLKEFKTSRYFPTKVRAIISDFAVFITILTMVLVDYALGIPSPKLQVPNKFKPT--RDDRGWVINPVGPNPWWTTIITVIPALLCTILIFMDQQITAVIINRKEHKLKKGCGYHLDLFVVGVMLGVCSVMGLPWFVAATVLSISHVNSLKLESECSAPGEQPKFLGIREQRFTGLMIFTLMGCSVFMTSVLKFIPMPVLYGVFLYMGASSLRGIQFFDRLRLFGMPAKHQPDFIYLRHVPLRKVHLFTIVQLSCLILLWVIKT-SRAAIVFPMMVLALVFIRKLLDFVFSKRELSWLDDLIPE 1021          
BLAST of slc4a-2 vs. Ensembl Medaka
Match: slc4a10a (sodium-driven chloride bicarbonate exchanger [Source:NCBI gene;Acc:101167104])

HSP 1 Score: 704.901 bits (1818), Expect = 0.000e+0
Identity = 391/946 (41.33%), Postives = 576/946 (60.89%), Query Frame = 1
Query:   46 LSSTENNDKDN-QRYLFCQLNEL---EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHHNKCGIGSQLSLFRSIVD-----------NPNKKMKQNPSRKTLCENGNE---EDGLLEY-KFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEELEMELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKL--YVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQ 2820
            L  TE+ D+D+    LF +L+E+   E    +W E +RW+KFEE VE+  E WSKP+V  LSL S+   +S I++  + L+    ++E++ D++L +      L       +++ L   H + +H K  + +++ + RS  D           + N +    PS+ ++ E   +   E+  +++ K    F KKIP G+E +N+LV E+ FL   +  F+RL  + ++    EV + TRF+ I+LG  G     HE GR   +L+ D +F   AYKA +  DL+  IDEFLD   V+PP EW+P+I+I+PPK  +P +    K  P+ +    + E  +P       EL+ TG+FFGGF+ D+KRK   YLSD+ D+++LQCLASF+FLY AC++P ITFGGLL +AT+G + A+ES+  A++ G+ YSLF+GQPLTILG+TGP+LVFE ++FK C  Y   +L  R  IG W     L++VA+D S LV Y+T FTEE FA LI +I+I +A + L  L   YPIN+N N   +    C C  P+           +   L+F        +E+SN           IT    +W + +  + C    G + G  CG    ++PD+ F+  +L   T  M+  LK F+ S   P KVR  I  FAV I I    L+D+ +G+ +PKL VP+KF+PT     R W++  +G NPWW+TI+  IPA+L  ILIFMDQQIT +I+NRK +KLKKG GYHLD+F++ +++GV S++G+PWFV +TVL+++HV SLK+ES  + PG  P FLG REQR T LMI   +G SVF T +L+ IPMPVL+GVF YMG S L  I    R+ LF + AK +PDF YL+++P+++VHLFT +Q+ CL+LL+ IK+ +  ++ FP++VLA+ F+RK L+  FS+ EL WLD ++P+
Sbjct:  111 LLGTEDADEDHIPHALFTELDEICLREGEDAEWRETARWLKFEEDVEDGGERWSKPYVATLSLHSLFELRSCIMNGTVMLDMRANSLEEIADMVLDQHELSGPLGPDARNRVREALLKQHHHQNHKK--LANRIPIVRSFADIGKKQSEPHSMDKNGQTVSPPSQPSINEGKQDVSRENSSVDFSKIDLHFMKKIPPGAEASNVLVGELEFLDRPVVAFVRLSPAVLLNGLAEVPITTRFLFILLGPLGKGPQYHEIGRSIATLMTDEIFHDVAYKAKDRSDLVAGIDEFLDQVTVLPPGEWDPSIRIEPPKN-VPSQ-EKRKIPPVPNGVTDLGESPEPGGHG-GPELQRTGKFFGGFILDIKRKAPHYLSDYTDAISLQCLASFLFLYCACMSPVITFGGLLGEATEGRVSAIESLFGASMTGIAYSLFAGQPLTILGSTGPVLVFEKILFKFCKEYGLSYLSLRACIGLWTAFLCLLLVATDASSLVCYITRFTEEAFAALICIIFIYEALEKLVHLGVHYPINKNNNIQKLTQYWCLCEEPHSP---------SNETLRF--------WEDSN-----------ITASEVNWTSLDVNE-CEKLHGHFEGRACGPHGPFIPDVLFWCVILFFSTVFMSAFLKEFKTSRYFPTKVRAIISDFAVFITILTMVLVDYALGIPSPKLQVPNKFKPT--RDDRGWVINPVGPNPWWTTIITVIPALLCTILIFMDQQITAVIINRKEHKLKKGCGYHLDLFVVGVMLGVCSVMGLPWFVAATVLSISHVNSLKLESECSAPGEQPKFLGIREQRFTGLMIFTLMGCSVFMTSVLKFIPMPVLYGVFLYMGASSLRGIQFFDRLRLFGMPAKHQPDFIYLRHVPLRKVHLFTIVQLSCLILLWVIKT-SRAAIVFPMMVLALVFIRKLLDFVFSKRELSWLDDLIPE 1019          
BLAST of slc4a-2 vs. Planmine SMEST
Match: SMESG000057490.1 (SMESG000057490.1)

HSP 1 Score: 1909.03 bits (4944), Expect = 0.000e+0
Identity = 966/968 (99.79%), Postives = 967/968 (99.90%), Query Frame = 1
Query:   37 MFNLSSTENNDKDNQRYLFCQLNELEPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHHNKCGIGSQLSLFRSIVDNPNKKMKQNPSRKTLCENGNEEDGLLEYKFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLANNKDEPLHHEDDSISEKYKPTQEELEMELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKLYVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQNXXXXXXXXXXXXXXXXXXXQPELTLEIMSPEDKEKEDRP 2940
