RING-type domain-containing protein

Overview
NameRING-type domain-containing protein
Smed IDSMED30035805
Length (bp)411
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RING-type domain-containing protein (SMED30035805) t-SNE clustered cells

Violin plots show distribution of expression levels for RING-type domain-containing protein (SMED30035805) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RING-type domain-containing protein (SMED30035805) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RING-type domain-containing protein (SMED30035805) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035805

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 135

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30035805h1SMcG0020329 Contig213uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035805h1SMcG0020329 Contig213newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035805h1SMcG0020629 Contig2221GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035805h1SMcG0020573 Contig2221GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035805h1SMcG0020513 Contig2221GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035805h1SMcG0020520 Contig2221GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035805h1SMcG0020450 Contig2221GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035805h1SMcG0020518 Contig2221GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035805h1SMcG0020329 Contig7368uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035805h1SMcG0020329 Contig7368newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035805h1SMcG0003553 Contig4875newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035805h1SMcG0003553 Contig4875uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035805h1SMcG0006887 Contig4952newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035805h1SMcG0006887 Contig4952uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035805h1SMcG0020329 Contig4952newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035805h1SMcG0020329 Contig4952uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035805h1SMcG0020329 Contig4875newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035805h1SMcG0020329 Contig4875uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
head regionSMED30035805h1SMcG0020329 SmedASXL_078472SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30035805h1SMcG0020329 SmedASXL_077741SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30035805h1SMcG0020329 SmedASXL_081309SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30035805h1SMcG0020329 SmedASXL_075293SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30035805h1SMcG0020329 SmedASXL_014051SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30035805h1SMcG0020329 SmedASXL_074252SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30035805h1SMcG0020329 SmedASXL_068096SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30035805h1SMcG0020329 SmedASXL_074251SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30035805 SmedASXL_072251SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30035805h1SMcG0020329 Contig19302newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035805h1SMcG0020329 Contig19302uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035805h1SMcG0020329 Contig14504uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035805h1SMcG0020329 Contig14504newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035805h1SMcG0020329 Contig27507newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035805h1SMcG0020329 Contig27507uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035805h1SMcG0020329 Contig32931uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035805h1SMcG0020329 Contig32931newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035805h1SMcG0020329 Contig32037newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035805h1SMcG0020329 Contig19303newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035805h1SMcG0020329 Contig19303uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035805h1SMcG0020329 Contig20613newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035805h1SMcG0020329 Contig20613uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035805h1SMcG0018912 Contig215uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035805h1SMcG0018912 Contig215newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035805h1SMcG0020329 Contig215uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035805h1SMcG0020329 Contig215newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035805h1SMcG0020329 Contig26855newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035805h1SMcG0020329 Contig26855uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035805h1SMcG0020329 Contig6924newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035805h1SMcG0020329 Contig6924uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035805h1SMcG0020329 Contig54527newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035805h1SMcG0020329 Contig54527uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035805h1SMcG0020329 Contig4951newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035805h1SMcG0020329 Contig4951uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035805h1SMcG0020329 Contig51621uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035805h1SMcG0020329 Contig51621newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035805h1SMcG0020750 Contig4951newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035805h1SMcG0020750 Contig4951uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035805h1SMcG0020329 Contig9562uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035805h1SMcG0020329 Contig9562newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30035805h1SMcG0020329 dd_Smed_v4_1617_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035805h1SMcG0020329 dd_Smed_v4_1617_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035805h1SMcG0020329 dd_Smed_v4_593_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30035805h1SMcG0016474 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035805h1SMcG0016474 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30035805h1SMcG0016474 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035805h1SMcG0016474 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035805h1SMcG0016474 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30035805h1SMcG0020559 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035805h1SMcG0020559 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30035805h1SMcG0020559 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035805h1SMcG0020559 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035805h1SMcG0020559 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30035805h1SMcG0020515 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035805h1SMcG0020515 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30035805h1SMcG0020515 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035805h1SMcG0020515 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035805h1SMcG0020515 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30035805h1SMcG0020513 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035805h1SMcG0020513 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30035805h1SMcG0020513 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035805h1SMcG0020513 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035805h1SMcG0020513 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30035805h1SMcG0020521 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035805h1SMcG0020521 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30035805h1SMcG0020521 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035805h1SMcG0020521 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035805h1SMcG0020521 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30035805h1SMcG0020629 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035805h1SMcG0020629 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30035805h1SMcG0020629 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035805h1SMcG0020629 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035805h1SMcG0020629 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30035805h1SMcG0020518 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035805h1SMcG0020518 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30035805h1SMcG0020518 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035805h1SMcG0020518 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035805h1SMcG0020518 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035805h1SMcG0020329 dd_Smed_v6_1617_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035805h1SMcG0020329 dd_Smed_v6_1617_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30035805h1SMcG0020594 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035805h1SMcG0020594 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30035805h1SMcG0020594 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035805h1SMcG0020594 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035805h1SMcG0020594 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30035805h1SMcG0020449 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035805h1SMcG0020449 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30035805h1SMcG0020449 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035805h1SMcG0020449 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035805h1SMcG0020449 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30035805h1SMcG0020548 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035805h1SMcG0020548 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30035805h1SMcG0020548 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035805h1SMcG0020548 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035805h1SMcG0020548 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30035805h1SMcG0020498 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035805h1SMcG0020498 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30035805h1SMcG0020498 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035805h1SMcG0020498 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035805h1SMcG0020498 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30035805h1SMcG0020450 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035805h1SMcG0020450 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30035805h1SMcG0020450 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035805h1SMcG0020450 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035805h1SMcG0020450 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30035805h1SMcG0020596 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035805h1SMcG0020596 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30035805h1SMcG0020596 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035805h1SMcG0020596 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035805h1SMcG0020596 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30035805h1SMcG0020329 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035805h1SMcG0020329 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30035805h1SMcG0020329 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035805h1SMcG0020329 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035805h1SMcG0020329 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035805h1SMcG0020329 dd_Smed_v4_593_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30035805h1SMcG0020329 dd_Smed_v4_593_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: MIB1 (mindbomb E3 ubiquitin protein ligase 1 [Source:HGNC Symbol;Acc:HGNC:21086])

