Threonine--tRNA ligase, cytoplasmic

Overview
NameThreonine--tRNA ligase, cytoplasmic
Smed IDSMED30035804
Length (bp)2161
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Threonine--tRNA ligase, cytoplasmic (SMED30035804) t-SNE clustered cells

Violin plots show distribution of expression levels for Threonine--tRNA ligase, cytoplasmic (SMED30035804) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Threonine--tRNA ligase, cytoplasmic (SMED30035804) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Threonine--tRNA ligase, cytoplasmic (SMED30035804) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Human
Match: TARS1 (threonyl-tRNA synthetase 1 [Source:HGNC Symbol;Acc:HGNC:11572])

HSP 1 Score: 504.212 bits (1297), Expect = 3.760e-170
Identity = 245/504 (48.61%), Postives = 335/504 (66.47%), Query Frame = 3
Query:  204 KYSDDDKFIKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLI-ERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
            K   D K IKV   +G      + K TPY I    +  L+++ +I+KVN + WDL++PL  D  +E L FE++ A+  +W S+A ++   +E ++          + GF  D  L+   +SS  F S+E      +     FER+++  E    +F ++  K  ++ E++++     ++YRC  LID+C  P VR+TG++K LKI ++ S       +  +LQRIYG+SFP+ ++L  W   QEEA  R+HR IG +QEL+FFH  SPGS F LP+G +I N LI+ IR +YRKRGF EV TP IF + LW TSGHW HY EN+F   ++ KE F++KPMNCP HCL++ H+ R  ++LPLRLADFG LHR EL+G L+GLTR+R+F QDDAHIFC  +QIE EI+  LDF++ VY +  F F L+LSTRP+ FLGDIE+W+ AE+QL+ SL +FG+ W LNSGDGAFYGPKIDI IKDA+ R HQCATIQLDFQLP+RFNL Y
Sbjct:   75 KAEKDSKPIKVTLPDGKQVDAESWKTTPYQIACGISQGLADNTVIAKVNNVVWDLDRPLEEDCTLELLKFEDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLEEGGVSSNDFSSLEALCKKIIKEKQAFERLEVKKETLLAMFKYNKFKCRILNEKVNTPT--TTVYRCGPLIDLCRGPHVRHTGKIKALKIHKNSSTYWEGKADMETLQRIYGISFPDPKMLKEWEKFQEEAKNRDHRKIGRDQELYFFHELSPGSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFSFEVE-KELFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAMEQIEDEIKGCLDFLRTVYSVFGFSFKLNLSTRPEKFLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTY 575          

HSP 2 Score: 115.931 bits (289), Expect = 3.760e-170
Identity = 60/126 (47.62%), Postives = 82/126 (65.08%), Query Frame = 2
Query: 1778 ERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDL-RNLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVRKGHGEDHESWDLQELIKKFK 2152
            +RPVI+HRAILGSVER +AIL E+  GKWPFWL+PRQV+VV V     EYA +V QQ  DA F+ D DL     + +KI N +  +YN IL++G+KE  S  V++R    + H    + E I++ +
Sbjct:  584 KRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERTISETIERLQ 709          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Human
Match: TARS1 (threonyl-tRNA synthetase 1 [Source:HGNC Symbol;Acc:HGNC:11572])

HSP 1 Score: 504.212 bits (1297), Expect = 3.760e-170
Identity = 245/504 (48.61%), Postives = 335/504 (66.47%), Query Frame = 3
Query:  204 KYSDDDKFIKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLI-ERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
            K   D K IKV   +G      + K TPY I    +  L+++ +I+KVN + WDL++PL  D  +E L FE++ A+  +W S+A ++   +E ++          + GF  D  L+   +SS  F S+E      +     FER+++  E    +F ++  K  ++ E++++     ++YRC  LID+C  P VR+TG++K LKI ++ S       +  +LQRIYG+SFP+ ++L  W   QEEA  R+HR IG +QEL+FFH  SPGS F LP+G +I N LI+ IR +YRKRGF EV TP IF + LW TSGHW HY EN+F   ++ KE F++KPMNCP HCL++ H+ R  ++LPLRLADFG LHR EL+G L+GLTR+R+F QDDAHIFC  +QIE EI+  LDF++ VY +  F F L+LSTRP+ FLGDIE+W+ AE+QL+ SL +FG+ W LNSGDGAFYGPKIDI IKDA+ R HQCATIQLDFQLP+RFNL Y
Sbjct:   75 KAEKDSKPIKVTLPDGKQVDAESWKTTPYQIACGISQGLADNTVIAKVNNVVWDLDRPLEEDCTLELLKFEDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLEEGGVSSNDFSSLEALCKKIIKEKQAFERLEVKKETLLAMFKYNKFKCRILNEKVNTPT--TTVYRCGPLIDLCRGPHVRHTGKIKALKIHKNSSTYWEGKADMETLQRIYGISFPDPKMLKEWEKFQEEAKNRDHRKIGRDQELYFFHELSPGSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFSFEVE-KELFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAMEQIEDEIKGCLDFLRTVYSVFGFSFKLNLSTRPEKFLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTY 575          

HSP 2 Score: 115.931 bits (289), Expect = 3.760e-170
Identity = 60/126 (47.62%), Postives = 82/126 (65.08%), Query Frame = 2
Query: 1778 ERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDL-RNLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVRKGHGEDHESWDLQELIKKFK 2152
            +RPVI+HRAILGSVER +AIL E+  GKWPFWL+PRQV+VV V     EYA +V QQ  DA F+ D DL     + +KI N +  +YN IL++G+KE  S  V++R    + H    + E I++ +
Sbjct:  584 KRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERTISETIERLQ 709          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Human
Match: TARS3 (threonyl-tRNA synthetase 3 [Source:HGNC Symbol;Acc:HGNC:24728])

HSP 1 Score: 504.212 bits (1297), Expect = 1.830e-168
Identity = 238/510 (46.67%), Postives = 339/510 (66.47%), Query Frame = 3
Query:  186 LLDKNTKYSDDDKFIKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLI-ERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
            LL    K  D    I V   +G        K TPY +    + +L+ S +I+KVNG  WDL++PL  DS +E L F+N+ A+  +W S+A +L   +E  +          + GF  D  ++++++SS +  ++E+     +     FER+++  EI  ++F ++  K  ++ E++++     ++YRC  LID+C+ P VR+TG++K +KI ++ S          +LQRIYG+SFP+ +++  W   QEEA  R+HR IG+EQELFFFH+ SPGS F LPRG  I N L D IRE+Y KR F+EV +P ++ ++LWE SGHW HY EN+F   ++ K+ F++KPMNCP HCL+++H+ R  +++P+R ADFG LHR EL+G LSGLTR+R+F QDDAHIFC  +QIE+EI+  L F++ VY    F F L+LSTRP+NFLG+IE+WN AE+QL+ SL  FG+ W +N GDGAFYGPKIDI IKDA+ R HQCATIQLDFQLP+RFNL Y
Sbjct:  148 LLAIYGKKGDTSNIITVRVADGQTVQGEVWKTTPYQVAAEISQELAESTVIAKVNGELWDLDRPLEGDSSLELLTFDNEEAQAVYWHSSAHILGEAMELYYGGHLCYGPPIENGFYYDMFIEDRAVSSTELSALENICKAIIKEKQPFERLEVSKEILLEMFKYNKFKCRILNEKVNTAT--TTVYRCGPLIDLCKGPHVRHTGKIKTIKIFKNSSTYWEGNPEMETLQRIYGISFPDNKMMRDWEKFQEEAKNRDHRKIGKEQELFFFHDLSPGSCFFLPRGAFIYNTLTDFIREEYHKRDFTEVLSPNMYNSKLWEASGHWQHYSENMFTFEIE-KDTFALKPMNCPGHCLMFAHRPRSWREMPIRFADFGVLHRNELSGTLSGLTRVRRFQQDDAHIFCTVEQIEEEIKGCLQFLQSVYSTFGFSFQLNLSTRPENFLGEIEMWNEAEKQLQNSLMDFGEPWKMNPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIRFNLTY 654          

HSP 2 Score: 95.5153 bits (236), Expect = 1.330e-19
Identity = 47/91 (51.65%), Postives = 63/91 (69.23%), Query Frame = 2
Query: 1778 ERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDL-RNLRMARKILNGEQQRYNCIL 2047
            +RPVIIHRAILGSVER +AIL E+  GKWPFWL+PRQV+V+ V     +YA +V  +  + GF+ D DL  +  + +KI N +  +YN IL
Sbjct:  663 KRPVIIHRAILGSVERMIAILSENYGGKWPFWLSPRQVMVIPVGPTCEKYALQVSSEFFEEGFMADVDLDHSCTLNKKIRNAQLAQYNFIL 753          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Human
Match: TARS3 (threonyl-tRNA synthetase 3 [Source:HGNC Symbol;Acc:HGNC:24728])

HSP 1 Score: 504.212 bits (1297), Expect = 1.830e-168
Identity = 238/510 (46.67%), Postives = 339/510 (66.47%), Query Frame = 3
Query:  186 LLDKNTKYSDDDKFIKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLI-ERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
            LL    K  D    I V   +G        K TPY +    + +L+ S +I+KVNG  WDL++PL  DS +E L F+N+ A+  +W S+A +L   +E  +          + GF  D  ++++++SS +  ++E+     +     FER+++  EI  ++F ++  K  ++ E++++     ++YRC  LID+C+ P VR+TG++K +KI ++ S          +LQRIYG+SFP+ +++  W   QEEA  R+HR IG+EQELFFFH+ SPGS F LPRG  I N L D IRE+Y KR F+EV +P ++ ++LWE SGHW HY EN+F   ++ K+ F++KPMNCP HCL+++H+ R  +++P+R ADFG LHR EL+G LSGLTR+R+F QDDAHIFC  +QIE+EI+  L F++ VY    F F L+LSTRP+NFLG+IE+WN AE+QL+ SL  FG+ W +N GDGAFYGPKIDI IKDA+ R HQCATIQLDFQLP+RFNL Y
Sbjct:  148 LLAIYGKKGDTSNIITVRVADGQTVQGEVWKTTPYQVAAEISQELAESTVIAKVNGELWDLDRPLEGDSSLELLTFDNEEAQAVYWHSSAHILGEAMELYYGGHLCYGPPIENGFYYDMFIEDRAVSSTELSALENICKAIIKEKQPFERLEVSKEILLEMFKYNKFKCRILNEKVNTAT--TTVYRCGPLIDLCKGPHVRHTGKIKTIKIFKNSSTYWEGNPEMETLQRIYGISFPDNKMMRDWEKFQEEAKNRDHRKIGKEQELFFFHDLSPGSCFFLPRGAFIYNTLTDFIREEYHKRDFTEVLSPNMYNSKLWEASGHWQHYSENMFTFEIE-KDTFALKPMNCPGHCLMFAHRPRSWREMPIRFADFGVLHRNELSGTLSGLTRVRRFQQDDAHIFCTVEQIEEEIKGCLQFLQSVYSTFGFSFQLNLSTRPENFLGEIEMWNEAEKQLQNSLMDFGEPWKMNPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIRFNLTY 654          