            MFNLSSTENNDKDNQRYLFCQLNELEPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHHNKCGIGSQLSLFRSIVDNPNKKMKQNPSRKTLCENGNEEDGLLEYKFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRL NNKDEPLHHEDDSISEKYKPTQEELEMELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQPLTILGTTGPLLVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKLYVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWST+LAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQNKSKNKKSKPCSSCCFKSKSQPELTLEIMSPEDKEKEDRP
Sbjct:    1 MFNLSSTENNDKDNQRYLFCQLNELEPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPHHNKCGIGSQLSLFRSIVDNPNKKMKQNPSRKTLCENGNEEDGLLEYKFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDRLVNNKDEPLHHEDDSISEKYKPTQEELEMELKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQPLTILGTTGPLLVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKLYVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTLLAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQNKSKNKKSKPCSSCCFKSKSQPELTLEIMSPEDKEKEDRP 968          
BLAST of slc4a-2 vs. Planmine SMEST
Match: SMESG000024335.1 (SMESG000024335.1)

HSP 1 Score: 916.761 bits (2368), Expect = 0.000e+0
Identity = 481/993 (48.44%), Postives = 654/993 (65.86%), Query Frame = 1
Query:   37 MFNLSSTENNDKDNQRYLFCQLNEL---EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPH---HNKCGIGSQLSLFRSIVDNPNKKMKQNPSRKTLCENGNEE---------------------------------DGLLEYKFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPK-----EMIPDRLANNKDEPLHHEDD-----------------SISEKYKPTQEELEME--LKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLY-IDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKLYVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQN 2823
            MF L   E+ +  N   LFC+++EL   +    +W E +RW+KFEE VE   E WSKPHV  LSL S+   ++ I  AV   N E  N E +I++IL K + EKK+   Q E++K++L   H++ H   H     GSQL L RS+ D   K   +   +  L    ++                                  D L   KF   F KKIPLG+E +NI+V E  FL++ + +FIRLK++ I+G  TEV +PTRF+ ++LG +G+    HE GR   +L+ D VF   AYKA    DL+  IDEFL +  V+PP EW+P+I+I+PPK       +P  + N     L    D                 S+  K +P +EE   +  L+ TGR FGG ++DVKRK  FYLSDF+D++++QC ASF FLYFACL P ITFGGLLV+AT GYLGA+ESIL+  IVGV+YSLFSGQPLTI+G+TGP+LVFES+V+ IC   +WD+LPFR+WIG WI  +L ++VA DLS LV+Y+T FTEE FA LI+LI++V+AF+ LF +++ YPI+  WN + I NR+C C P N T +     ++ +    +  P + P   NS+   ++  IDW NI++ +F+W+   ++ +C  +GG W G  CG  ++PD+FFFS +L IGTF ++YGLK+ RN+   P  VR  I  FAV+IAI   TL+D+ +G +TPKL VP+KFEPTLGY  R W++P LGKNPWW+ I+A  PA+LAVILIFMDQQIT +IVNRK NKLKKG GYHLD+ ++AILI VNS++G+PWFV +TVL++NHVMSLK ES N  PG  PVFLGCREQR+T  +I L IG SVF TP+L+RIPM VL+GVF +MGV+ L  + ++QRI LFF+ AK +PD+ +L+Y+P++RVHLFT IQ++ L+LL+ IK+IN++S+ FPI+VLA+CFVRK LE  F+  ELKWLD I+P +
Sbjct:   91 MFLLGEDEDEETHN---LFCEMDELRLDDEGEPEWKETARWIKFEEDVEEGGERWSKPHVASLSLYSLFEVRNCITSAVNMFNVEANNFETIIEIILNKIVSEKKISPDQREKVKEMLQRKHVHLHERRHKSNAKGSQLPLIRSLADIGKKYSSKEVDKVQLQRRNSDHEERDANSSQPSIIKSSSSIYVDKNRIDVDQCGSDNLASQKFDLHFFKKIPLGAETSNIMVGETDFLNQMVVVFIRLKEAVILGELTEVPVPTRFVFVMLGPQGSAVKNHEIGRSMATLMSDDVFHDVAYKARNLDDLLAGIDEFLSNCTVLPPAEWDPSIRIEPPKSGPIARKVPS-MPNGAQALLTASGDGRGGNNNGTPSSGTGPASVVNKLQPVEEESHADPTLRRTGRLFGGLIEDVKRKAPFYLSDFKDAIHVQCFASFFFLYFACLTPIITFGGLLVQATGGYLGAIESILSGTIVGVVYSLFSGQPLTIMGSTGPVLVFESIVYNICERMRWDYLPFRLWIGVWIAAYLFLMVAFDLSALVRYITRFTEESFAALIALIFMVEAFKKLFLIVDYYPIDTRWNIDMIKNRTCECFPRNATAMDAFFQKNNKPSNVYMPPMLYPVPLNSSVIDIVNNIDWQNISNYHFTWDYKKYRLICTKWGGIWTGPGCGNYFIPDVFFFSCLLFIGTFVLSYGLKMMRNAQFFPNWVRSLISDFAVMIAISSMTLLDWSLGFHTPKLNVPAKFEPTLGYEMRGWVIPALGKNPWWTIIIAMGPALLAVILIFMDQQITAVIVNRKENKLKKGSGYHLDLLVVAILILVNSILGIPWFVAATVLSINHVMSLKKESENTAPGERPVFLGCREQRVTGTIIFLVIGLSVFLTPLLKRIPMAVLYGVFLFMGVASLKGVQLMQRISLFFMPAKYQPDYIFLRYVPLRRVHLFTIIQIILLVLLWVIKTINVMSICFPIMVLALCFVRKGLEYLFTYNELKWLDDIMPNH 1079          
BLAST of slc4a-2 vs. Planmine SMEST
Match: SMESG000024335.1 (SMESG000024335.1)

HSP 1 Score: 915.99 bits (2366), Expect = 0.000e+0
Identity = 481/994 (48.39%), Postives = 658/994 (66.20%), Query Frame = 1