HSP 1 Score: 48.521 bits (114), Expect = 7.026e-7
Identity = 20/61 (32.79%), Postives = 35/61 (57.38%), Query Frame = 1
Query:  139 NVKPSREENQPDNEIPMCNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMF 321
            +V+  +++ Q   E  MC +C D   ++ F CGH TC +C +++ ECP C+  I  R  ++
Sbjct:  946 DVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRILLY 1006          
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: MIB2 (mindbomb E3 ubiquitin protein ligase 2 [Source:HGNC Symbol;Acc:HGNC:30577])

HSP 1 Score: 46.595 bits (109), Expect = 3.230e-6
Identity = 18/44 (40.91%), Postives = 25/44 (56.82%), Query Frame = 1
Query:  190 CNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMF 321
            C IC D+ + + FQCGH  C  C + L  CP C+  I  R ++F
Sbjct:  925 CPICIDSHIRLVFQCGHGACAPCGSALSACPICRQPIRDRIQIF 968          
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: MIB2 (mindbomb E3 ubiquitin protein ligase 2 [Source:HGNC Symbol;Acc:HGNC:30577])

HSP 1 Score: 46.595 bits (109), Expect = 3.252e-6
Identity = 18/44 (40.91%), Postives = 25/44 (56.82%), Query Frame = 1
Query:  190 CNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMF 321
            C IC D+ + + FQCGH  C  C + L  CP C+  I  R ++F
Sbjct: 1012 CPICIDSHIRLVFQCGHGACAPCGSALSACPICRQPIRDRIQIF 1055          
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: MIB2 (mindbomb E3 ubiquitin protein ligase 2 [Source:HGNC Symbol;Acc:HGNC:30577])

HSP 1 Score: 46.595 bits (109), Expect = 3.254e-6
Identity = 18/44 (40.91%), Postives = 25/44 (56.82%), Query Frame = 1
Query:  190 CNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMF 321
            C IC D+ + + FQCGH  C  C + L  CP C+  I  R ++F
Sbjct: 1022 CPICIDSHIRLVFQCGHGACAPCGSALSACPICRQPIRDRIQIF 1065          
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: MIB2 (mindbomb E3 ubiquitin protein ligase 2 [Source:HGNC Symbol;Acc:HGNC:30577])

HSP 1 Score: 46.595 bits (109), Expect = 3.255e-6
Identity = 18/44 (40.91%), Postives = 25/44 (56.82%), Query Frame = 1
Query:  190 CNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMF 321
            C IC D+ + + FQCGH  C  C + L  CP C+  I  R ++F
Sbjct: 1026 CPICIDSHIRLVFQCGHGACAPCGSALSACPICRQPIRDRIQIF 1069          
BLAST of RING-type domain-containing protein vs. Ensembl Fly
Match: mib1 (gene:FBgn0263601 transcript:FBtr0333578)

HSP 1 Score: 51.6026 bits (122), Expect = 2.971e-8
Identity = 22/74 (29.73%), Postives = 39/74 (52.70%), Query Frame = 1
Query:  100 IVDKEEIERFHRNNVKPSREENQPDNEIPMCNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMF 321
            +V    +  F  ++V+  +++ Q   E  MC +C D   ++ F CGH TC +C +Q+  CP C+  +  R  +F
Sbjct: 1042 MVAPSNVNNFQMDDVQKLKQQLQDIKEQTMCPVCFDRIKNMVFLCGHGTCQMCGDQIEGCPICRKTVEKRILLF 1115          
BLAST of RING-type domain-containing protein vs. Ensembl Fly
Match: mib1 (gene:FBgn0263601 transcript:FBtr0075520)

HSP 1 Score: 51.6026 bits (122), Expect = 2.991e-8
Identity = 22/74 (29.73%), Postives = 39/74 (52.70%), Query Frame = 1
Query:  100 IVDKEEIERFHRNNVKPSREENQPDNEIPMCNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMF 321
            +V    +  F  ++V+  +++ Q   E  MC +C D   ++ F CGH TC +C +Q+  CP C+  +  R  +F
Sbjct: 1153 MVAPSNVNNFQMDDVQKLKQQLQDIKEQTMCPVCFDRIKNMVFLCGHGTCQMCGDQIEGCPICRKTVEKRILLF 1226          
BLAST of RING-type domain-containing protein vs. Ensembl Fly
Match: Diap2 (gene:FBgn0015247 transcript:FBtr0087297)