HSP 2 Score: 95.5153 bits (236), Expect = 1.330e-19
Identity = 47/91 (51.65%), Postives = 63/91 (69.23%), Query Frame = 2
Query: 1778 ERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDL-RNLRMARKILNGEQQRYNCIL 2047
            +RPVIIHRAILGSVER +AIL E+  GKWPFWL+PRQV+V+ V     +YA +V  +  + GF+ D DL  +  + +KI N +  +YN IL
Sbjct:  663 KRPVIIHRAILGSVERMIAILSENYGGKWPFWLSPRQVMVIPVGPTCEKYALQVSSEFFEEGFMADVDLDHSCTLNKKIRNAQLAQYNFIL 753          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Human
Match: TARS3 (threonyl-tRNA synthetase 3 [Source:HGNC Symbol;Acc:HGNC:24728])

HSP 1 Score: 505.368 bits (1300), Expect = 1.839e-168
Identity = 238/510 (46.67%), Postives = 339/510 (66.47%), Query Frame = 3
Query:  186 LLDKNTKYSDDDKFIKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLI-ERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
            LL    K  D    I V   +G        K TPY +    + +L+ S +I+KVNG  WDL++PL  DS +E L F+N+ A+  +W S+A +L   +E  +          + GF  D  ++++++SS +  ++E+     +     FER+++  EI  ++F ++  K  ++ E++++     ++YRC  LID+C+ P VR+TG++K +KI ++ S          +LQRIYG+SFP+ +++  W   QEEA  R+HR IG+EQELFFFH+ SPGS F LPRG  I N L D IRE+Y KR F+EV +P ++ ++LWE SGHW HY EN+F   ++ K+ F++KPMNCP HCL+++H+ R  +++P+R ADFG LHR EL+G LSGLTR+R+F QDDAHIFC  +QIE+EI+  L F++ VY    F F L+LSTRP+NFLG+IE+WN AE+QL+ SL  FG+ W +N GDGAFYGPKIDI IKDA+ R HQCATIQLDFQLP+RFNL Y
Sbjct:  148 LLAIYGKKGDTSNIITVRVADGQTVQGEVWKTTPYQVAAEISQELAESTVIAKVNGELWDLDRPLEGDSSLELLTFDNEEAQAVYWHSSAHILGEAMELYYGGHLCYGPPIENGFYYDMFIEDRAVSSTELSALENICKAIIKEKQPFERLEVSKEILLEMFKYNKFKCRILNEKVNTAT--TTVYRCGPLIDLCKGPHVRHTGKIKTIKIFKNSSTYWEGNPEMETLQRIYGISFPDNKMMRDWEKFQEEAKNRDHRKIGKEQELFFFHDLSPGSCFFLPRGAFIYNTLTDFIREEYHKRDFTEVLSPNMYNSKLWEASGHWQHYSENMFTFEIE-KDTFALKPMNCPGHCLMFAHRPRSWREMPIRFADFGVLHRNELSGTLSGLTRVRRFQQDDAHIFCTVEQIEEEIKGCLQFLQSVYSTFGFSFQLNLSTRPENFLGEIEMWNEAEKQLQNSLMDFGEPWKMNPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIRFNLTY 654          

HSP 2 Score: 108.227 bits (269), Expect = 1.164e-23
Identity = 57/115 (49.57%), Postives = 77/115 (66.96%), Query Frame = 2
Query: 1778 ERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDL-RNLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVR----KGHGE 2107
            +RPVIIHRAILGSVER +AIL E+  GKWPFWL+PRQV+V+ V     +YA +V  +  + GF+ D DL  +  + +KI N +  +YN IL++G+KE     V+VR    K HGE
Sbjct:  663 KRPVIIHRAILGSVERMIAILSENYGGKWPFWLSPRQVMVIPVGPTCEKYALQVSSEFFEEGFMADVDLDHSCTLNKKIRNAQLAQYNFILVVGEKEKIDNAVNVRTRDNKIHGE 777          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Celegans
Match: tars-1 (Threonine--tRNA ligase, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:P52709])

HSP 1 Score: 483.797 bits (1244), Expect = 4.146e-162
Identity = 230/498 (46.18%), Postives = 326/498 (65.46%), Query Frame = 3
Query:  228 IKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLI-ERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVY-GILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKYF 1715
            I++   +G ++     + TP+ I +  +  L+ + +I+KVNG  WDL++P   ++ +E L F++D A+  FW S+A +L   +E              +GF  D   +N++I    F  I+      V     FER+++  E   ++F ++  K+ +I E++H+     ++YRC  LID+C  P VR+TG++K + I ++ S       +  SLQR+YG+SFP+ + L  W   QEEA KR+HR +G+E +LFFFH  SPGSAF  P+G HI NKL+D IR+QYR+RGF+EV TP ++  +LWETSGHW HY E++FKI ++ KEEF +KPMNCP HCL++ H      +LP R ADFG LHR E++G L+GLTR+R+F QDDAHIFCR DQI +EI++ LDF+++ Y  +  F F L+LSTRP+ FLG+IE W+ AE  L  +L   G+ W LN GDGAFYGPKIDI I+DAL R  QCATIQLDFQLP +F+L YF
Sbjct:   41 IQITLPDGKIHEGKTWRTTPFEIAERISKGLAEAAVIAKVNGAVWDLDRPFEGNAKLELLKFDDDEAKQVFWHSSAHVLGEAMERYCGGHLCYGPPIQEGFYYDMWHENRTICPDDFPKIDQIVKAAVKDKQKFERLEMTKEDLLEMFKYNEFKVRIITEKIHTPK--TTVYRCGPLIDLCRGPHVRHTGKVKAMAITKNSSSYWEGKADAESLQRLYGISFPDSKQLKEWQKLQEEAAKRDHRKLGKEHDLFFFHQLSPGSAFWYPKGAHIYNKLVDFIRKQYRRRGFTEVITPNMYNKKLWETSGHWQHYSEDMFKIEVE-KEEFGLKPMNCPGHCLMFGHMPHTYNELPFRFADFGVLHRNEMSGALTGLTRVRRFQQDDAHIFCRQDQISEEIKQCLDFLEYAYEKVFGFTFKLNLSTRPEGFLGNIETWDKAEADLTNALNASGRKWVLNPGDGAFYGPKIDITIQDALKRNFQCATIQLDFQLPNQFDLSYF 535          

HSP 2 Score: 103.219 bits (256), Expect = 1.399e-22
Identity = 55/130 (42.31%), Postives = 82/130 (63.08%), Query Frame = 2
Query: 1766 EGSFERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDLR-NLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVRKGHGEDHESWDLQELIKKFK 2152
            +G  +RPV+IHRA+LGSVER  AIL ES  GKWPFWL+PRQ  +++V +   +YAN+V +QI +AGF  + +      M +++   +  ++N IL+IG KE ++  V+VR           L +LI KF+
Sbjct:  538 KGEKQRPVMIHRAVLGSVERMTAILTESYGGKWPFWLSPRQCKIITVHESVRDYANDVKKQIFEAGFEIEYEENCGDTMNKQVRKAQLAQFNFILVIGAKEKENGTVNVRTRDNAVRGEVALDKLISKFR 667          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Celegans
Match: tars-1 (Threonine--tRNA ligase, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:P52709])

HSP 1 Score: 483.797 bits (1244), Expect = 4.146e-162
Identity = 230/498 (46.18%), Postives = 326/498 (65.46%), Query Frame = 3
Query:  228 IKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLI-ERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVY-GILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKYF 1715
            I++   +G ++     + TP+ I +  +  L+ + +I+KVNG  WDL++P   ++ +E L F++D A+  FW S+A +L   +E              +GF  D   +N++I    F  I+      V     FER+++  E   ++F ++  K+ +I E++H+     ++YRC  LID+C  P VR+TG++K + I ++ S       +  SLQR+YG+SFP+ + L  W   QEEA KR+HR +G+E +LFFFH  SPGSAF  P+G HI NKL+D IR+QYR+RGF+EV TP ++  +LWETSGHW HY E++FKI ++ KEEF +KPMNCP HCL++ H      +LP R ADFG LHR E++G L+GLTR+R+F QDDAHIFCR DQI +EI++ LDF+++ Y  +  F F L+LSTRP+ FLG+IE W+ AE  L  +L   G+ W LN GDGAFYGPKIDI I+DAL R  QCATIQLDFQLP +F+L YF
Sbjct:   41 IQITLPDGKIHEGKTWRTTPFEIAERISKGLAEAAVIAKVNGAVWDLDRPFEGNAKLELLKFDDDEAKQVFWHSSAHVLGEAMERYCGGHLCYGPPIQEGFYYDMWHENRTICPDDFPKIDQIVKAAVKDKQKFERLEMTKEDLLEMFKYNEFKVRIITEKIHTPK--TTVYRCGPLIDLCRGPHVRHTGKVKAMAITKNSSSYWEGKADAESLQRLYGISFPDSKQLKEWQKLQEEAAKRDHRKLGKEHDLFFFHQLSPGSAFWYPKGAHIYNKLVDFIRKQYRRRGFTEVITPNMYNKKLWETSGHWQHYSEDMFKIEVE-KEEFGLKPMNCPGHCLMFGHMPHTYNELPFRFADFGVLHRNEMSGALTGLTRVRRFQQDDAHIFCRQDQISEEIKQCLDFLEYAYEKVFGFTFKLNLSTRPEGFLGNIETWDKAEADLTNALNASGRKWVLNPGDGAFYGPKIDITIQDALKRNFQCATIQLDFQLPNQFDLSYF 535          

HSP 2 Score: 103.219 bits (256), Expect = 1.399e-22
Identity = 55/130 (42.31%), Postives = 82/130 (63.08%), Query Frame = 2
Query: 1766 EGSFERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDLR-NLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVRKGHGEDHESWDLQELIKKFK 2152
            +G  +RPV+IHRA+LGSVER  AIL ES  GKWPFWL+PRQ  +++V +   +YAN+V +QI +AGF  + +      M +++   +  ++N IL+IG KE ++  V+VR           L +LI KF+
Sbjct:  538 KGEKQRPVMIHRAVLGSVERMTAILTESYGGKWPFWLSPRQCKIITVHESVRDYANDVKKQIFEAGFEIEYEENCGDTMNKQVRKAQLAQFNFILVIGAKEKENGTVNVRTRDNAVRGEVALDKLISKFR 667          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Celegans
Match: tars-1 (Threonine--tRNA ligase, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:P52709])