Query:   37 MFNLSSTENNDKDNQRYLFCQLNEL---EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPH---HNKCGIGSQLSLFRSIVD----------NPNKKMKQNPSRKTLCENGNE------------------------EDGLLEYKFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPK-----EMIPDRLANNKDEPLHHEDD-----------------SISEKYKPTQEELEME--LKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLY-IDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKLYVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQN 2823
            MF L   E+ +  N   LFC+++EL   +    +W E +RW+KFEE VE   E WSKPHV  LSL S+   ++ I  AV   N E  N E +I++IL K + EKK+   Q E++K++L   H++ H   H     GSQL L RS+ D          + + + +  P++ T  +  +                          D L   KF   F KKIPLG+E +NI+V E  FL++ + +FIRLK++ I+G  TEV +PTRF+ ++LG +G+    HE GR   +L+ D VF   AYKA    DL+  IDEFL +  V+PP EW+P+I+I+PPK       +P  + N     L    D                 S+  K +P +EE   +  L+ TGR FGG ++DVKRK  FYLSDF+D++++QC ASF FLYFACL P ITFGGLLV+AT GYLGA+ESIL+  IVGV+YSLFSGQPLTI+G+TGP+LVFES+V+ IC   +WD+LPFR+WIG WI  +L ++VA DLS LV+Y+T FTEE FA LI+LI++V+AF+ LF +++ YPI+  WN + I NR+C C P N T +     ++ +    +  P + P   NS+   ++  IDW NI++ +F+W+   ++ +C  +GG W G  CG  ++PD+FFFS +L IGTF ++YGLK+ RN+   P  VR  I  FAV+IAI   TL+D+ +G +TPKL VP+KFEPTLGY  R W++P LGKNPWW+ I+A  PA+LAVILIFMDQQIT +IVNRK NKLKKG GYHLD+ ++AILI VNS++G+PWFV +TVL++NHVMSLK ES N  PG  PVFLGCREQR+T  +I L IG SVF TP+L+RIPM VL+GVF +MGV+ L  + ++QRI LFF+ AK +PD+ +L+Y+P++RVHLFT IQ++ L+LL+ IK+IN++S+ FPI+VLA+CFVRK LE  F+  ELKWLD I+P +
Sbjct:   91 MFLLGEDEDEETHN---LFCEMDELRLDDEGEPEWKETARWIKFEEDVEEGGERWSKPHVASLSLYSLFEVRNCITSAVNMFNVEANNFETIIEIILNKIVSEKKISPDQREKVKEMLQRKHVHLHERRHKSNAKGSQLPLIRSLADIGKKYSSKEVDKDHEERDYPTKFTRFDANSSQPSIIKSSSSIYVDKNRIDVDQCGSDNLASQKFDLHFFKKIPLGAETSNIMVGETDFLNQMVVVFIRLKEAVILGELTEVPVPTRFVFVMLGPQGSAVKNHEIGRSMATLMSDDVFHDVAYKARNLDDLLAGIDEFLSNCTVLPPAEWDPSIRIEPPKSGPIARKVPS-MPNGAQALLTASGDGRGGNNNGTPSSGTGPASVVNKLQPVEEESHADPTLRRTGRLFGGLIEDVKRKAPFYLSDFKDAIHVQCFASFFFLYFACLTPIITFGGLLVQATGGYLGAIESILSGTIVGVVYSLFSGQPLTIMGSTGPVLVFESIVYNICERMRWDYLPFRLWIGVWIAAYLFLMVAFDLSALVRYITRFTEESFAALIALIFMVEAFKKLFLIVDYYPIDTRWNIDMIKNRTCECFPRNATAMDAFFQKNNKPSNVYMPPMLYPVPLNSSVIDIVNNIDWQNISNYHFTWDYKKYRLICTKWGGIWTGPGCGNYFIPDVFFFSCLLFIGTFVLSYGLKMMRNAQFFPNWVRSLISDFAVMIAISSMTLLDWSLGFHTPKLNVPAKFEPTLGYEMRGWVIPALGKNPWWTIIIAMGPALLAVILIFMDQQITAVIVNRKENKLKKGSGYHLDLLVVAILILVNSILGIPWFVAATVLSINHVMSLKKESENTAPGERPVFLGCREQRVTGTIIFLVIGLSVFLTPLLKRIPMAVLYGVFLFMGVASLKGVQLMQRISLFFMPAKYQPDYIFLRYVPLRRVHLFTIIQIILLVLLWVIKTINVMSICFPIMVLALCFVRKGLEYLFTYNELKWLDDIMPNH 1080          
BLAST of slc4a-2 vs. Planmine SMEST
Match: SMESG000024335.1 (SMESG000024335.1)

HSP 1 Score: 914.45 bits (2362), Expect = 0.000e+0
Identity = 481/996 (48.29%), Postives = 653/996 (65.56%), Query Frame = 1
Query:   37 MFNLSSTENNDKDNQRYLFCQLNEL---EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPH---HNKCGIGSQLSLFRSIVDNPNKKMKQNPSRKTLCENGNE-------------------------------------EDGLLEYKFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIPDR----LANNKDEPLHHEDD-----------------SISEKYKPTQEELEME--LKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLY-IDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKLYVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQN 2823