HSP 1 Score: 46.9802 bits (110), Expect = 1.154e-6
Identity = 23/59 (38.98%), Postives = 32/59 (54.24%), Query Frame = 1
Query:  157 EENQPDNEIPMCNICQDNPVSIGF-QCGHL-TCNVCSNQLFECPYCKAGIVSRTKMFFS 327
            EEN+   +  +C +C D  V + F  CGHL TCN C+  +  CP C+A I    + F S
Sbjct:  440 EENRQLKDARLCKVCLDEEVGVVFLPCGHLATCNQCAPSVANCPMCRADIKGFVRTFLS 498          
BLAST of RING-type domain-containing protein vs. Ensembl Fly
Match: Diap2 (gene:FBgn0015247 transcript:FBtr0087296)

HSP 1 Score: 46.9802 bits (110), Expect = 1.154e-6
Identity = 23/59 (38.98%), Postives = 32/59 (54.24%), Query Frame = 1
Query:  157 EENQPDNEIPMCNICQDNPVSIGF-QCGHL-TCNVCSNQLFECPYCKAGIVSRTKMFFS 327
            EEN+   +  +C +C D  V + F  CGHL TCN C+  +  CP C+A I    + F S
Sbjct:  440 EENRQLKDARLCKVCLDEEVGVVFLPCGHLATCNQCAPSVANCPMCRADIKGFVRTFLS 498          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:ZFIN;Acc:ZDB-GENE-050628-1])

HSP 1 Score: 50.0618 bits (118), Expect = 1.520e-7
Identity = 20/44 (45.45%), Postives = 27/44 (61.36%), Query Frame = 1
Query:  190 CNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMF 321
            C IC DN + + FQCGH +C  CS+ L  CP C+  I  R ++F
Sbjct:  845 CPICIDNHIRLVFQCGHASCIDCSSALKTCPICRQTIRERIQLF 888          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 49.2914 bits (116), Expect = 2.242e-7
Identity = 20/61 (32.79%), Postives = 35/61 (57.38%), Query Frame = 1
Query:  139 NVKPSREENQPDNEIPMCNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMF 321
            +V+  +++ Q   E  MC +C D   ++ F CGH TC +C +++ ECP C+  I  R  ++
Sbjct:  981 DVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1041          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 49.2914 bits (116), Expect = 2.262e-7
Identity = 20/61 (32.79%), Postives = 35/61 (57.38%), Query Frame = 1
Query:  139 NVKPSREENQPDNEIPMCNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMF 321
            +V+  +++ Q   E  MC +C D   ++ F CGH TC +C +++ ECP C+  I  R  ++
Sbjct:  970 DVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1030          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 49.2914 bits (116), Expect = 2.444e-7
Identity = 20/61 (32.79%), Postives = 35/61 (57.38%), Query Frame = 1
Query:  139 NVKPSREENQPDNEIPMCNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMF 321
            +V+  +++ Q   E  MC +C D   ++ F CGH TC +C +++ ECP C+  I  R  ++
Sbjct:  978 DVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1038          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 44.669 bits (104), Expect = 7.906e-6
Identity = 20/61 (32.79%), Postives = 35/61 (57.38%), Query Frame = 1
Query:  139 NVKPSREENQPDNEIPMCNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMF 321
            +V+  +++ Q   E  MC +C D   ++ F CGH TC +C +++ ECP C+  I  R  ++
Sbjct:  173 DVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 233          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: coa7 (cytochrome c oxidase assembly factor 7 (putative) [Source:Xenbase;Acc:XB-GENE-6258829])

HSP 1 Score: 50.0618 bits (118), Expect = 1.960e-7
Identity = 20/44 (45.45%), Postives = 26/44 (59.09%), Query Frame = 1
Query:  190 CNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMF 321
            C IC DN + + FQCGH +C  CS  L  CP C+  I  R ++F
Sbjct:  908 CPICIDNHIKLVFQCGHGSCTECSTSLTACPICRQLIRERIQIF 951          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: coa7 (cytochrome c oxidase assembly factor 7 (putative) [Source:Xenbase;Acc:XB-GENE-6258829])

HSP 1 Score: 50.0618 bits (118), Expect = 2.051e-7
Identity = 20/44 (45.45%), Postives = 26/44 (59.09%), Query Frame = 1
Query:  190 CNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMF 321
            C IC DN + + FQCGH +C  CS  L  CP C+  I  R ++F
Sbjct:  879 CPICIDNHIKLVFQCGHGSCTECSTSLTACPICRQLIRERIQIF 922          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: coa7 (cytochrome c oxidase assembly factor 7 (putative) [Source:Xenbase;Acc:XB-GENE-6258829])

HSP 1 Score: 50.0618 bits (118), Expect = 2.057e-7
Identity = 20/44 (45.45%), Postives = 26/44 (59.09%), Query Frame = 1
Query:  190 CNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMF 321
            C IC DN + + FQCGH +C  CS  L  CP C+  I  R ++F
Sbjct:  907 CPICIDNHIKLVFQCGHGSCTECSTSLTACPICRQLIRERIQIF 950          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: coa7 (cytochrome c oxidase assembly factor 7 (putative) [Source:Xenbase;Acc:XB-GENE-6258829])