HSP 1 Score: 483.797 bits (1244), Expect = 4.146e-162
Identity = 230/498 (46.18%), Postives = 326/498 (65.46%), Query Frame = 3
Query:  228 IKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLI-ERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVY-GILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKYF 1715
            I++   +G ++     + TP+ I +  +  L+ + +I+KVNG  WDL++P   ++ +E L F++D A+  FW S+A +L   +E              +GF  D   +N++I    F  I+      V     FER+++  E   ++F ++  K+ +I E++H+     ++YRC  LID+C  P VR+TG++K + I ++ S       +  SLQR+YG+SFP+ + L  W   QEEA KR+HR +G+E +LFFFH  SPGSAF  P+G HI NKL+D IR+QYR+RGF+EV TP ++  +LWETSGHW HY E++FKI ++ KEEF +KPMNCP HCL++ H      +LP R ADFG LHR E++G L+GLTR+R+F QDDAHIFCR DQI +EI++ LDF+++ Y  +  F F L+LSTRP+ FLG+IE W+ AE  L  +L   G+ W LN GDGAFYGPKIDI I+DAL R  QCATIQLDFQLP +F+L YF
Sbjct:   41 IQITLPDGKIHEGKTWRTTPFEIAERISKGLAEAAVIAKVNGAVWDLDRPFEGNAKLELLKFDDDEAKQVFWHSSAHVLGEAMERYCGGHLCYGPPIQEGFYYDMWHENRTICPDDFPKIDQIVKAAVKDKQKFERLEMTKEDLLEMFKYNEFKVRIITEKIHTPK--TTVYRCGPLIDLCRGPHVRHTGKVKAMAITKNSSSYWEGKADAESLQRLYGISFPDSKQLKEWQKLQEEAAKRDHRKLGKEHDLFFFHQLSPGSAFWYPKGAHIYNKLVDFIRKQYRRRGFTEVITPNMYNKKLWETSGHWQHYSEDMFKIEVE-KEEFGLKPMNCPGHCLMFGHMPHTYNELPFRFADFGVLHRNEMSGALTGLTRVRRFQQDDAHIFCRQDQISEEIKQCLDFLEYAYEKVFGFTFKLNLSTRPEGFLGNIETWDKAEADLTNALNASGRKWVLNPGDGAFYGPKIDITIQDALKRNFQCATIQLDFQLPNQFDLSYF 535          

HSP 2 Score: 103.219 bits (256), Expect = 1.399e-22
Identity = 55/130 (42.31%), Postives = 82/130 (63.08%), Query Frame = 2
Query: 1766 EGSFERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDLR-NLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVRKGHGEDHESWDLQELIKKFK 2152
            +G  +RPV+IHRA+LGSVER  AIL ES  GKWPFWL+PRQ  +++V +   +YAN+V +QI +AGF  + +      M +++   +  ++N IL+IG KE ++  V+VR           L +LI KF+
Sbjct:  538 KGEKQRPVMIHRAVLGSVERMTAILTESYGGKWPFWLSPRQCKIITVHESVRDYANDVKKQIFEAGFEIEYEENCGDTMNKQVRKAQLAQFNFILVIGAKEKENGTVNVRTRDNAVRGEVALDKLISKFR 667          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Celegans
Match: tars-1 (Threonine--tRNA ligase, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:P52709])

HSP 1 Score: 483.797 bits (1244), Expect = 1.631e-161
Identity = 230/498 (46.18%), Postives = 326/498 (65.46%), Query Frame = 3
Query:  228 IKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLI-ERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVY-GILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKYF 1715
            I++   +G ++     + TP+ I +  +  L+ + +I+KVNG  WDL++P   ++ +E L F++D A+  FW S+A +L   +E              +GF  D   +N++I    F  I+      V     FER+++  E   ++F ++  K+ +I E++H+     ++YRC  LID+C  P VR+TG++K + I ++ S       +  SLQR+YG+SFP+ + L  W   QEEA KR+HR +G+E +LFFFH  SPGSAF  P+G HI NKL+D IR+QYR+RGF+EV TP ++  +LWETSGHW HY E++FKI ++ KEEF +KPMNCP HCL++ H      +LP R ADFG LHR E++G L+GLTR+R+F QDDAHIFCR DQI +EI++ LDF+++ Y  +  F F L+LSTRP+ FLG+IE W+ AE  L  +L   G+ W LN GDGAFYGPKIDI I+DAL R  QCATIQLDFQLP +F+L YF
Sbjct:   82 IQITLPDGKIHEGKTWRTTPFEIAERISKGLAEAAVIAKVNGAVWDLDRPFEGNAKLELLKFDDDEAKQVFWHSSAHVLGEAMERYCGGHLCYGPPIQEGFYYDMWHENRTICPDDFPKIDQIVKAAVKDKQKFERLEMTKEDLLEMFKYNEFKVRIITEKIHTPK--TTVYRCGPLIDLCRGPHVRHTGKVKAMAITKNSSSYWEGKADAESLQRLYGISFPDSKQLKEWQKLQEEAAKRDHRKLGKEHDLFFFHQLSPGSAFWYPKGAHIYNKLVDFIRKQYRRRGFTEVITPNMYNKKLWETSGHWQHYSEDMFKIEVE-KEEFGLKPMNCPGHCLMFGHMPHTYNELPFRFADFGVLHRNEMSGALTGLTRVRRFQQDDAHIFCRQDQISEEIKQCLDFLEYAYEKVFGFTFKLNLSTRPEGFLGNIETWDKAEADLTNALNASGRKWVLNPGDGAFYGPKIDITIQDALKRNFQCATIQLDFQLPNQFDLSYF 576          

HSP 2 Score: 103.219 bits (256), Expect = 1.650e-22
Identity = 55/130 (42.31%), Postives = 82/130 (63.08%), Query Frame = 2
Query: 1766 EGSFERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDLR-NLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVRKGHGEDHESWDLQELIKKFK 2152
            +G  +RPV+IHRA+LGSVER  AIL ES  GKWPFWL+PRQ  +++V +   +YAN+V +QI +AGF  + +      M +++   +  ++N IL+IG KE ++  V+VR           L +LI KF+
Sbjct:  579 KGEKQRPVMIHRAVLGSVERMTAILTESYGGKWPFWLSPRQCKIITVHESVRDYANDVKKQIFEAGFEIEYEENCGDTMNKQVRKAQLAQFNFILVIGAKEKENGTVNVRTRDNAVRGEVALDKLISKFR 708          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Fly
Match: ThrRS (gene:FBgn0027081 transcript:FBtr0080333)

HSP 1 Score: 484.567 bits (1246), Expect = 6.905e-166
Identity = 230/495 (46.46%), Postives = 326/495 (65.86%), Query Frame = 3
Query:  228 IKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLIERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
            IKV   +G      + + TPY + +  +  L+++ +ISKVNG  WDL++ L  +  ++ L F++  A+  FW S+A ++   +E ++          + GF  D  L+ + IS+  + ++E      V    +FER+++      ++F ++  K+ ++    + ++  ++Y+C  LID+C  P VR+TG++K LKI ++ S       +  +LQR+YG+SFP+ + L  W   QEEA KR+HR IG EQELFFFH  SPGS F  PRG HI N L+  I+ +YRKRGF EV +P I+  +LW TSGHW HY EN+F    + KE+F++KPMNCP HCLI+ ++ R  ++LPLR+ADFG LHR EL+G L+GLTR+R+F QDDAHIFC P+QI+ E++  L+F+K+VY I  F F L LSTRPDN+LG++E WN AE+ L +SL +FG  W  N GDGAFYGPKIDI I DAL R HQCATIQLDFQLP+RFNL Y
Sbjct:   52 IKVTLPDGKQVDATSWETTPYEVARGISQGLADNTVISKVNGEVWDLDRVLEGNCTLQLLKFDDPEAQAVFWHSSAHIMGEAMERIYGGHLCYGPPIENGFYYDMHLEGEGISTNDYGAMEGLVKQIVKEKQNFERLEMKKSDLLEMFKYNEFKVRILNEKVTTDR-TTVYKCGSLIDLCRGPHVRHTGKVKALKITKNSSTYWEGKADAETLQRVYGISFPDPKQLKEWEKLQEEAAKRDHRKIGREQELFFFHELSPGSCFFQPRGAHIYNTLMGFIKAEYRKRGFQEVISPNIYNAKLWMTSGHWQHYAENMFSFEAE-KEKFALKPMNCPGHCLIFDNRNRSWRELPLRMADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAPEQIKSEMKGCLEFLKYVYTIFGFSFQLVLSTRPDNYLGELEQWNDAEKALAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRAHQCATIQLDFQLPIRFNLSY 544          

HSP 2 Score: 120.939 bits (302), Expect = 6.905e-166
Identity = 62/133 (46.62%), Postives = 86/133 (64.66%), Query Frame = 2
Query: 1757 LRNEGSFERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDL-RNLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVRKGHGEDHESWDLQELIKKFK 2152
            + ++G  +RPVIIHRAILGSVER +AIL E+ +GKWPFWL+PRQV+VV V   + +YA  V  Q+ DAGF+ + D      M +KI N +  ++N IL++G KE  S  V+VR    + H    + ELI K +
Sbjct:  545 IADDGEKKRPVIIHRAILGSVERMIAILTENFAGKWPFWLSPRQVMVVPVGPAYDQYAQSVRDQLHDAGFMSEADCDAGDTMNKKIRNAQLAQFNFILVVGDKERSSNTVNVRTRDNKVHGEVSVAELITKLQ 677          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Fly
Match: ThrRS (gene:FBgn0027081 transcript:FBtr0080331)

HSP 1 Score: 484.567 bits (1246), Expect = 6.905e-166
Identity = 230/495 (46.46%), Postives = 326/495 (65.86%), Query Frame = 3
Query:  228 IKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLIERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
            IKV   +G      + + TPY + +  +  L+++ +ISKVNG  WDL++ L  +  ++ L F++  A+  FW S+A ++   +E ++          + GF  D  L+ + IS+  + ++E      V    +FER+++      ++F ++  K+ ++    + ++  ++Y+C  LID+C  P VR+TG++K LKI ++ S       +  +LQR+YG+SFP+ + L  W   QEEA KR+HR IG EQELFFFH  SPGS F  PRG HI N L+  I+ +YRKRGF EV +P I+  +LW TSGHW HY EN+F    + KE+F++KPMNCP HCLI+ ++ R  ++LPLR+ADFG LHR EL+G L+GLTR+R+F QDDAHIFC P+QI+ E++  L+F+K+VY I  F F L LSTRPDN+LG++E WN AE+ L +SL +FG  W  N GDGAFYGPKIDI I DAL R HQCATIQLDFQLP+RFNL Y
Sbjct:   52 IKVTLPDGKQVDATSWETTPYEVARGISQGLADNTVISKVNGEVWDLDRVLEGNCTLQLLKFDDPEAQAVFWHSSAHIMGEAMERIYGGHLCYGPPIENGFYYDMHLEGEGISTNDYGAMEGLVKQIVKEKQNFERLEMKKSDLLEMFKYNEFKVRILNEKVTTDR-TTVYKCGSLIDLCRGPHVRHTGKVKALKITKNSSTYWEGKADAETLQRVYGISFPDPKQLKEWEKLQEEAAKRDHRKIGREQELFFFHELSPGSCFFQPRGAHIYNTLMGFIKAEYRKRGFQEVISPNIYNAKLWMTSGHWQHYAENMFSFEAE-KEKFALKPMNCPGHCLIFDNRNRSWRELPLRMADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAPEQIKSEMKGCLEFLKYVYTIFGFSFQLVLSTRPDNYLGELEQWNDAEKALAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRAHQCATIQLDFQLPIRFNLSY 544          