            MF L   E+ +  N   LFC+++EL   +    +W E +RW+KFEE VE   E WSKPHV  LSL S+   ++ I  AV   N E  N E +I++IL K + EKK+   Q E++K++L   H++ H   H     GSQL L RS+ D   K   +   +  L    ++                                      D L   KF   F KKIPLG+E +NI+V E  FL++ + +FIRLK++ I+G  TEV +PTRF+ ++LG +G+    HE GR   +L+ D VF   AYKA    DL+  IDEFL +  V+PP EW+P+I+I+PPK     R    + N     L    D                 S+  K +P +EE   +  L+ TGR FGG ++DVKRK  FYLSDF+D++++QC ASF FLYFACL P ITFGGLLV+AT GYLGA+ESIL+  IVGV+YSLFSGQPLTI+G+TGP+LVFES+V+ IC   +WD+LPFR+WIG WI  +L ++VA DLS LV+Y+T FTEE FA LI+LI++V+AF+ LF +++ YPI+  WN + I NR+C C P N T +     ++ +    +  P + P   NS+   ++  IDW NI++ +F+W+   ++ +C  +GG W G  CG  ++PD+FFFS +L IGTF ++YGLK+ RN+   P  VR  I  FAV+IAI   TL+D+ +G +TPKL VP+KFEPTLGY  R W++P LGKNPWW+ I+A  PA+LAVILIFMDQQIT +IVNRK NKLKKG GYHLD+ ++AILI VNS++G+PWFV +TVL++NHVMSLK ES N  PG  PVFLGCREQR+T  +I L IG SVF TP+L+RIPM VL+GVF +MGV+ L  + ++QRI LFF+ AK +PD+ +L+Y+P++RVHLFT IQ++ L+LL+ IK+IN++S+ FPI+VLA+CFVRK LE  F+  ELKWLD I+P +
Sbjct:   91 MFLLGEDEDEETHN---LFCEMDELRLDDEGEPEWKETARWIKFEEDVEEGGERWSKPHVASLSLYSLFEVRNCITSAVNMFNVEANNFETIIEIILNKIVSEKKISPDQREKVKEMLQRKHVHLHERRHKSNAKGSQLPLIRSLADIGKKYSSKEVDKVQLQRRNSDYPTKFTRFDANSSQPSIIKSSSSIYVDKNRIDVDQCGSDNLASQKFDLHFFKKIPLGAETSNIMVGETDFLNQMVVVFIRLKEAVILGELTEVPVPTRFVFVMLGPQGSAVKNHEIGRSMATLMSDDVFHDVAYKARNLDDLLAGIDEFLSNCTVLPPAEWDPSIRIEPPKSGPIARKVPSMPNGAQALLTASGDGRGGNNNGTPSSGTGPASVVNKLQPVEEESHADPTLRRTGRLFGGLIEDVKRKAPFYLSDFKDAIHVQCFASFFFLYFACLTPIITFGGLLVQATGGYLGAIESILSGTIVGVVYSLFSGQPLTIMGSTGPVLVFESIVYNICERMRWDYLPFRLWIGVWIAAYLFLMVAFDLSALVRYITRFTEESFAALIALIFMVEAFKKLFLIVDYYPIDTRWNIDMIKNRTCECFPRNATAMDAFFQKNNKPSNVYMPPMLYPVPLNSSVIDIVNNIDWQNISNYHFTWDYKKYRLICTKWGGIWTGPGCGNYFIPDVFFFSCLLFIGTFVLSYGLKMMRNAQFFPNWVRSLISDFAVMIAISSMTLLDWSLGFHTPKLNVPAKFEPTLGYEMRGWVIPALGKNPWWTIIIAMGPALLAVILIFMDQQITAVIVNRKENKLKKGSGYHLDLLVVAILILVNSILGIPWFVAATVLSINHVMSLKKESENTAPGERPVFLGCREQRVTGTIIFLVIGLSVFLTPLLKRIPMAVLYGVFLFMGVASLKGVQLMQRISLFFMPAKYQPDYIFLRYVPLRRVHLFTIIQIILLVLLWVIKTINVMSICFPIMVLALCFVRKGLEYLFTYNELKWLDDIMPNH 1083          
BLAST of slc4a-2 vs. Planmine SMEST
Match: SMESG000024335.1 (SMESG000024335.1)

HSP 1 Score: 910.983 bits (2353), Expect = 0.000e+0
Identity = 484/1008 (48.02%), Postives = 654/1008 (64.88%), Query Frame = 1
Query:   37 MFNLSSTENNDKDNQRYLFCQLNEL---EPSSNKWYECSRWVKFEEVVENTKEHWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDEKKLDFSQEEELKQLLSMCHLNPH---HNKCGIGSQLSLFRSIVD------------------NPNKKMKQNPSRKTLCENGNEEDG------------------------------LLEYKFCSRFKKKIPLGSEVANILVAEIGFLSENLCLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLVDSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPK-----EMIPDRLANNKDEPLHHEDD-----------------SISEKYKPTQEELEME--LKITGRFFGGFVDDVKRKKKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAMESILAAAIVGVLYSLFSGQXXXXXXXXXXXXVFESVVFKICGYYKWDFLPFRMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQNLFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEKPPMLPGFENSNFSQLLY-IDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNTCGKLYVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVVIAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWSTILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIGVNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHLMISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFINAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILVLAMCFVRKSLECFFSQEELKWLDRILPQN 2823
            MF L   E+ +  N   LFC+++EL   +    +W E +RW+KFEE VE   E WSKPHV  LSL S+   ++ I  AV   N E  N E +I++IL K + EKK+   Q E++K++L   H++ H   H     GSQL L RS+ D                  N  K       R  +C    E D                               L   KF   F KKIPLG+E +NI+V E  FL++ + +FIRLK++ I+G  TEV +PTRF+ ++LG +G+    HE GR   +L+ D VF   AYKA    DL+  IDEFL +  V+PP EW+P+I+I+PPK       +P  + N     L    D                 S+  K +P +EE   +  L+ TGR FGG ++DVKRK  FYLSDF+D++++QC ASF FLYFACL P ITFGGLLV+AT GYLGA+ESIL+  IVGV+YSLFSGQPLTI+G+TGP+LVFES+V+ IC   +WD+LPFR+WIG WI  +L ++VA DLS LV+Y+T FTEE FA LI+LI++V+AF+ LF +++ YPI+  WN + I NR+C C P N T +     ++ +    +  P + P   NS+   ++  IDW NI++ +F+W+   ++ +C  +GG W G  CG  ++PD+FFFS +L IGTF ++YGLK+ RN+   P  VR  I  FAV+IAI   TL+D+ +G +TPKL VP+KFEPTLGY  R W++P LGKNPWW+ I+A  PA+LAVILIFMDQQIT +IVNRK NKLKKG GYHLD+ ++AILI VNS++G+PWFV +TVL++NHVMSLK ES N  PG  PVFLGCREQR+T  +I L IG SVF TP+L+RIPM VL+GVF +MGV+ L  + ++QRI LFF+ AK +PD+ +L+Y+P++RVHLFT IQ++ L+LL+ IK+IN++S+ FPI+VLA+CFVRK LE  F+  ELKWLD I+P +