HSP 1 Score: 50.0618 bits (118), Expect = 2.096e-7
Identity = 20/44 (45.45%), Postives = 26/44 (59.09%), Query Frame = 1
Query:  190 CNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMF 321
            C IC DN + + FQCGH +C  CS  L  CP C+  I  R ++F
Sbjct:  904 CPICIDNHIKLVFQCGHGSCTECSTSLTACPICRQLIRERIQIF 947          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: coa7 (cytochrome c oxidase assembly factor 7 (putative) [Source:Xenbase;Acc:XB-GENE-6258829])

HSP 1 Score: 50.0618 bits (118), Expect = 2.223e-7
Identity = 20/44 (45.45%), Postives = 26/44 (59.09%), Query Frame = 1
Query:  190 CNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMF 321
            C IC DN + + FQCGH +C  CS  L  CP C+  I  R ++F
Sbjct:  917 CPICIDNHIKLVFQCGHGSCTECSTSLTACPICRQLIRERIQIF 960          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Rnf123 (ring finger protein 123 [Source:MGI Symbol;Acc:MGI:2148796])

HSP 1 Score: 49.6766 bits (117), Expect = 2.366e-7
Identity = 24/51 (47.06%), Postives = 30/51 (58.82%), Query Frame = 1
Query:  169 PDNEIPMCNICQDNPVSIGFQ-CGHLTCNVCSNQLF----ECPYCKAGIVS 306
            P NE  +C IC  +P+S  FQ CGH +C  C NQ      +C +CKA IVS
Sbjct: 1247 PTNEEDLCPICYAHPISAVFQPCGHKSCKACINQHLMNNKDCFFCKATIVS 1297          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Rnf123 (ring finger protein 123 [Source:MGI Symbol;Acc:MGI:2148796])

HSP 1 Score: 49.6766 bits (117), Expect = 2.366e-7
Identity = 24/51 (47.06%), Postives = 30/51 (58.82%), Query Frame = 1
Query:  169 PDNEIPMCNICQDNPVSIGFQ-CGHLTCNVCSNQLF----ECPYCKAGIVS 306
            P NE  +C IC  +P+S  FQ CGH +C  C NQ      +C +CKA IVS
Sbjct: 1247 PTNEEDLCPICYAHPISAVFQPCGHKSCKACINQHLMNNKDCFFCKATIVS 1297          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Rnf123 (ring finger protein 123 [Source:MGI Symbol;Acc:MGI:2148796])

HSP 1 Score: 49.6766 bits (117), Expect = 2.366e-7
Identity = 24/51 (47.06%), Postives = 30/51 (58.82%), Query Frame = 1
Query:  169 PDNEIPMCNICQDNPVSIGFQ-CGHLTCNVCSNQLF----ECPYCKAGIVS 306
            P NE  +C IC  +P+S  FQ CGH +C  C NQ      +C +CKA IVS
Sbjct: 1253 PTNEEDLCPICYAHPISAVFQPCGHKSCKACINQHLMNNKDCFFCKATIVS 1303          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Rnf123 (ring finger protein 123 [Source:MGI Symbol;Acc:MGI:2148796])

HSP 1 Score: 49.6766 bits (117), Expect = 2.366e-7
Identity = 24/51 (47.06%), Postives = 30/51 (58.82%), Query Frame = 1
Query:  169 PDNEIPMCNICQDNPVSIGFQ-CGHLTCNVCSNQLF----ECPYCKAGIVS 306
            P NE  +C IC  +P+S  FQ CGH +C  C NQ      +C +CKA IVS
Sbjct: 1253 PTNEEDLCPICYAHPISAVFQPCGHKSCKACINQHLMNNKDCFFCKATIVS 1303          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:MGI Symbol;Acc:MGI:2443157])

HSP 1 Score: 48.521 bits (114), Expect = 4.824e-7
Identity = 20/61 (32.79%), Postives = 35/61 (57.38%), Query Frame = 1
Query:  139 NVKPSREENQPDNEIPMCNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMF 321
            +V+  +++ Q   E  MC +C D   ++ F CGH TC +C +++ ECP C+  I  R  ++
Sbjct:  946 DVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRILLY 1006          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8RX26|RGLG3_ARATH (E3 ubiquitin-protein ligase RGLG3 OS=Arabidopsis thaliana OX=3702 GN=RGLG3 PE=1 SV=1)

HSP 1 Score: 52.373 bits (124), Expect = 1.460e-7
Identity = 25/109 (22.94%), Postives = 52/109 (47.71%), Query Frame = 1
Query:    1 MKFILAIKTIISLGGNIYKMTSRGQRIIDACADIVDKEEIERFHRNNVKPSREENQ--PDNEIPMCNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMF 321
            M+     K  +SL     + + +  + +    ++++++   R   N +  + E++     + +P+C IC  NP  + F CGH TC  C   +  CP C+  I +R +++
Sbjct:  258 MEIPFQYKATLSLNRKPVRSSHQHHKPLPPPPEVIERDNAVRSVPNQMTETAEKSDRLAPSTVPVCPICLTNPKDMAFSCGHTTCKECGVVITTCPLCRQPITTRIRLY 366          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9VUX2|MIB_DROME (E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster OX=7227 GN=mib1 PE=1 SV=3)