HSP 2 Score: 120.939 bits (302), Expect = 6.905e-166
Identity = 62/133 (46.62%), Postives = 86/133 (64.66%), Query Frame = 2
Query: 1757 LRNEGSFERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDL-RNLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVRKGHGEDHESWDLQELIKKFK 2152
            + ++G  +RPVIIHRAILGSVER +AIL E+ +GKWPFWL+PRQV+VV V   + +YA  V  Q+ DAGF+ + D      M +KI N +  ++N IL++G KE  S  V+VR    + H    + ELI K +
Sbjct:  545 IADDGEKKRPVIIHRAILGSVERMIAILTENFAGKWPFWLSPRQVMVVPVGPAYDQYAQSVRDQLHDAGFMSEADCDAGDTMNKKIRNAQLAQFNFILVVGDKERSSNTVNVRTRDNKVHGEVSVAELITKLQ 677          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Fly
Match: ThrRS (gene:FBgn0027081 transcript:FBtr0080332)

HSP 1 Score: 483.797 bits (1244), Expect = 8.154e-166
Identity = 230/495 (46.46%), Postives = 326/495 (65.86%), Query Frame = 3
Query:  228 IKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLIERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
            IKV   +G      + + TPY + +  +  L+++ +ISKVNG  WDL++ L  +  ++ L F++  A+  FW S+A ++   +E ++          + GF  D  L+ + IS+  + ++E      V    +FER+++      ++F ++  K+ ++    + ++  ++Y+C  LID+C  P VR+TG++K LKI ++ S       +  +LQR+YG+SFP+ + L  W   QEEA KR+HR IG EQELFFFH  SPGS F  PRG HI N L+  I+ +YRKRGF EV +P I+  +LW TSGHW HY EN+F    + KE+F++KPMNCP HCLI+ ++ R  ++LPLR+ADFG LHR EL+G L+GLTR+R+F QDDAHIFC P+QI+ E++  L+F+K+VY I  F F L LSTRPDN+LG++E WN AE+ L +SL +FG  W  N GDGAFYGPKIDI I DAL R HQCATIQLDFQLP+RFNL Y
Sbjct:  109 IKVTLPDGKQVDATSWETTPYEVARGISQGLADNTVISKVNGEVWDLDRVLEGNCTLQLLKFDDPEAQAVFWHSSAHIMGEAMERIYGGHLCYGPPIENGFYYDMHLEGEGISTNDYGAMEGLVKQIVKEKQNFERLEMKKSDLLEMFKYNEFKVRILNEKVTTDR-TTVYKCGSLIDLCRGPHVRHTGKVKALKITKNSSTYWEGKADAETLQRVYGISFPDPKQLKEWEKLQEEAAKRDHRKIGREQELFFFHELSPGSCFFQPRGAHIYNTLMGFIKAEYRKRGFQEVISPNIYNAKLWMTSGHWQHYAENMFSFEAE-KEKFALKPMNCPGHCLIFDNRNRSWRELPLRMADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAPEQIKSEMKGCLEFLKYVYTIFGFSFQLVLSTRPDNYLGELEQWNDAEKALAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRAHQCATIQLDFQLPIRFNLSY 601          

HSP 2 Score: 121.324 bits (303), Expect = 8.154e-166
Identity = 62/133 (46.62%), Postives = 86/133 (64.66%), Query Frame = 2
Query: 1757 LRNEGSFERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDL-RNLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVRKGHGEDHESWDLQELIKKFK 2152
            + ++G  +RPVIIHRAILGSVER +AIL E+ +GKWPFWL+PRQV+VV V   + +YA  V  Q+ DAGF+ + D      M +KI N +  ++N IL++G KE  S  V+VR    + H    + ELI K +
Sbjct:  602 IADDGEKKRPVIIHRAILGSVERMIAILTENFAGKWPFWLSPRQVMVVPVGPAYDQYAQSVRDQLHDAGFMSEADCDAGDTMNKKIRNAQLAQFNFILVVGDKERSSNTVNVRTRDNKVHGEVSVAELITKLQ 734          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Fly
Match: ThrRS (gene:FBgn0027081 transcript:FBtr0346436)

HSP 1 Score: 483.797 bits (1244), Expect = 8.154e-166
Identity = 230/495 (46.46%), Postives = 326/495 (65.86%), Query Frame = 3
Query:  228 IKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLIERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
            IKV   +G      + + TPY + +  +  L+++ +ISKVNG  WDL++ L  +  ++ L F++  A+  FW S+A ++   +E ++          + GF  D  L+ + IS+  + ++E      V    +FER+++      ++F ++  K+ ++    + ++  ++Y+C  LID+C  P VR+TG++K LKI ++ S       +  +LQR+YG+SFP+ + L  W   QEEA KR+HR IG EQELFFFH  SPGS F  PRG HI N L+  I+ +YRKRGF EV +P I+  +LW TSGHW HY EN+F    + KE+F++KPMNCP HCLI+ ++ R  ++LPLR+ADFG LHR EL+G L+GLTR+R+F QDDAHIFC P+QI+ E++  L+F+K+VY I  F F L LSTRPDN+LG++E WN AE+ L +SL +FG  W  N GDGAFYGPKIDI I DAL R HQCATIQLDFQLP+RFNL Y
Sbjct:  109 IKVTLPDGKQVDATSWETTPYEVARGISQGLADNTVISKVNGEVWDLDRVLEGNCTLQLLKFDDPEAQAVFWHSSAHIMGEAMERIYGGHLCYGPPIENGFYYDMHLEGEGISTNDYGAMEGLVKQIVKEKQNFERLEMKKSDLLEMFKYNEFKVRILNEKVTTDR-TTVYKCGSLIDLCRGPHVRHTGKVKALKITKNSSTYWEGKADAETLQRVYGISFPDPKQLKEWEKLQEEAAKRDHRKIGREQELFFFHELSPGSCFFQPRGAHIYNTLMGFIKAEYRKRGFQEVISPNIYNAKLWMTSGHWQHYAENMFSFEAE-KEKFALKPMNCPGHCLIFDNRNRSWRELPLRMADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAPEQIKSEMKGCLEFLKYVYTIFGFSFQLVLSTRPDNYLGELEQWNDAEKALAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRAHQCATIQLDFQLPIRFNLSY 601          

HSP 2 Score: 121.324 bits (303), Expect = 8.154e-166
Identity = 62/133 (46.62%), Postives = 86/133 (64.66%), Query Frame = 2
Query: 1757 LRNEGSFERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDL-RNLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVRKGHGEDHESWDLQELIKKFK 2152
            + ++G  +RPVIIHRAILGSVER +AIL E+ +GKWPFWL+PRQV+VV V   + +YA  V  Q+ DAGF+ + D      M +KI N +  ++N IL++G KE  S  V+VR    + H    + ELI K +
Sbjct:  602 IADDGEKKRPVIIHRAILGSVERMIAILTENFAGKWPFWLSPRQVMVVPVGPAYDQYAQSVRDQLHDAGFMSEADCDAGDTMNKKIRNAQLAQFNFILVVGDKERSSNTVNVRTRDNKVHGEVSVAELITKLQ 734          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Fly
Match: mRpL39 (gene:FBgn0036462 transcript:FBtr0075672)

HSP 1 Score: 71.633 bits (174), Expect = 4.306e-13
Identity = 56/235 (23.83%), Postives = 109/235 (46.38%), Query Frame = 3
Query:  234 VMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNG-LFWDLNKPLVNDSDIEFLLF---ENDIARDAFWRSTAFLLNGILEHLFSSET-YRSHS------NDKGFICDFIL--KNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLIERLHSE-NKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPN 896
             + +NG+++       TP+   Q+ +        ++ ++G + WD+++PL     ++ L F   E  +   AFWR+ +F+L   L   F  E   + HS          F+ D +L  +N      + +++  + +   A     ER+D+  ++A+++F  S  K + +  +  + N  ++LYR  D IDI   P+V +T  L   K V S + ++       +  RI GV+ P+
Sbjct:   70 TLVMNGNIS-------TPFNCAQHLSEGHCKRSALALIDGSVPWDMHRPLQESCTLQLLNFHVSEPHVVNKAFWRTCSFMLGAALNRAFKPEANLQLHSFPGPNIKSGSFVHDIVLQTQNWEPGKEEMRALSAEMVKLAAQDLRIERLDVQQDLAQEMFKDSKYKSEQLPSISQQTNGRVTLYRLGDHIDISRGPMVASTSFLG--KCVISAAHKVAEEGPSGAFYRIQGVALPS 295          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Zebrafish
Match: tars1 (threonyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-041010-218])

HSP 1 Score: 496.508 bits (1277), Expect = 2.896e-166
Identity = 238/504 (47.22%), Postives = 337/504 (66.87%), Query Frame = 3
Query:  204 KYSDDDKFIKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLI-ERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
            K + + K IK+   +G +    + K TPY +    +  L+++ +ISKVN   WDL++PL  D  + FL F+++ A+  +W S+A ++   +E ++          + GF  D  L N+ +SS  F  +E+     +     FER+++  E   ++F ++  K  ++ E++ +     ++YRC  LID+C  P VR+TG++K +KI ++ S       +  SLQRIYG+SFP+ ++L  W   QEEA  R+HR +G EQ+LFFFH+ SPGS F LP+G +I N LI+ IR +YRKRGF EV TP I+ ++LW+TSGHW HY EN+F   ++ KE F++KPMNCP HCL++ H+ R  ++LPLRLADFG LHR EL+G L+GLTR+R+F QDDAHIFC  DQIE EI+  LDF++ VY +  F F L+LSTRP+ FLG+ E+W+ AE+QL+ SL  FG+ W LN GDGAFYGPKIDI IKDA+ R HQCATIQLDFQLP+RFNL +
Sbjct:   70 KAAKESKPIKITLPDGKVVDGESWKTTPYQVACGISQGLADNTVISKVNNGVWDLDRPLEEDCSLVFLKFDDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLDNEGVSSNDFPCLENLCKKIIKEKQPFERLEVKKETLLEMFKYNKFKCRILNEKVTTPT--TTVYRCGPLIDLCRGPHVRHTGKIKAMKIHKNSSTYWEGKADMESLQRIYGISFPDPKMLKEWEKFQEEAKNRDHRKLGREQDLFFFHDLSPGSCFFLPKGAYIYNTLIEFIRSEYRKRGFQEVVTPNIYNSKLWQTSGHWQHYSENMFSFEVE-KEIFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCSMDQIESEIKGCLDFLRTVYDVFGFTFKLNLSTRPEKFLGEPEVWDQAEKQLENSLNDFGEKWVLNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTF 570          