Sbjct:   91 MFLLGEDEDEETHN---LFCEMDELRLDDEGEPEWKETARWIKFEEDVEEGGERWSKPHVASLSLYSLFEVRNCITSAVNMFNVEANNFETIIEIILNKIVSEKKISPDQREKVKEMLQRKHVHLHERRHKSNAKGSQLPLIRSLADIGKKYSSKEVDKVQLQRRNSGKVYVAIAYRMCVCVYHEERDANSSQPSIIKSSSSIYVDKNRIDVDQCGSDNLASQKFDLHFFKKIPLGAETSNIMVGETDFLNQMVVVFIRLKEAVILGELTEVPVPTRFVFVMLGPQGSAVKNHEIGRSMATLMSDDVFHDVAYKARNLDDLLAGIDEFLSNCTVLPPAEWDPSIRIEPPKSGPIARKVPS-MPNGAQALLTASGDGRGGNNNGTPSSGTGPASVVNKLQPVEEESHADPTLRRTGRLFGGLIEDVKRKAPFYLSDFKDAIHVQCFASFFFLYFACLTPIITFGGLLVQATGGYLGAIESILSGTIVGVVYSLFSGQPLTIMGSTGPVLVFESIVYNICERMRWDYLPFRLWIGVWIAAYLFLMVAFDLSALVRYITRFTEESFAALIALIFMVEAFKKLFLIVDYYPIDTRWNIDMIKNRTCECFPRNATAMDAFFQKNNKPSNVYMPPMLYPVPLNSSVIDIVNNIDWQNISNYHFTWDYKKYRLICTKWGGIWTGPGCGNYFIPDVFFFSCLLFIGTFVLSYGLKMMRNAQFFPNWVRSLISDFAVMIAISSMTLLDWSLGFHTPKLNVPAKFEPTLGYEMRGWVIPALGKNPWWTIIIAMGPALLAVILIFMDQQITAVIVNRKENKLKKGSGYHLDLLVVAILILVNSILGIPWFVAATVLSINHVMSLKKESENTAPGERPVFLGCREQRVTGTIIFLVIGLSVFLTPLLKRIPMAVLYGVFLFMGVASLKGVQLMQRISLFFMPAKYQPDYIFLRYVPLRRVHLFTIIQIILLVLLWVIKTINVMSICFPIMVLALCFVRKGLEYLFTYNELKWLDDIMPNH 1094          
The following BLAST results are available for this feature:
BLAST of slc4a-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC4A100.000e+042.49solute carrier family 4 member 10 [Source:HGNC Sym... [more]
SLC4A100.000e+042.49solute carrier family 4 member 10 [Source:HGNC Sym... [more]
SLC4A100.000e+042.49solute carrier family 4 member 10 [Source:HGNC Sym... [more]
SLC4A70.000e+041.27solute carrier family 4 member 7 [Source:HGNC Symb... [more]
SLC4A70.000e+041.27solute carrier family 4 member 7 [Source:HGNC Symb... [more]
back to top
BLAST of slc4a-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abts-10.000e+039.27Anion exchange protein [Source:UniProtKB/TrEMBL;A... [more]
abts-10.000e+039.27Anion exchange protein [Source:UniProtKB/TrEMBL;A... [more]
abts-18.797e-1242.93Anion exchange protein [Source:UniProtKB/TrEMBL;A... [more]
abts-42.201e-5923.55Anion/Bicarbonate TranSporter family [Source:UniP... [more]
abts-41.684e-5122.82Anion/Bicarbonate TranSporter family [Source:UniP... [more]
back to top
BLAST of slc4a-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ndae10.000e+042.39gene:FBgn0259111 transcript:FBtr0331660[more]
Ndae10.000e+041.32gene:FBgn0259111 transcript:FBtr0331659[more]
Ndae10.000e+041.32gene:FBgn0259111 transcript:FBtr0299537[more]
Ndae10.000e+041.32gene:FBgn0259111 transcript:FBtr0299539[more]
Ndae10.000e+041.32gene:FBgn0259111 transcript:FBtr0331658[more]
back to top
BLAST of slc4a-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc4a80.000e+042.24solute carrier family 4 member 8 [Source:ZFIN;Acc:... [more]
slc4a10a0.000e+042.37solute carrier family 4 member 10a [Source:ZFIN;Ac... [more]
slc4a10a0.000e+042.37solute carrier family 4 member 10a [Source:ZFIN;Ac... [more]
slc4a10a0.000e+042.37solute carrier family 4 member 10a [Source:ZFIN;Ac... [more]
slc4a10a0.000e+042.37solute carrier family 4 member 10a [Source:ZFIN;Ac... [more]
back to top
BLAST of slc4a-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbx50.000e+042.57T-box 5 [Source:Xenbase;Acc:XB-GENE-486855][more]
tbx50.000e+042.53T-box 5 [Source:Xenbase;Acc:XB-GENE-486855][more]
tbx50.000e+042.53T-box 5 [Source:Xenbase;Acc:XB-GENE-486855][more]
tbx50.000e+042.57T-box 5 [Source:Xenbase;Acc:XB-GENE-486855][more]
tbx50.000e+042.57T-box 5 [Source:Xenbase;Acc:XB-GENE-486855][more]
back to top