HSP 1 Score: 51.6026 bits (122), Expect = 2.998e-7
Identity = 22/74 (29.73%), Postives = 39/74 (52.70%), Query Frame = 1
Query:  100 IVDKEEIERFHRNNVKPSREENQPDNEIPMCNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMF 321
            +V    +  F  ++V+  +++ Q   E  MC +C D   ++ F CGH TC +C +Q+  CP C+  +  R  +F
Sbjct: 1153 MVAPSNVNNFQMDDVQKLKQQLQDIKEQTMCPVCFDRIKNMVFLCGHGTCQMCGDQIEGCPICRKTVEKRILLF 1226          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5XPI3|RN123_MOUSE (E3 ubiquitin-protein ligase RNF123 OS=Mus musculus OX=10090 GN=Rnf123 PE=1 SV=1)

HSP 1 Score: 49.6766 bits (117), Expect = 1.655e-6
Identity = 24/51 (47.06%), Postives = 30/51 (58.82%), Query Frame = 1
Query:  169 PDNEIPMCNICQDNPVSIGFQ-CGHLTCNVCSNQLF----ECPYCKAGIVS 306
            P NE  +C IC  +P+S  FQ CGH +C  C NQ      +C +CKA IVS
Sbjct: 1247 PTNEEDLCPICYAHPISAVFQPCGHKSCKACINQHLMNNKDCFFCKATIVS 1297          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|D3ZXK7|RN123_RAT (E3 ubiquitin-protein ligase RNF123 OS=Rattus norvegicus OX=10116 GN=Rnf123 PE=1 SV=1)

HSP 1 Score: 49.6766 bits (117), Expect = 1.655e-6
Identity = 24/51 (47.06%), Postives = 30/51 (58.82%), Query Frame = 1
Query:  169 PDNEIPMCNICQDNPVSIGFQ-CGHLTCNVCSNQLF----ECPYCKAGIVS 306
            P NE  +C IC  +P+S  FQ CGH +C  C NQ      +C +CKA IVS
Sbjct: 1251 PTNEEDLCPICYAHPISAVFQPCGHKSCKACINQHLMNNKDCFFCKATIVS 1301          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q804S5|MIB1_DANRE (E3 ubiquitin-protein ligase mib1 OS=Danio rerio OX=7955 GN=mib1 PE=1 SV=1)

HSP 1 Score: 49.2914 bits (116), Expect = 1.707e-6
Identity = 20/61 (32.79%), Postives = 35/61 (57.38%), Query Frame = 1
Query:  139 NVKPSREENQPDNEIPMCNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMF 321
            +V+  +++ Q   E  MC +C D   ++ F CGH TC +C +++ ECP C+  I  R  ++
Sbjct:  970 DVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1030          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: A0A250WVA8 (RING-type domain-containing protein OS=Chlamydomonas eustigma OX=1157962 GN=CEUSTIGMA_g2002.t1 PE=4 SV=1)

HSP 1 Score: 58.5362 bits (140), Expect = 3.121e-7
Identity = 22/54 (40.74%), Postives = 31/54 (57.41%), Query Frame = 1
Query:  169 PDNEI---PMCNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMF 321
            PD+ +   P C+IC + P S+ F CGH  C  C   L  CP+C+  I ++ KMF
Sbjct:  805 PDSSVVSTPQCSICMERPRSLVFSCGHQCCFKCGEPLLTCPFCRMAITTKIKMF 858          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: A8HPA3 (Predicted protein OS=Chlamydomonas reinhardtii OX=3055 GN=CHLREDRAFT_146196 PE=4 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 4.225e-7
Identity = 23/83 (27.71%), Postives = 44/83 (53.01%), Query Frame = 1
Query:   73 QRIIDACADIVDKEEIERFHRNNVKPSREENQPDNEIPMCNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMF 321
            +R ++A +  V    I+R      K    + + ++E   C +C + P ++ F CGH +C  CS ++  CP+C+  I +R ++F
Sbjct:  731 ERKLEASSRSVRDALIQR------KIDEAQRRSNSEQAACAVCMEGPKAVVFNCGHQSCEACSGKMSSCPFCRVAITARIRLF 807          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: A0A2K3E5F7 (RING-type domain-containing protein OS=Chlamydomonas reinhardtii OX=3055 GN=CHLRE_01g011600v5 PE=4 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 4.302e-7
Identity = 23/83 (27.71%), Postives = 44/83 (53.01%), Query Frame = 1
Query:   73 QRIIDACADIVDKEEIERFHRNNVKPSREENQPDNEIPMCNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMF 321
            +R ++A +  V    I+R      K    + + ++E   C +C + P ++ F CGH +C  CS ++  CP+C+  I +R ++F
Sbjct:  901 ERKLEASSRSVRDALIQR------KIDEAQRRSNSEQAACAVCMEGPKAVVFNCGHQSCEACSGKMSSCPFCRVAITARIRLF 977          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: U5GEJ4 (RING-type domain-containing protein OS=Populus trichocarpa OX=3694 GN=POPTR_005G065700 PE=4 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 6.391e-7
Identity = 23/64 (35.94%), Postives = 33/64 (51.56%), Query Frame = 1
Query:  130 HRNNVKPSREENQPDNEIPMCNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMF 321
            H  N KP +      +  P+C IC  NP  + F CGH+TC  C   +  CP C+  I +R ++F
Sbjct:  350 HMTNFKPVQPTAPTASVEPVCPICLANPKDLAFGCGHMTCRDCGASISACPLCRQPITTRLRLF 413          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: A0A2K3NFK1 (E3 ubiquitin-protein ligase rglg1-like protein (Fragment) OS=Trifolium pratense OX=57577 GN=L195_g025116 PE=4 SV=1)