HSP 2 Score: 108.997 bits (271), Expect = 4.030e-24
Identity = 56/126 (44.44%), Postives = 78/126 (61.90%), Query Frame = 2
Query: 1778 ERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDL-RNLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVRKGHGEDHESWDLQELIKKFK 2152
            +RPVIIHRAILGSVER +AIL E+  GKWP WL+PRQV+VV +     EYA  V ++    G + D DL     + +KI N +  +YN IL++G+KE  S  V+VR    + H    L + +++ K
Sbjct:  579 KRPVIIHRAILGSVERMIAILTENYGGKWPLWLSPRQVMVVPIGPTCDEYAQRVQKEFHKVGLMTDVDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKSSDTVNVRTRDNKVHGERSLTDCMERLK 704          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Zebrafish
Match: tars1 (threonyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-041010-218])

HSP 1 Score: 449.514 bits (1155), Expect = 9.621e-152
Identity = 224/504 (44.44%), Postives = 326/504 (64.68%), Query Frame = 3
Query:  204 KYSDDDKFIKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLI-ERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
            K + + K IK+   +G +    + K TPY +    +  L+++ +ISKVN   WDL++PL  D  + FL F+++ A+  +W S+A ++   +E ++          + GF  D  L N+ +SS  F  +E+     +     FER+++  E   ++F ++  K  ++ E++ +     ++YRC  LID+C  P VR+TG++K +KI ++ S       +  SLQRIYG+SFP+ ++L  W   QEEA  R+HR +G EQ+LFFFH+ SPGS F LP+G +I N LI+ IR +YRKRGF EV TP I+ ++LW+TSGHW HY EN+F   ++ KE F++KPMNCP HCL++ H+ R  ++LPLRLADFG LHR EL+G L+GLTR+R+F QDDAHIFC  DQIE EI+  LDF++ VY +  F F L+LSTRP+ FLG+ E+W+ AE+    ++     S +LN G  + +   IDI IKDA+ R HQCATIQLDFQLP+RFNL +
Sbjct:   52 KAAKESKPIKITLPDGKVVDGESWKTTPYQVACGISQGLADNTVISKVNNGVWDLDRPLEEDCSLVFLKFDDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLDNEGVSSNDFPCLENLCKKIIKEKQPFERLEVKKETLLEMFKYNKFKCRILNEKVTTPT--TTVYRCGPLIDLCRGPHVRHTGKIKAMKIHKNSSTYWEGKADMESLQRIYGISFPDPKMLKEWEKFQEEAKNRDHRKLGREQDLFFFHDLSPGSCFFLPKGAYIYNTLIEFIRSEYRKRGFQEVVTPNIYNSKLWQTSGHWQHYSENMFSFEVE-KEIFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCSMDQIESEIKGCLDFLRTVYDVFGFTFKLNLSTRPEKFLGEPEVWDQAEKVKFTTV-----SITLNFGADSTF---IDIQIKDAIGRYHQCATIQLDFQLPIRFNLTF 544          

HSP 2 Score: 108.997 bits (271), Expect = 9.621e-152
Identity = 56/126 (44.44%), Postives = 78/126 (61.90%), Query Frame = 2
Query: 1778 ERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDL-RNLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVRKGHGEDHESWDLQELIKKFK 2152
            +RPVIIHRAILGSVER +AIL E+  GKWP WL+PRQV+VV +     EYA  V ++    G + D DL     + +KI N +  +YN IL++G+KE  S  V+VR    + H    L + +++ K
Sbjct:  553 KRPVIIHRAILGSVERMIAILTENYGGKWPLWLSPRQVMVVPIGPTCDEYAQRVQKEFHKVGLMTDVDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKSSDTVNVRTRDNKVHGERSLTDCMERLK 678          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Zebrafish
Match: tars1 (threonyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-041010-218])

HSP 1 Score: 440.654 bits (1132), Expect = 4.010e-149
Identity = 219/504 (43.45%), Postives = 317/504 (62.90%), Query Frame = 3
Query:  204 KYSDDDKFIKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLI-ERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
            K + + K IK+   +G +    + K TPY +    +  L+++ +ISKVN   WDL++PL  D  + FL F+++ A+  +W S+A ++   +E ++          + GF  D  L N+ +SS  F  +E+     +     FER+++  E   ++F ++  K  ++ E++ +     ++YRC  LID+C  P VRNTG++K +KI ++ S       +  SLQRIYG+SFP+ ++L  W   QEEA  R+HR +G EQ+LFFFH+ SPGS F LP+G +I N LI+ IR +YRKRGF EV TP I+ ++LW+TSGHW HY EN+F   ++ KE F++KPMNCP HCL++ H+ R  ++LPLRLADFG LHR EL+G L+GLTR+R+F QDDAHIFC  DQIE EI+  LDF++ VY +  F F L+LSTRP+ FLG+ E++    ++L +                      IDI IKDA+ R HQCATIQLDFQLP+RFNL +
Sbjct:   52 KAAKESKPIKITLPDGKVVDGESWKTTPYQVACGISQGLADNTVISKVNNGVWDLDRPLEEDCSLVFLKFDDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLDNEGVSSNDFPCLENLCKKIIKEKQPFERLEVKKETLLEMFKYNKFKCRILNEKVTTPT--TTVYRCGPLIDLCRGPHVRNTGKIKAMKIHKNSSTYWEGKADMESLQRIYGISFPDPKMLKEWEKFQEEAKNRDHRKLGREQDLFFFHDLSPGSCFFLPKGAYIYNTLIEFIRSEYRKRGFQEVVTPNIYNSKLWQTSGHWQHYSENMFSFEVE-KEIFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCSMDQIESEIKGCLDFLRTVYDVFGFTFKLNLSTRPEKFLGEPEVYKQMNKELPEHF--------------------IDIQIKDAIGRYHQCATIQLDFQLPIRFNLTF 532          

HSP 2 Score: 108.997 bits (271), Expect = 4.010e-149
Identity = 56/126 (44.44%), Postives = 78/126 (61.90%), Query Frame = 2
Query: 1778 ERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDL-RNLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVRKGHGEDHESWDLQELIKKFK 2152
            +RPVIIHRAILGSVER +AIL E+  GKWP WL+PRQV+VV +     EYA  V ++    G + D DL     + +KI N +  +YN IL++G+KE  S  V+VR    + H    L + +++ K
Sbjct:  541 KRPVIIHRAILGSVERMIAILTENYGGKWPLWLSPRQVMVVPIGPTCDEYAQRVQKEFHKVGLMTDVDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKSSDTVNVRTRDNKVHGERSLTDCMERLK 666          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Zebrafish
Match: tars1 (threonyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-041010-218])

HSP 1 Score: 449.129 bits (1154), Expect = 3.475e-148
Identity = 224/504 (44.44%), Postives = 326/504 (64.68%), Query Frame = 3
Query:  204 KYSDDDKFIKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLI-ERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
            K + + K IK+   +G +    + K TPY +    +  L+++ +ISKVN   WDL++PL  D  + FL F+++ A+  +W S+A ++   +E ++          + GF  D  L N+ +SS  F  +E+     +     FER+++  E   ++F ++  K  ++ E++ +     ++YRC  LID+C  P VR+TG++K +KI ++ S       +  SLQRIYG+SFP+ ++L  W   QEEA  R+HR +G EQ+LFFFH+ SPGS F LP+G +I N LI+ IR +YRKRGF EV TP I+ ++LW+TSGHW HY EN+F   ++ KE F++KPMNCP HCL++ H+ R  ++LPLRLADFG LHR EL+G L+GLTR+R+F QDDAHIFC  DQIE EI+  LDF++ VY +  F F L+LSTRP+ FLG+ E+W+ AE+    ++     S +LN G  + +   IDI IKDA+ R HQCATIQLDFQLP+RFNL +
Sbjct:   52 KAAKESKPIKITLPDGKVVDGESWKTTPYQVACGISQGLADNTVISKVNNGVWDLDRPLEEDCSLVFLKFDDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLDNEGVSSNDFPCLENLCKKIIKEKQPFERLEVKKETLLEMFKYNKFKCRILNEKVTTPT--TTVYRCGPLIDLCRGPHVRHTGKIKAMKIHKNSSTYWEGKADMESLQRIYGISFPDPKMLKEWEKFQEEAKNRDHRKLGREQDLFFFHDLSPGSCFFLPKGAYIYNTLIEFIRSEYRKRGFQEVVTPNIYNSKLWQTSGHWQHYSENMFSFEVE-KEIFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCSMDQIESEIKGCLDFLRTVYDVFGFTFKLNLSTRPEKFLGEPEVWDQAEKVKFTTV-----SITLNFGADSTF---IDIQIKDAIGRYHQCATIQLDFQLPIRFNLTF 544          

HSP 2 Score: 94.3597 bits (233), Expect = 1.561e-19
Identity = 46/93 (49.46%), Postives = 61/93 (65.59%), Query Frame = 2
Query: 1778 ERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDL-RNLRMARKILNGEQQRYNCILII 2053
            +RPVIIHRAILGSVER +AIL E+  GKWP WL+PRQV+VV +     EYA  V ++    G + D DL     + +KI N +  +YN IL++
Sbjct:  553 KRPVIIHRAILGSVERMIAILTENYGGKWPLWLSPRQVMVVPIGPTCDEYAQRVQKEFHKVGLMTDVDLDPGCTLNKKIRNAQLAQYNFILVL 645          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Zebrafish
Match: tars1 (threonyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-041010-218])