BLAST of slc4a-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc4a100.000e+042.92solute carrier family 4, sodium bicarbonate cotran... [more]
Slc4a100.000e+042.92solute carrier family 4, sodium bicarbonate cotran... [more]
Slc4a100.000e+041.60solute carrier family 4, sodium bicarbonate cotran... [more]
Slc4a40.000e+041.09solute carrier family 4 (anion exchanger), member ... [more]
Slc4a40.000e+041.09solute carrier family 4 (anion exchanger), member ... [more]
back to top
BLAST of slc4a-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5DTL9|S4A10_MOUSE0.000e+041.60Sodium-driven chloride bicarbonate exchanger OS=Mu... [more]
sp|Q9GL77|S4A4_BOVIN0.000e+041.20Electrogenic sodium bicarbonate cotransporter 1 OS... [more]
sp|Q9JI66|S4A4_RAT0.000e+041.09Electrogenic sodium bicarbonate cotransporter 1 OS... [more]
sp|O88343|S4A4_MOUSE0.000e+041.09Electrogenic sodium bicarbonate cotransporter 1 OS... [more]
sp|Q80ZA5|S4A10_RAT0.000e+041.27Sodium-driven chloride bicarbonate exchanger OS=Ra... [more]
back to top
BLAST of slc4a-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJZ60.000e+0100.00Anion exchange protein OS=Schmidtea mediterranea O... [more]
A0A0H3YF380.000e+048.24Anion exchange protein OS=Schmidtea mediterranea O... [more]
A4K8Z40.000e+044.01Anion exchange protein OS=Doryteuthis pealeii OX=1... [more]
K1R5540.000e+042.58Anion exchange protein OS=Crassostrea gigas OX=291... [more]
A0A0C9RDR50.000e+041.36Anion exchange protein (Fragment) OS=Fopius arisan... [more]
back to top
BLAST of slc4a-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc4a10b0.000e+041.75solute carrier family 4 member 10 [Source:NCBI gen... [more]
slc4a10b0.000e+041.75solute carrier family 4 member 10 [Source:NCBI gen... [more]
slc4a10a0.000e+042.00sodium-driven chloride bicarbonate exchanger-like ... [more]
slc4a10a0.000e+042.00sodium-driven chloride bicarbonate exchanger-like ... [more]
slc4a10a0.000e+042.00sodium-driven chloride bicarbonate exchanger-like ... [more]
back to top
BLAST of slc4a-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc4a74.182e-1744.67solute carrier family 4 member 7 [Source:ZFIN;Acc:... [more]
slc4a71.133e-13541.78solute carrier family 4 member 7 [Source:ZFIN;Acc:... [more]
SLC4A41.748e-12743.46solute carrier family 4 member 4 [Source:HGNC Symb... [more]
SLC4A41.170e-12542.68solute carrier family 4 member 4 [Source:HGNC Symb... [more]
SLC4A41.820e-12242.47solute carrier family 4 member 4 [Source:HGNC Symb... [more]
back to top
BLAST of slc4a-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
BOR12.383e-1733.97Boron efflux transporter of the plasma membrane; b... [more]
back to top
BLAST of slc4a-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO458441.347e-8734.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317933.171e-7533.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO270892.894e-2854.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406102.180e-2629.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406113.830e-1327.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc4a-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc4a80.000e+041.26electroneutral sodium bicarbonate exchanger 1 [Sou... [more]
slc4a10b0.000e+041.83solute carrier family 4 member 10 [Source:NCBI gen... [more]
slc4a10b0.000e+041.83solute carrier family 4 member 10 [Source:NCBI gen... [more]
slc4a10a0.000e+041.33sodium-driven chloride bicarbonate exchanger [Sour... [more]
slc4a10a0.000e+041.33sodium-driven chloride bicarbonate exchanger [Sour... [more]
back to top
BLAST of slc4a-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000057490.10.000e+099.79SMESG000057490.1[more]
SMESG000024335.10.000e+048.44SMESG000024335.1[more]