HSP 1 Score: 57.3806 bits (137), Expect = 8.456e-7
Identity = 23/56 (41.07%), Postives = 30/56 (53.57%), Query Frame = 1
Query:  151 SREENQPDNEIPMCNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKM 318
            S E   P +E P+C IC  NP  + F CGH TC  C   L  CP C+  I +R ++
Sbjct:  375 STEPTAPASEEPVCPICLTNPKDMAFGCGHTTCKECGATLSSCPMCRQQITTRLRL 430          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:103034310])

HSP 1 Score: 50.0618 bits (118), Expect = 1.018e-7
Identity = 20/44 (45.45%), Postives = 26/44 (59.09%), Query Frame = 1
Query:  190 CNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMF 321
            C IC DN + + FQCGH +C  CS  L  CP C+  I  R ++F
Sbjct:  903 CPICIDNQIKLVFQCGHASCIDCSAALKTCPICRQTIRERIQLF 946          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:103034310])

HSP 1 Score: 50.0618 bits (118), Expect = 1.024e-7
Identity = 20/44 (45.45%), Postives = 26/44 (59.09%), Query Frame = 1
Query:  190 CNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMF 321
            C IC DN + + FQCGH +C  CS  L  CP C+  I  R ++F
Sbjct:  967 CPICIDNQIKLVFQCGHASCIDCSAALKTCPICRQTIRERIQLF 1010          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:103034310])

HSP 1 Score: 50.0618 bits (118), Expect = 1.024e-7
Identity = 20/44 (45.45%), Postives = 26/44 (59.09%), Query Frame = 1
Query:  190 CNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMF 321
            C IC DN + + FQCGH +C  CS  L  CP C+  I  R ++F
Sbjct:  973 CPICIDNQIKLVFQCGHASCIDCSAALKTCPICRQTIRERIQLF 1016          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 49.2914 bits (116), Expect = 1.898e-7
Identity = 20/61 (32.79%), Postives = 35/61 (57.38%), Query Frame = 1
Query:  139 NVKPSREENQPDNEIPMCNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMF 321
            +V+  +++ Q   E  MC +C D   ++ F CGH TC +C +++ ECP C+  I  R  ++
Sbjct:  967 DVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1027          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 49.2914 bits (116), Expect = 2.106e-7
Identity = 20/61 (32.79%), Postives = 35/61 (57.38%), Query Frame = 1
Query:  139 NVKPSREENQPDNEIPMCNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMF 321
            +V+  +++ Q   E  MC +C D   ++ F CGH TC +C +++ ECP C+  I  R  ++
Sbjct:  946 DVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1006          
BLAST of RING-type domain-containing protein vs. Ensembl Sea Lamprey
Match: birc2 (baculoviral IAP repeat containing 2 [Source:ZFIN;Acc:ZDB-GENE-030825-6])

HSP 1 Score: 44.669 bits (104), Expect = 1.932e-6
Identity = 23/62 (37.10%), Postives = 32/62 (51.61%), Query Frame = 1
Query:  148 PSREENQPDNEIPMCNICQDNPVSIGF-QCGHLT-CNVCSNQLFECPYCKAGIVSRTKMFFS 327
            P  EE +   E   C +C D  VS+ F  CGHL  C  C++ L +CP C+A +    + F S
Sbjct:  515 PPEEELKRLQEQHTCKVCMDKEVSVVFIPCGHLVVCRDCASSLRKCPICRAVVRGTVRTFMS 576          
BLAST of RING-type domain-containing protein vs. Ensembl Nematostella
Match: EDO37483 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFK6])

HSP 1 Score: 43.1282 bits (100), Expect = 5.297e-6
Identity = 20/63 (31.75%), Postives = 32/63 (50.79%), Query Frame = 1
Query:  133 RNNVKPSREENQPDNEIPMCNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMF 321
             N++   + + Q   +   C IC D P ++ F CGH TC+ C   L  CP+C+  I  +  +F
Sbjct:  123 ENSLTSLQAKLQELEDKSQCPICMDKPRTVAFLCGHGTCSECCQSLRNCPFCRKPIEKKINLF 185          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:101175479])

HSP 1 Score: 50.447 bits (119), Expect = 9.844e-8
Identity = 20/44 (45.45%), Postives = 26/44 (59.09%), Query Frame = 1
Query:  190 CNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMF 321
            C IC DN + + FQCGH +C  CS  L  CP C+  I  R ++F
Sbjct: 1040 CPICIDNHIKLVFQCGHASCIECSAALKTCPICRQTIRERIQLF 1083          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:101175479])

HSP 1 Score: 50.0618 bits (118), Expect = 1.079e-7
Identity = 20/44 (45.45%), Postives = 26/44 (59.09%), Query Frame = 1
Query:  190 CNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMF 321
            C IC DN + + FQCGH +C  CS  L  CP C+  I  R ++F
Sbjct:  984 CPICIDNHIKLVFQCGHASCIECSAALKTCPICRQTIRERIQLF 1027          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:101158637])