HSP 1 Score: 440.654 bits (1132), Expect = 4.774e-145
Identity = 219/504 (43.45%), Postives = 317/504 (62.90%), Query Frame = 3
Query:  204 KYSDDDKFIKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLI-ERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
            K + + K IK+   +G +    + K TPY +    +  L+++ +ISKVN   WDL++PL  D  + FL F+++ A+  +W S+A ++   +E ++          + GF  D  L N+ +SS  F  +E+     +     FER+++  E   ++F ++  K  ++ E++ +     ++YRC  LID+C  P VRNTG++K +KI ++ S       +  SLQRIYG+SFP+ ++L  W   QEEA  R+HR +G EQ+LFFFH+ SPGS F LP+G +I N LI+ IR +YRKRGF EV TP I+ ++LW+TSGHW HY EN+F   ++ KE F++KPMNCP HCL++ H+ R  ++LPLRLADFG LHR EL+G L+GLTR+R+F QDDAHIFC  DQIE EI+  LDF++ VY +  F F L+LSTRP+ FLG+ E++    ++L +                      IDI IKDA+ R HQCATIQLDFQLP+RFNL +
Sbjct:   52 KAAKESKPIKITLPDGKVVDGESWKTTPYQVACGISQGLADNTVISKVNNGVWDLDRPLEEDCSLVFLKFDDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLDNEGVSSNDFPCLENLCKKIIKEKQPFERLEVKKETLLEMFKYNKFKCRILNEKVTTPT--TTVYRCGPLIDLCRGPHVRNTGKIKAMKIHKNSSTYWEGKADMESLQRIYGISFPDPKMLKEWEKFQEEAKNRDHRKLGREQDLFFFHDLSPGSCFFLPKGAYIYNTLIEFIRSEYRKRGFQEVVTPNIYNSKLWQTSGHWQHYSENMFSFEVE-KEIFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCSMDQIESEIKGCLDFLRTVYDVFGFTFKLNLSTRPEKFLGEPEVYKQMNKELPEHF--------------------IDIQIKDAIGRYHQCATIQLDFQLPIRFNLTF 532          

HSP 2 Score: 94.3597 bits (233), Expect = 1.666e-19
Identity = 46/93 (49.46%), Postives = 61/93 (65.59%), Query Frame = 2
Query: 1778 ERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDL-RNLRMARKILNGEQQRYNCILII 2053
            +RPVIIHRAILGSVER +AIL E+  GKWP WL+PRQV+VV +     EYA  V ++    G + D DL     + +KI N +  +YN IL++
Sbjct:  541 KRPVIIHRAILGSVERMIAILTENYGGKWPLWLSPRQVMVVPIGPTCDEYAQRVQKEFHKVGLMTDVDLDPGCTLNKKIRNAQLAQYNFILVL 633          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Xenopus
Match: tars (threonyl-tRNA synthetase 1 [Source:NCBI gene;Acc:407892])

HSP 1 Score: 505.753 bits (1301), Expect = 3.657e-170
Identity = 238/503 (47.32%), Postives = 337/503 (67.00%), Query Frame = 3
Query:  204 KYSDDDKFIKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLIERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
            K + + K IKV   +G      + K TPY I    +  L+++ +++KVNG  WDL++PL  D  +  L F+++ A+  +W S+A ++   +E ++          + GF  D  L++  +SS  F S+E+     +     FER+++  E   ++F ++  K  ++     +    ++YRC  LID+C  P VR+TG++K LK+ ++ S       +  +LQR+YG+SFP+ ++L  W   QEEA  R+HR IG EQELFFFH  SPGS F LP+G +I N+LI  IR++YRKRGF EV TP ++ ++LW+TSGHW HY EN+F   ++ KE F++KPMNCP HCL++ H+ R  ++LPLR+ADFG LHR EL+G L+GLTR+R+F QDDAHIFC  +QIE+EI+  LDF++ VY +  F F L+LSTRP+ FLGDIE+WN AE+QL+ SL +FG+ W LN GDGAFYGPKIDI IKDA+ R HQCATIQLDFQLP+RFNL Y
Sbjct:   38 KAAKESKAIKVTLPDGKQVDAESWKSTPYQIACGISQGLADNTVVAKVNGSVWDLDRPLEEDCTLALLKFDDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLEDGGVSSNDFTSLENLCKKIMKEKQQFERLEVTKETLLEMFKYNKFKCRILNE-KVDTPTTTVYRCGPLIDLCRGPHVRHTGKIKALKVHKNSSTYWEGKADMETLQRVYGISFPDPKMLKEWEKFQEEAKNRDHRKIGREQELFFFHELSPGSCFFLPKGAYIYNQLIAFIRQEYRKRGFQEVVTPNVYNSKLWQTSGHWQHYSENMFSFEVE-KEIFALKPMNCPGHCLMFDHRPRSWRELPLRMADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAMEQIEEEIKSCLDFLRAVYNVFGFTFKLNLSTRPEKFLGDIEVWNQAEKQLENSLNEFGEKWVLNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTY 538          

HSP 2 Score: 106.301 bits (264), Expect = 3.646e-23
Identity = 58/125 (46.40%), Postives = 79/125 (63.20%), Query Frame = 2
Query: 1778 ERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDL-RNLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVRKGHGEDHESWDLQELIKKF 2149
            +RPVIIHRAILGSVER +AIL E+  GKWP WL+P+QV+VV V     EYA +V +Q   AG + D DL     + +KI N +  +YN IL+IG+KE  S  V++R    + H    + E I++ 
Sbjct:  547 KRPVIIHRAILGSVERMIAILTENFGGKWPLWLSPQQVMVVPVGPTCDEYAQQV-KQFHRAGLMTDVDLDPGCTLNKKIRNAQLAQYNFILVIGEKEKASGTVNIRTRDNKVHGERTIAETIERL 670          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Xenopus
Match: tars (threonyl-tRNA synthetase 1 [Source:NCBI gene;Acc:407892])

HSP 1 Score: 505.368 bits (1300), Expect = 4.734e-170
Identity = 242/509 (47.54%), Postives = 339/509 (66.60%), Query Frame = 3
Query:  186 LLDKNTKYSDDDKFIKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLIERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
            L DK  K S   K IKV   +G      + K TPY I    +  L+++ +++KVNG  WDL++PL  D  +  L F+++ A+  +W S+A ++   +E ++          + GF  D  L++  +SS  F S+E+     +     FER+++  E   ++F ++  K  ++     +    ++YRC  LID+C  P VR+TG++K LK+ ++ S       +  +LQR+YG+SFP+ ++L  W   QEEA  R+HR IG EQELFFFH  SPGS F LP+G +I N+LI  IR++YRKRGF EV TP ++ ++LW+TSGHW HY EN+F   ++ KE F++KPMNCP HCL++ H+ R  ++LPLR+ADFG LHR EL+G L+GLTR+R+F QDDAHIFC  +QIE+EI+  LDF++ VY +  F F L+LSTRP+ FLGDIE+WN AE+QL+ SL +FG+ W LN GDGAFYGPKIDI IKDA+ R HQCATIQLDFQLP+RFNL Y
Sbjct:   35 LADKAAKES---KAIKVTLPDGKQVDAESWKSTPYQIACGISQGLADNTVVAKVNGSVWDLDRPLEEDCTLALLKFDDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLEDGGVSSNDFTSLENLCKKIMKEKQQFERLEVTKETLLEMFKYNKFKCRILNE-KVDTPTTTVYRCGPLIDLCRGPHVRHTGKIKALKVHKNSSTYWEGKADMETLQRVYGISFPDPKMLKEWEKFQEEAKNRDHRKIGREQELFFFHELSPGSCFFLPKGAYIYNQLIAFIRQEYRKRGFQEVVTPNVYNSKLWQTSGHWQHYSENMFSFEVE-KEIFALKPMNCPGHCLMFDHRPRSWRELPLRMADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAMEQIEEEIKSCLDFLRAVYNVFGFTFKLNLSTRPEKFLGDIEVWNQAEKQLENSLNEFGEKWVLNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTY 538          

HSP 2 Score: 109.768 bits (273), Expect = 3.517e-24
Identity = 58/125 (46.40%), Postives = 79/125 (63.20%), Query Frame = 2
Query: 1778 ERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDL-RNLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVRKGHGEDHESWDLQELIKKF 2149
            +RPVIIHRAILGSVER +AIL E+  GKWP WL+P+QV+VV V     EYA +V +Q   AG + D DL     + +KI N +  +YN IL+IG+KE  S  V++R    + H    + E I++ 
Sbjct:  547 KRPVIIHRAILGSVERMIAILTENFGGKWPLWLSPQQVMVVPVGPTCDEYAQQVREQFHRAGLMTDVDLDPGCTLNKKIRNAQLAQYNFILVIGEKEKASGTVNIRTRDNKVHGERTIAETIERL 671          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Xenopus
Match: tars (threonyl-tRNA synthetase 1 [Source:NCBI gene;Acc:407892])

HSP 1 Score: 506.138 bits (1302), Expect = 7.435e-170
Identity = 238/503 (47.32%), Postives = 337/503 (67.00%), Query Frame = 3
Query:  204 KYSDDDKFIKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLIERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
            K + + K IKV   +G      + K TPY I    +  L+++ +++KVNG  WDL++PL  D  +  L F+++ A+  +W S+A ++   +E ++          + GF  D  L++  +SS  F S+E+     +     FER+++  E   ++F ++  K  ++     +    ++YRC  LID+C  P VR+TG++K LK+ ++ S       +  +LQR+YG+SFP+ ++L  W   QEEA  R+HR IG EQELFFFH  SPGS F LP+G +I N+LI  IR++YRKRGF EV TP ++ ++LW+TSGHW HY EN+F   ++ KE F++KPMNCP HCL++ H+ R  ++LPLR+ADFG LHR EL+G L+GLTR+R+F QDDAHIFC  +QIE+EI+  LDF++ VY +  F F L+LSTRP+ FLGDIE+WN AE+QL+ SL +FG+ W LN GDGAFYGPKIDI IKDA+ R HQCATIQLDFQLP+RFNL Y
Sbjct:   73 KAAKESKAIKVTLPDGKQVDAESWKSTPYQIACGISQGLADNTVVAKVNGSVWDLDRPLEEDCTLALLKFDDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLEDGGVSSNDFTSLENLCKKIMKEKQQFERLEVTKETLLEMFKYNKFKCRILNE-KVDTPTTTVYRCGPLIDLCRGPHVRHTGKIKALKVHKNSSTYWEGKADMETLQRVYGISFPDPKMLKEWEKFQEEAKNRDHRKIGREQELFFFHELSPGSCFFLPKGAYIYNQLIAFIRQEYRKRGFQEVVTPNVYNSKLWQTSGHWQHYSENMFSFEVE-KEIFALKPMNCPGHCLMFDHRPRSWRELPLRMADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAMEQIEEEIKSCLDFLRAVYNVFGFTFKLNLSTRPEKFLGDIEVWNQAEKQLENSLNEFGEKWVLNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTY 573          

HSP 2 Score: 109.768 bits (273), Expect = 3.188e-24
Identity = 58/125 (46.40%), Postives = 79/125 (63.20%), Query Frame = 2
Query: 1778 ERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDL-RNLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVRKGHGEDHESWDLQELIKKF 2149
            +RPVIIHRAILGSVER +AIL E+  GKWP WL+P+QV+VV V     EYA +V +Q   AG + D DL     + +KI N +  +YN IL+IG+KE  S  V++R    + H    + E I++ 
Sbjct:  582 KRPVIIHRAILGSVERMIAILTENFGGKWPLWLSPQQVMVVPVGPTCDEYAQQVREQFHRAGLMTDVDLDPGCTLNKKIRNAQLAQYNFILVIGEKEKASGTVNIRTRDNKVHGERTIAETIERL 706          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Xenopus
Match: tars (threonyl-tRNA synthetase 1 [Source:NCBI gene;Acc:407892])