SMESG000024335.10.000e+048.39SMESG000024335.1[more]
SMESG000024335.10.000e+048.29SMESG000024335.1[more]
SMESG000024335.10.000e+048.02SMESG000024335.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30035834
GenBankAKN21408.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035834 ID=SMED30035834|Name=slc4a-2|organism=Schmidtea mediterranea sexual|type=transcript|length=3133bp
CAGTTCAGCATCGCTTTTTGAACTTCATTATTTAAAATGTTCAATTTAAG
TTCAACCGAAAATAATGACAAGGATAACCAGCGTTACTTATTTTGTCAGT
TGAATGAATTGGAGCCTTCTAGTAACAAATGGTATGAATGTTCAAGATGG
GTAAAATTCGAAGAAGTAGTGGAAAATACGAAGGAACATTGGTCAAAGCC
TCATGTTGGAGTTCTGTCTTTAAGGAGTATATTAACCTTTAAGTCAATGA
TTTTGCATGCGGTGATTTCATTAAACCACGAAGGGGAAAATATAGAAGAC
GTGATTGATTTGATTTTACGGAAAGCAATAGATGAAAAGAAATTAGATTT
TTCACAGGAAGAGGAATTAAAACAATTATTATCAATGTGTCACTTAAATC
CTCACCATAATAAATGTGGAATTGGATCTCAACTTTCATTGTTTCGAAGC
ATTGTAGATAATCCGAATAAAAAAATGAAACAAAATCCAAGTCGTAAAAC
CTTATGCGAAAATGGAAATGAAGAAGATGGACTTTTGGAATATAAATTTT
GTTCCAGATTCAAAAAGAAAATTCCTTTAGGCTCAGAAGTCGCGAATATC
TTAGTGGCCGAAATTGGATTTTTATCAGAAAATCTTTGTCTGTTTATAAG
ATTAAAACAAAGCTCTATTATTGGAGCGTATACTGAAGTTCATTTGCCAA
CAAGATTTATAATAATAATACTTGGTACAAAGGGAACTTTATCAAATATT
CACGAGTGCGGTAGGGTAGCTGGATCCTTGCTTGTTGACAGTGTATTCCG
TAAGTCTGCATATAAAGCTAATGAAACAAAAGATTTAATTCAAGCAATTG
ATGAATTTTTGGACTCTGCTTTAGTAATTCCTCCAGATGAATGGAATCCA
AACATAAAAATAGACCCACCAAAGGAAATGATTCCGGACCGCTTGGCCAA
CAATAAAGATGAACCATTACATCATGAGGATGACAGCATATCGGAAAAGT
ATAAGCCAACGCAAGAGGAATTAGAAATGGAGCTGAAAATTACAGGAAGG
TTTTTCGGTGGGTTTGTCGATGATGTTAAAAGAAAGAAAAAATTTTATCT
AAGTGATTTTAGAGATTCACTTAATCTGCAATGTTTAGCTAGTTTCATTT
TCCTTTATTTTGCATGCTTAGCTCCGACCATAACATTTGGTGGGTTGTTG
GTCAAGGCAACGGATGGATACCTCGGTGCAATGGAATCGATTTTGGCCGC
TGCAATTGTTGGAGTTCTCTATTCCTTATTTTCTGGGCAACCCCTTACGA
TTTTGGGTACTACAGGGCCGTTATTGGTTTTCGAGTCCGTCGTGTTCAAA
ATCTGTGGATATTATAAATGGGATTTTCTTCCATTTCGGATGTGGATTGG
ATTTTGGATCATGATATTTTTGTTGATTATCGTTGCATCTGATTTGAGTA
TGCTGGTGAAATATCTCACGACATTCACAGAGGAATGTTTTGCTATGCTC
ATTTCCCTCATTTATATTGTGAAGGCCTTCCAGAATCTTTTCGAATTGCT
CGAAGATTATCCAATAAACAGGAACTGGAACCCTAACTACATTCTGAATC
GATCCTGTTCTTGCATTCCTCCGAATAAAACGATCCTCTCAAAATCTTTG
GATGAACATACGCAGAGACTGTTGAAGTTTGAAAAGCCTCCAATGTTGCC
GGGTTTTGAAAACTCCAATTTTTCACAATTGCTTTACATCGACTGGAATA
ACATAACTGACGGCTATTTTTCATGGAATACTCACAATTTCAAGCAAATG
TGTGTTGATTATGGTGGGACATGGGCCGGAAATACTTGTGGAAAATTGTA
TGTACCAGATATATTTTTCTTTTCTTCAATGTTAATGATTGGAACTTTCA
CCATGGCCTATGGTTTGAAAATATTTCGAAATTCCGACTTGCTTCCTTGC
AAGGTCAGGGAAACGATAGGAACATTTGCTGTGGTCATTGCGATATTCAT
GTTTACTTTGATTGATTTCGTTATCGGAATGAATACACCCAAGTTGATAG
TTCCTTCCAAGTTTGAGCCAACATTGGGTTACAGTTCCAGAACGTGGATA
GTTCCTATTCTCGGCAAGAATCCGTGGTGGTCAACTATACTCGCTTTTAT
ACCGGCCATACTTGCAGTGATTCTGATATTCATGGATCAACAGATAACGG
TCATCATTGTCAATCGCAAGAGTAATAAATTAAAAAAAGGATATGGCTAT
CATCTTGATATGTTTATTATCGCGATTTTGATTGGAGTCAATTCCTTGAT
TGGAGTGCCTTGGTTTGTCGGATCAACCGTTCTAGCTATGAATCATGTAA
TGAGTTTGAAAATAGAATCATCCAACAATGTTCCTGGGGTTGCACCGGTT
TTCCTAGGATGCAGAGAGCAAAGAATGACCCATTTGATGATTTCACTGGC
AATTGGATTTTCGGTATTTTTCACGCCGATGCTTCAAAGAATACCAATGC
CGGTGCTTTTTGGAGTATTTTTCTATATGGGGGTGAGTCCTTTATCCGAA
ATAGACATGATTCAAAGAATAGGCCTGTTTTTTATAAACGCCAAAAAGAG
GCCAGATTTCAAATATCTTCAATACATTCCAATCAAGAGGGTCCATTTGT
TCACTGCTATTCAAGTTTTGTGTTTGCTGTTGTTGTTTACAATAAAATCC
ATTAACATTCTATCTGTATCATTCCCAATTTTGGTTCTAGCAATGTGTTT
TGTAAGGAAATCCTTGGAATGCTTTTTCAGTCAGGAAGAATTGAAATGGC
TAGATCGAATTCTACCTCAAAATAAATCTAAAAATAAAAAGTCAAAACCG
TGTTCCAGCTGTTGTTTTAAAAGTAAATCGCAACCCGAATTAACGTTGGA
GATTATGAGTCCGGAAGACAAGGAAAAAGAAGATCGTCCATAAATTCTTA
TCTTTCATGCAACTCCTTTCTCTTTGATGATTTTAAATTTAAAAAAGATA
TTCTATTTGATTATTTTTATTCTTGAATATTTGTAATAAATATTCGACTG
ATCAGACCTATTTTATGCGGACTTATTAGAAATTTTATGCTGAATTGAAA
ATAAAAATAATCTTAATTCATTATTAAAAAAAA
back to top

protein sequence of SMED30035834-orf-1