HSP 1 Score: 49.2914 bits (116), Expect = 2.096e-7
Identity = 20/61 (32.79%), Postives = 35/61 (57.38%), Query Frame = 1
Query:  139 NVKPSREENQPDNEIPMCNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMF 321
            +V+  +++ Q   E  MC +C D   ++ F CGH TC +C +++ ECP C+  I  R  ++
Sbjct:  960 DVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1020          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000043474.1 (SMESG000043474.1)

HSP 1 Score: 219.55 bits (558), Expect = 2.925e-68
Identity = 102/108 (94.44%), Postives = 104/108 (96.30%), Query Frame = 1
Query:    4 KFILAIKTIISLGGNIYKMTSRGQRIIDACADIVDKEEIERFHRNNVKPSREENQPDNEIPMCNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMFFS 327
            K +  IK IISLGG+IYKMTSRGQRIIDACADIVDKEEIERFHRNNVKPSREENQPDNEIPMCNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMFFS
Sbjct:  656 KLVSTIKIIISLGGDIYKMTSRGQRIIDACADIVDKEEIERFHRNNVKPSREENQPDNEIPMCNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMFFS 763          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000043474.1 (SMESG000043474.1)

HSP 1 Score: 219.55 bits (558), Expect = 5.012e-68
Identity = 102/108 (94.44%), Postives = 104/108 (96.30%), Query Frame = 1
Query:    4 KFILAIKTIISLGGNIYKMTSRGQRIIDACADIVDKEEIERFHRNNVKPSREENQPDNEIPMCNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMFFS 327
            K +  IK IISLGG+IYKMTSRGQRIIDACADIVDKEEIERFHRNNVKPSREENQPDNEIPMCNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMFFS
Sbjct:  718 KLVSTIKIIISLGGDIYKMTSRGQRIIDACADIVDKEEIERFHRNNVKPSREENQPDNEIPMCNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMFFS 825          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000043474.1 (SMESG000043474.1)

HSP 1 Score: 219.55 bits (558), Expect = 5.828e-68
Identity = 102/108 (94.44%), Postives = 104/108 (96.30%), Query Frame = 1
Query:    4 KFILAIKTIISLGGNIYKMTSRGQRIIDACADIVDKEEIERFHRNNVKPSREENQPDNEIPMCNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMFFS 327
            K +  IK IISLGG+IYKMTSRGQRIIDACADIVDKEEIERFHRNNVKPSREENQPDNEIPMCNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMFFS
Sbjct:  714 KLVSTIKIIISLGGDIYKMTSRGQRIIDACADIVDKEEIERFHRNNVKPSREENQPDNEIPMCNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMFFS 821          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000043474.1 (SMESG000043474.1)

HSP 1 Score: 219.55 bits (558), Expect = 6.716e-68
Identity = 102/108 (94.44%), Postives = 104/108 (96.30%), Query Frame = 1
Query:    4 KFILAIKTIISLGGNIYKMTSRGQRIIDACADIVDKEEIERFHRNNVKPSREENQPDNEIPMCNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMFFS 327
            K +  IK IISLGG+IYKMTSRGQRIIDACADIVDKEEIERFHRNNVKPSREENQPDNEIPMCNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMFFS
Sbjct:  725 KLVSTIKIIISLGGDIYKMTSRGQRIIDACADIVDKEEIERFHRNNVKPSREENQPDNEIPMCNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMFFS 832          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000043474.1 (SMESG000043474.1)