HSP 1 Score: 505.753 bits (1301), Expect = 1.311e-169
Identity = 238/503 (47.32%), Postives = 337/503 (67.00%), Query Frame = 3
Query:  204 KYSDDDKFIKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLIERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
            K + + K IKV   +G      + K TPY I    +  L+++ +++KVNG  WDL++PL  D  +  L F+++ A+  +W S+A ++   +E ++          + GF  D  L++  +SS  F S+E+     +     FER+++  E   ++F ++  K  ++     +    ++YRC  LID+C  P VR+TG++K LK+ ++ S       +  +LQR+YG+SFP+ ++L  W   QEEA  R+HR IG EQELFFFH  SPGS F LP+G +I N+LI  IR++YRKRGF EV TP ++ ++LW+TSGHW HY EN+F   ++ KE F++KPMNCP HCL++ H+ R  ++LPLR+ADFG LHR EL+G L+GLTR+R+F QDDAHIFC  +QIE+EI+  LDF++ VY +  F F L+LSTRP+ FLGDIE+WN AE+QL+ SL +FG+ W LN GDGAFYGPKIDI IKDA+ R HQCATIQLDFQLP+RFNL Y
Sbjct:   69 KAAKESKAIKVTLPDGKQVDAESWKSTPYQIACGISQGLADNTVVAKVNGSVWDLDRPLEEDCTLALLKFDDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLEDGGVSSNDFTSLENLCKKIMKEKQQFERLEVTKETLLEMFKYNKFKCRILNE-KVDTPTTTVYRCGPLIDLCRGPHVRHTGKIKALKVHKNSSTYWEGKADMETLQRVYGISFPDPKMLKEWEKFQEEAKNRDHRKIGREQELFFFHELSPGSCFFLPKGAYIYNQLIAFIRQEYRKRGFQEVVTPNVYNSKLWQTSGHWQHYSENMFSFEVE-KEIFALKPMNCPGHCLMFDHRPRSWRELPLRMADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAMEQIEEEIKSCLDFLRAVYNVFGFTFKLNLSTRPEKFLGDIEVWNQAEKQLENSLNEFGEKWVLNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTY 569          

HSP 2 Score: 83.5741 bits (205), Expect = 6.132e-16
Identity = 52/132 (39.39%), Postives = 73/132 (55.30%), Query Frame = 2
Query: 1778 ERPVIIHRAILGSVERFLAILIESNSGKW-----PFWLNPRQVLVVSVS--DKFIEYANEVCQQIKDAGFLCDTDL-RNLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVRKGHGEDHESWDLQELIKKF 2149
            +RPVIIHRAILGSVER +AIL E+  GKW      F   PRQV V + +     +    +V +Q   AG + D DL     + +KI N +  +YN IL+IG+KE  S  V++R    + H    + E I++ 
Sbjct:  578 KRPVIIHRAILGSVERMIAILTENFGGKWGKIERAFISAPRQVTVTATTPLQSVLGNYTQVREQFHRAGLMTDVDLDPGCTLNKKIRNAQLAQYNFILVIGEKEKASGTVNIRTRDNKVHGERTIAETIERL 709          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Xenopus
Match: tars (threonyl-tRNA synthetase 1 [Source:NCBI gene;Acc:407892])

HSP 1 Score: 504.597 bits (1298), Expect = 2.485e-169
Identity = 238/503 (47.32%), Postives = 337/503 (67.00%), Query Frame = 3
Query:  204 KYSDDDKFIKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLIERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
            K + + K IKV   +G      + K TPY I    +  L+++ +++KVNG  WDL++PL  D  +  L F+++ A+  +W S+A ++   +E ++          + GF  D  L++  +SS  F S+E+     +     FER+++  E   ++F ++  K  ++     +    ++YRC  LID+C  P VR+TG++K LK+ ++ S       +  +LQR+YG+SFP+ ++L  W   QEEA  R+HR IG EQELFFFH  SPGS F LP+G +I N+LI  IR++YRKRGF EV TP ++ ++LW+TSGHW HY EN+F   ++ KE F++KPMNCP HCL++ H+ R  ++LPLR+ADFG LHR EL+G L+GLTR+R+F QDDAHIFC  +QIE+EI+  LDF++ VY +  F F L+LSTRP+ FLGDIE+WN AE+QL+ SL +FG+ W LN GDGAFYGPKIDI IKDA+ R HQCATIQLDFQLP+RFNL Y
Sbjct:   67 KAAKESKAIKVTLPDGKQVDAESWKSTPYQIACGISQGLADNTVVAKVNGSVWDLDRPLEEDCTLALLKFDDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLEDGGVSSNDFTSLENLCKKIMKEKQQFERLEVTKETLLEMFKYNKFKCRILNE-KVDTPTTTVYRCGPLIDLCRGPHVRHTGKIKALKVHKNSSTYWEGKADMETLQRVYGISFPDPKMLKEWEKFQEEAKNRDHRKIGREQELFFFHELSPGSCFFLPKGAYIYNQLIAFIRQEYRKRGFQEVVTPNVYNSKLWQTSGHWQHYSENMFSFEVE-KEIFALKPMNCPGHCLMFDHRPRSWRELPLRMADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAMEQIEEEIKSCLDFLRAVYNVFGFTFKLNLSTRPEKFLGDIEVWNQAEKQLENSLNEFGEKWVLNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTY 567          

HSP 2 Score: 109.768 bits (273), Expect = 3.618e-24
Identity = 58/125 (46.40%), Postives = 79/125 (63.20%), Query Frame = 2
Query: 1778 ERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDL-RNLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVRKGHGEDHESWDLQELIKKF 2149
            +RPVIIHRAILGSVER +AIL E+  GKWP WL+P+QV+VV V     EYA +V +Q   AG + D DL     + +KI N +  +YN IL+IG+KE  S  V++R    + H    + E I++ 
Sbjct:  576 KRPVIIHRAILGSVERMIAILTENFGGKWPLWLSPQQVMVVPVGPTCDEYAQQVREQFHRAGLMTDVDLDPGCTLNKKIRNAQLAQYNFILVIGEKEKASGTVNIRTRDNKVHGERTIAETIERL 700          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Mouse
Match: Tars (threonyl-tRNA synthetase [Source:MGI Symbol;Acc:MGI:106314])

HSP 1 Score: 508.064 bits (1307), Expect = 1.519e-172
Identity = 245/504 (48.61%), Postives = 337/504 (66.87%), Query Frame = 3
Query:  204 KYSDDDKFIKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLI-ERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
            K + D K IKV   +G      + K TPY I    +  L+++ +++KVN + WDL++PL  D  +E L FE++ A+  +W S+A ++   +E ++          + GF  D  L+   +SS  F S+E      +     FER+++  E   ++F ++  K  ++ E++++     ++YRC  LID+C  P VR+TG++K LKI ++ S       +  +LQRIYG+SFP+ +LL  W   QEEA  R+HR IG +QEL+FFH  SPGS F LP+G +I N L++ IR +YRKRGF EV TP IF + LW TSGHW HY EN+F   ++ KE+F++KPMNCP HCL++ H+ R  ++LPLRLADFG LHR EL+G L+GLTR+R+F QDDAHIFC  +QIE EI+  LDF++ VY +  F F L+LSTRP+ FLGDIEIWN AE+QL+ SL +FG+ W LN GDGAFYGPKIDI IKDA+ R HQCATIQLDFQLP+RFNL Y
Sbjct:   74 KAAKDSKPIKVTLPDGKQVDAESWKTTPYQIACGISQGLADNTVVAKVNKVVWDLDRPLETDCTLELLKFEDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLEEGGVSSNDFSSLETLCKKIIKEKQTFERLEVKKETLLEMFKYNKFKCRILNEKVNTPT--TTVYRCGPLIDLCRGPHVRHTGKIKTLKIHKNSSTYWEGKADMETLQRIYGISFPDPKLLKEWEKFQEEAKNRDHRKIGRDQELYFFHELSPGSCFFLPKGAYIYNTLMEFIRSEYRKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFSFEVE-KEQFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAMEQIEDEIKGCLDFLRTVYSVFGFSFKLNLSTRPEKFLGDIEIWNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTY 574          

HSP 2 Score: 119.783 bits (299), Expect = 1.519e-172
Identity = 60/126 (47.62%), Postives = 84/126 (66.67%), Query Frame = 2
Query: 1778 ERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDL-RNLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVRKGHGEDHESWDLQELIKKFK 2152
            +RPVI+HRAILGSVER +AIL E+  GKWPFWL+PRQV+VV V     EYA +V QQ  DA F+ DTDL     + +KI N +  +YN IL++G+KE  S  V++R    + H    ++E +++ +
Sbjct:  583 KRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQFHDAKFMADTDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKASGTVNIRTRDNKVHGERTVEETVRRLQ 708          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Mouse
Match: Tarsl2 (threonyl-tRNA synthetase-like 2 [Source:MGI Symbol;Acc:MGI:2444486])

HSP 1 Score: 500.745 bits (1288), Expect = 5.829e-167
Identity = 238/533 (44.65%), Postives = 343/533 (64.35%), Query Frame = 3
Query:  114 FLKRSLSENELLKVQQIKQFLWKDLLDKNTKYSDDDKFIKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLIERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
            F+K  L   E LK           LL    +  + +  I V    G        K TPY +    + +L+   +I+KVNG+ WDL++PL  DS +E L+F+N+ A+  +W S+A +L   +E  +          + GF  D  ++++ +SS +  ++E+     +     FER+++  +   ++F ++  K  +++    +    ++YRC  LID+C+ P VR+TG++K +KI ++ S          +LQRIYG+SFP+ +++  W   QEEA  R+HR IG+EQELFFFH+ SPGS F LPRG  I N L+D IRE+Y KR F+EV +P ++ ++LWETSGHW HY  N+F   ++ K+ F++KPMNCP HCL+++H+ R  +++P+R ADFG LHR EL+G LSGLTR+R+F QDDAHIFC  +QIE+EI+  L F++ VY    F F L+LSTRP++FLG+IEIW+ AE QL+ SL +FGK W +N GDGAFYGPKIDI IKDA+ R HQCATIQLDFQLP+RFNL Y
Sbjct:  119 FIKERLQLFETLKTDH-------QLLPATQEKKNTNNVISVRVAGGKTVQGERWKTTPYQVAAGISKELAEHTVIAKVNGVLWDLDRPLEGDSTVELLMFDNEEAQAVYWHSSAHILGEAMELYYGGHLCYGPPIENGFYYDMFIEDRVVSSTELSALENICKTIIKEKQPFERLEVSKDTLLEMFKYNKFKCRILKE-KVDTPTTTVYRCGPLIDLCKGPHVRHTGKIKAIKIFKNSSTYWEGNPEMETLQRIYGISFPDSKMMKDWEKFQEEAKSRDHRKIGKEQELFFFHDLSPGSCFFLPRGAFIYNALMDFIREEYHKRNFTEVLSPNMYNSKLWETSGHWQHYSNNMFTFDVE-KDTFALKPMNCPGHCLMFAHRPRSWREMPVRFADFGVLHRNELSGTLSGLTRVRRFQQDDAHIFCMVEQIEEEIKGCLHFLQSVYSTFGFSFQLNLSTRPEHFLGEIEIWDEAERQLQNSLVEFGKPWKINPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIRFNLTY 642          