>SMED30035834-orf-1 ID=SMED30035834-orf-1|Name=SMED30035834-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=969bp
MFNLSSTENNDKDNQRYLFCQLNELEPSSNKWYECSRWVKFEEVVENTKE
HWSKPHVGVLSLRSILTFKSMILHAVISLNHEGENIEDVIDLILRKAIDE
KKLDFSQEEELKQLLSMCHLNPHHNKCGIGSQLSLFRSIVDNPNKKMKQN
PSRKTLCENGNEEDGLLEYKFCSRFKKKIPLGSEVANILVAEIGFLSENL
CLFIRLKQSSIIGAYTEVHLPTRFIIIILGTKGTLSNIHECGRVAGSLLV
DSVFRKSAYKANETKDLIQAIDEFLDSALVIPPDEWNPNIKIDPPKEMIP
DRLANNKDEPLHHEDDSISEKYKPTQEELEMELKITGRFFGGFVDDVKRK
KKFYLSDFRDSLNLQCLASFIFLYFACLAPTITFGGLLVKATDGYLGAME
SILAAAIVGVLYSLFSGQPLTILGTTGPLLVFESVVFKICGYYKWDFLPF
RMWIGFWIMIFLLIIVASDLSMLVKYLTTFTEECFAMLISLIYIVKAFQN
LFELLEDYPINRNWNPNYILNRSCSCIPPNKTILSKSLDEHTQRLLKFEK
PPMLPGFENSNFSQLLYIDWNNITDGYFSWNTHNFKQMCVDYGGTWAGNT
CGKLYVPDIFFFSSMLMIGTFTMAYGLKIFRNSDLLPCKVRETIGTFAVV
IAIFMFTLIDFVIGMNTPKLIVPSKFEPTLGYSSRTWIVPILGKNPWWST
ILAFIPAILAVILIFMDQQITVIIVNRKSNKLKKGYGYHLDMFIIAILIG
VNSLIGVPWFVGSTVLAMNHVMSLKIESSNNVPGVAPVFLGCREQRMTHL
MISLAIGFSVFFTPMLQRIPMPVLFGVFFYMGVSPLSEIDMIQRIGLFFI
NAKKRPDFKYLQYIPIKRVHLFTAIQVLCLLLLFTIKSINILSVSFPILV
LAMCFVRKSLECFFSQEELKWLDRILPQNKSKNKKSKPCSSCCFKSKSQP
ELTLEIMSPEDKEKEDRP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000047collecting duct
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002063non-ciliated epidermis
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
PLANA:0007528glial cell
Vocabulary: INTERPRO
TermDefinition
IPR003024Na/HCO3_transpt
IPR003020HCO3_transpt_euk
IPR013769Band3_cytoplasmic_dom
IPR011531HCO3_transpt_C
IPR016152PTrfase/Anion_transptr
Vocabulary: molecular function
TermDefinition
GO:0005452inorganic anion exchanger activity
GO:0008509anion transmembrane transporter activity
GO:0005215transporter activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006820anion transport
GO:0006810transport
GO:0006811ion transport
GO:0015698inorganic anion transport
GO:0098656anion transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003024Sodium bicarbonate cotransporterPRINTSPR01232NAHCO3TRSPRTcoord: 467..474
score: 60.0
coord: 270..278
score: 66.67
coord: 290..302
score: 36.92
coord: 280..288
score: 65.56
coord: 420..427
score: 77.5
IPR003020Bicarbonate transporter, eukaryoticPRINTSPR01231HCO3TRNSPORTcoord: 712..721
score: 84.64
coord: 381..392
score: 68.45
coord: 219..231
score: 43.13
coord: 471..483
score: 55.22
coord: 726..739
score: 54.59
coord: 356..365
score: 65.36
IPR003020Bicarbonate transporter, eukaryoticTIGRFAMTIGR00834TIGR00834coord: 23..935
e-value: 1.2E-262
score: 871.9
IPR003020Bicarbonate transporter, eukaryoticPANTHERPTHR11453ANION EXCHANGE PROTEINcoord: 6..937
IPR013769Band 3 cytoplasmic domainPFAMPF07565Band_3_cytocoord: 45..289
e-value: 6.2E-49
score: 167.2
IPR016152Phosphotransferase/anion transporterGENE3DG3DSA:3.40.930.10coord: 12..316
e-value: 2.4E-74
score: 252.2
IPR016152Phosphotransferase/anion transporterSUPERFAMILYSSF55804Phoshotransferase/anion transport proteincoord: 18..298
IPR011531Bicarbonate transporter, C-terminalPFAMPF00955HCO3_cotranspcoord: 334..875
e-value: 2.9E-203
score: 676.3
NoneNo IPR availableGENE3DG3DSA:1.10.287.570coord: 349..390
e-value: 1.6E-20
score: 74.6
NoneNo IPR availablePANTHERPTHR11453:SF36SODIUM BICARBONATE COTRANSPORTER 3coord: 6..937
NoneNo IPR availableTMHMMTMhelixcoord: 367..389
NoneNo IPR availableTMHMMTMhelixcoord: 737..759
NoneNo IPR availableTMHMMTMhelixcoord: 609..631
NoneNo IPR availableTMHMMTMhelixcoord: 402..424
NoneNo IPR availableTMHMMTMhelixcoord: 473..495
NoneNo IPR availableTMHMMTMhelixcoord: 815..837
NoneNo IPR availableTMHMMTMhelixcoord: 643..665
NoneNo IPR availableTMHMMTMhelixcoord: 447..466
NoneNo IPR availableTMHMMTMhelixcoord: 697..716
NoneNo IPR availableTMHMMTMhelixcoord: 877..899