HSP 1 Score: 219.164 bits (557), Expect = 2.089e-67
Identity = 102/108 (94.44%), Postives = 104/108 (96.30%), Query Frame = 1
Query:    4 KFILAIKTIISLGGNIYKMTSRGQRIIDACADIVDKEEIERFHRNNVKPSREENQPDNEIPMCNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMFFS 327
            K +  IK IISLGG+IYKMTSRGQRIIDACADIVDKEEIERFHRNNVKPSREENQPDNEIPMCNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMFFS
Sbjct:  814 KLVSTIKIIISLGGDIYKMTSRGQRIIDACADIVDKEEIERFHRNNVKPSREENQPDNEIPMCNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGIVSRTKMFFS 921          
The following BLAST results are available for this feature:
BLAST of RING-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MIB17.026e-732.79mindbomb E3 ubiquitin protein ligase 1 [Source:HGN... [more]
MIB23.230e-640.91mindbomb E3 ubiquitin protein ligase 2 [Source:HGN... [more]
MIB23.252e-640.91mindbomb E3 ubiquitin protein ligase 2 [Source:HGN... [more]
MIB23.254e-640.91mindbomb E3 ubiquitin protein ligase 2 [Source:HGN... [more]
MIB23.255e-640.91mindbomb E3 ubiquitin protein ligase 2 [Source:HGN... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
mib12.971e-829.73gene:FBgn0263601 transcript:FBtr0333578[more]
mib12.991e-829.73gene:FBgn0263601 transcript:FBtr0075520[more]
Diap21.154e-638.98gene:FBgn0015247 transcript:FBtr0087297[more]
Diap21.154e-638.98gene:FBgn0015247 transcript:FBtr0087296[more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mib21.520e-745.45mindbomb E3 ubiquitin protein ligase 2 [Source:ZFI... [more]
mib12.242e-732.79mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib12.262e-732.79mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib12.444e-732.79mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib17.906e-632.79mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
coa71.960e-745.45cytochrome c oxidase assembly factor 7 (putative) ... [more]
coa72.051e-745.45cytochrome c oxidase assembly factor 7 (putative) ... [more]
coa72.057e-745.45cytochrome c oxidase assembly factor 7 (putative) ... [more]
coa72.096e-745.45cytochrome c oxidase assembly factor 7 (putative) ... [more]
coa72.223e-745.45cytochrome c oxidase assembly factor 7 (putative) ... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rnf1232.366e-747.06ring finger protein 123 [Source:MGI Symbol;Acc:MGI... [more]
Rnf1232.366e-747.06ring finger protein 123 [Source:MGI Symbol;Acc:MGI... [more]
Rnf1232.366e-747.06ring finger protein 123 [Source:MGI Symbol;Acc:MGI... [more]
Rnf1232.366e-747.06ring finger protein 123 [Source:MGI Symbol;Acc:MGI... [more]
Mib14.824e-732.79mindbomb E3 ubiquitin protein ligase 1 [Source:MGI... [more]
back to top
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8RX26|RGLG3_ARATH1.460e-722.94E3 ubiquitin-protein ligase RGLG3 OS=Arabidopsis t... [more]
sp|Q9VUX2|MIB_DROME2.998e-729.73E3 ubiquitin-protein ligase mind-bomb OS=Drosophil... [more]
sp|Q5XPI3|RN123_MOUSE1.655e-647.06E3 ubiquitin-protein ligase RNF123 OS=Mus musculus... [more]
sp|D3ZXK7|RN123_RAT1.655e-647.06E3 ubiquitin-protein ligase RNF123 OS=Rattus norve... [more]
sp|Q804S5|MIB1_DANRE1.707e-632.79E3 ubiquitin-protein ligase mib1 OS=Danio rerio OX... [more]
back to top
BLAST of RING-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A250WVA83.121e-740.74RING-type domain-containing protein OS=Chlamydomon... [more]
A8HPA34.225e-727.71Predicted protein OS=Chlamydomonas reinhardtii OX=... [more]
A0A2K3E5F74.302e-727.71RING-type domain-containing protein OS=Chlamydomon... [more]
U5GEJ46.391e-735.94RING-type domain-containing protein OS=Populus tri... [more]
A0A2K3NFK18.456e-741.07E3 ubiquitin-protein ligase rglg1-like protein (Fr... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mib21.018e-745.45mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
mib21.024e-745.45mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
mib21.024e-745.45mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
mib11.898e-732.79mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib12.106e-732.79mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
birc21.932e-637.10baculoviral IAP repeat containing 2 [Source:ZFIN;A... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO374835.297e-631.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
mib29.844e-845.45mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
mib21.079e-745.45mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
mib12.096e-732.79mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
back to top
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043474.12.925e-6894.44SMESG000043474.1[more]
SMESG000043474.15.012e-6894.44SMESG000043474.1[more]
SMESG000043474.15.828e-6894.44SMESG000043474.1[more]
SMESG000043474.16.716e-6894.44SMESG000043474.1[more]
SMESG000043474.12.089e-6794.44SMESG000043474.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035805 ID=SMED30035805|Name=RING-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=411bp
ATGAAATTTATTTTAGCTATTAAAACCATAATCTCATTGGGCGGTAACAT
TTATAAGATGACGTCACGTGGCCAGAGGATTATTGATGCGTGCGCTGACA
TTGTTGACAAGGAGGAAATCGAGAGATTTCATAGAAATAATGTCAAACCA
TCAAGGGAAGAAAATCAGCCTGATAATGAAATCCCAATGTGCAACATATG
CCAAGATAATCCGGTGAGTATTGGATTCCAATGTGGCCATTTGACATGCA
ATGTCTGTTCCAATCAGTTATTTGAATGTCCCTACTGTAAGGCTGGCATT
GTCAGTAGGACTAAAATGTTTTTCAGTTAGGAATTTTCAGCTGACATTTT
TATTGGCTTTTACACTTGATTAAACTTTATTGATATTTTGTGCTCAATAA
ATTAAATTAAT
back to top

protein sequence of SMED30035805-orf-1

>SMED30035805-orf-1 ID=SMED30035805-orf-1|Name=SMED30035805-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=110bp
MKFILAIKTIISLGGNIYKMTSRGQRIIDACADIVDKEEIERFHRNNVKP
SREENQPDNEIPMCNICQDNPVSIGFQCGHLTCNVCSNQLFECPYCKAGI
VSRTKMFFS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000070intestinal phagocyte
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0004842ubiquitin-protein transferase activity
GO:0016740transferase activity
GO:0046872metal ion binding
Vocabulary: INTERPRO
TermDefinition
IPR013083Znf_RING/FYVE/PHD
IPR001841Znf_RING
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005815microtubule organizing center
GO:0005856cytoskeleton
Vocabulary: biological process
TermDefinition
GO:0007219Notch signaling pathway
GO:0016567protein ubiquitination
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 31..103
e-value: 9.9E-12
score: 46.2
NoneNo IPR availablePFAMPF13920zf-C3HC4_3coord: 56..94
e-value: 6.6E-9
score: 35.5
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 57..97
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 58..91
score: 10.38