HSP 2 Score: 107.071 bits (266), Expect = 1.976e-23
Identity = 56/125 (44.80%), Postives = 80/125 (64.00%), Query Frame = 2
Query: 1781 RPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDLRN-LRMARKILNGEQQRYNCILIIGQKEVDSRQVSVRKGHGEDHESWDLQELIKKFK 2152
            RPVIIHRAILGSVER +AIL E+  GKWP WL+PRQV+V+ V      YA +V ++  + GF+ D DL +   + +KI N +  +YN IL++G+KE  +  V+VR    + H    +  +I+K K
Sbjct:  652 RPVIIHRAILGSVERMIAILSENYGGKWPLWLSPRQVMVIPVGPACENYALQVSKECFEEGFMADVDLDDSCTLNKKIRNAQLAQYNFILVVGEKEKINNAVNVRTRDNKIHGEISIASVIEKLK 776          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Mouse
Match: Tars2 (threonyl-tRNA synthetase 2, mitochondrial (putative) [Source:MGI Symbol;Acc:MGI:1919057])

HSP 1 Score: 463.381 bits (1191), Expect = 2.499e-153
Identity = 229/531 (43.13%), Postives = 320/531 (60.26%), Query Frame = 3
Query:  174 LWKDLLDKNTKYSDDD-KFIKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFIL-KNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLIERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKS----------------KEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
            LW   + K    +    + IK+    G     +    TPY +    +  L+++ + ++VNG  +DL++PL  D  + FL F++   +  FW S+A +L    E    +   R  S + GF  DF L K +++ S +   +E      +A+   F R++   +  R LF  +  KL LIE         ++Y C   +D+C  P +R+TGQ+  LK++ + S    S     +LQR+ G+SFP  ELL  W   +E A  R+HR IG+EQELFFFH  SPGS F LPRGT + N L+  IR +Y +RGFSEV TP +F  +LWE SGHW+HY+ ++F +                    K+  ++KPMNCPAHCL+++H+ R  ++LP+RLADFGALHR E +G L GLTRL +F QDDAHIFC P Q+E EI+  LDF++ VY +L F F L LSTRP  FLG+  +W+ AE+ L+++LEKFG+ W LN GDGAFYGPKID+ + DAL R HQC TIQLDFQLPLRF+L+Y
Sbjct:   47 LWTAHVKKLASMTQKKARAIKISLPEGQKVDAVAWNTTPYQLAHQISVTLADTAVAAEVNGELYDLDRPLETDCHLRFLTFDSPEGKAVFWHSSAHVLGAAAEQQLGAVLCRGPSTESGFYHDFFLGKERTVRSAELPILERICQELIAAAQPFRRLEASRDQLRQLFKDNHFKLHLIEE-KVTGPTATVYGCGMSVDLCRGPHLRHTGQIGALKLLTNSSALWRSLGAPETLQRVSGISFPKVELLRNWEARREAAELRDHRRIGKEQELFFFHELSPGSCFFLPRGTRVYNALVAFIRAEYARRGFSEVKTPTLFSTKLWEQSGHWEHYRADMFSLKPPGTDGVDNSQSGHPARCPKDTLALKPMNCPAHCLMFAHRPRSWRELPVRLADFGALHRAEASGSLGGLTRLWRFQQDDAHIFCAPHQLEAEIQGCLDFLRCVYSVLGFSFHLALSTRPPGFLGEPRLWDQAEQVLQQALEKFGEPWDLNPGDGAFYGPKIDVHLHDALGRPHQCGTIQLDFQLPLRFDLQY 576          

HSP 2 Score: 100.138 bits (248), Expect = 2.907e-21
Identity = 52/128 (40.62%), Postives = 76/128 (59.38%), Query Frame = 2
Query: 1769 GSFERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDL-RNLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVRKGHGEDHESWDLQELIKKF 2149
            G+ E PV+IHRA+LGSVER L +L ES  GKWP WL+P QV+V+ V  +  EYA +V Q ++ AG + D D    L ++R++   +   YN   ++GQ+E   R V+VR          DL E +++ 
Sbjct:  581 GTPECPVLIHRAVLGSVERLLGVLAESCGGKWPLWLSPLQVVVIPVRTEQEEYARQVQQCLQAAGLVSDLDADSGLTLSRRVRRAQLAHYNFQFVVGQREQSQRTVNVRTRDNRQLGERDLAESVQRL 708          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Mouse
Match: Tars2 (threonyl-tRNA synthetase 2, mitochondrial (putative) [Source:MGI Symbol;Acc:MGI:1919057])

HSP 1 Score: 408.683 bits (1049), Expect = 8.168e-137
Identity = 211/531 (39.74%), Postives = 298/531 (56.12%), Query Frame = 3
Query:  174 LWKDLLDKNTKYSDDD-KFIKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFIL-KNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLIERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKS----------------KEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
            LW   + K    +    + IK+    G     +    TPY +    +  L+++ + ++VNG  +DL++PL  D  + FL F++   +  FW S+A +L    E    +   R  S + GF  DF L K +++ S +   +E      +A+   F R++   +  R LF  +  KL LIE         ++Y C   +D+C  P +R+TGQ+  LK++ + S    S     +LQR+ G+SFP  ELL  W   +E A  R+HR IG+EQELFFFH  SPGS F LPRGT + N L+  IR +Y +RGFSEV TP +F  +LWE SGHW+HY+ ++F +                    K+  ++KPMNCPAHCL+++H+ R  ++LP+RLADFGALHR E +G L GLTRL +F QDDAHIFC P Q+E EI+  LDF++ VY +L F F L LSTRP  FLG+  +W+ AE+                          ID+ + DAL R HQC TIQLDFQLPLRF+L+Y
Sbjct:   47 LWTAHVKKLASMTQKKARAIKISLPEGQKVDAVAWNTTPYQLAHQISVTLADTAVAAEVNGELYDLDRPLETDCHLRFLTFDSPEGKAVFWHSSAHVLGAAAEQQLGAVLCRGPSTESGFYHDFFLGKERTVRSAELPILERICQELIAAAQPFRRLEASRDQLRQLFKDNHFKLHLIEE-KVTGPTATVYGCGMSVDLCRGPHLRHTGQIGALKLLTNSSALWRSLGAPETLQRVSGISFPKVELLRNWEARREAAELRDHRRIGKEQELFFFHELSPGSCFFLPRGTRVYNALVAFIRAEYARRGFSEVKTPTLFSTKLWEQSGHWEHYRADMFSLKPPGTDGVDNSQSGHPARCPKDTLALKPMNCPAHCLMFAHRPRSWRELPVRLADFGALHRAEASGSLGGLTRLWRFQQDDAHIFCAPHQLEAEIQGCLDFLRCVYSVLGFSFHLALSTRPPGFLGEPRLWDQAEQ--------------------------IDVHLHDALGRPHQCGTIQLDFQLPLRFDLQY 550          

HSP 2 Score: 100.138 bits (248), Expect = 8.168e-137
Identity = 52/128 (40.62%), Postives = 76/128 (59.38%), Query Frame = 2
Query: 1769 GSFERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDL-RNLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVRKGHGEDHESWDLQELIKKF 2149
            G+ E PV+IHRA+LGSVER L +L ES  GKWP WL+P QV+V+ V  +  EYA +V Q ++ AG + D D    L ++R++   +   YN   ++GQ+E   R V+VR          DL E +++ 
Sbjct:  555 GTPECPVLIHRAVLGSVERLLGVLAESCGGKWPLWLSPLQVVVIPVRTEQEEYARQVQQCLQAAGLVSDLDADSGLTLSRRVRRAQLAHYNFQFVVGQREQSQRTVNVRTRDNRQLGERDLAESVQRL 682          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Mouse
Match: Tars2 (threonyl-tRNA synthetase 2, mitochondrial (putative) [Source:MGI Symbol;Acc:MGI:1919057])

HSP 1 Score: 396.356 bits (1017), Expect = 4.333e-133
Identity = 186/358 (51.96%), Postives = 242/358 (67.60%), Query Frame = 3
Query:  687 KLDLIERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKS----------------KEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
            KL LIE         ++Y C   +D+C  P +R+TGQ+  LK++ + S    S     +LQR+ G+SFP  ELL  W   +E A  R+HR IG+EQELFFFH  SPGS F LPRGT + N L+  IR +Y +RGFSEV TP +F  +LWE SGHW+HY+ ++F +                    K+  ++KPMNCPAHCL+++H+ R  ++LP+RLADFGALHR E +G L GLTRL +F QDDAHIFC P Q+E EI+  LDF++ VY +L F F L LSTRP  FLG+  +W+ AE+ L+++LEKFG+ W LN GDGAFYGPKID+ + DAL R HQC TIQLDFQLPLRF+L+Y
Sbjct:  139 KLHLIEE-KVTGPTATVYGCGMSVDLCRGPHLRHTGQIGALKLLTNSSALWRSLGAPETLQRVSGISFPKVELLRNWEARREAAELRDHRRIGKEQELFFFHELSPGSCFFLPRGTRVYNALVAFIRAEYARRGFSEVKTPTLFSTKLWEQSGHWEHYRADMFSLKPPGTDGVDNSQSGHPARCPKDTLALKPMNCPAHCLMFAHRPRSWRELPVRLADFGALHRAEASGSLGGLTRLWRFQQDDAHIFCAPHQLEAEIQGCLDFLRCVYSVLGFSFHLALSTRPPGFLGEPRLWDQAEQVLQQALEKFGEPWDLNPGDGAFYGPKIDVHLHDALGRPHQCGTIQLDFQLPLRFDLQY 495          

HSP 2 Score: 100.138 bits (248), Expect = 4.333e-133
Identity = 52/128 (40.62%), Postives = 76/128 (59.38%), Query Frame = 2
Query: 1769 GSFERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDL-RNLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVRKGHGEDHESWDLQELIKKF 2149
            G+ E PV+IHRA+LGSVER L +L ES  GKWP WL+P QV+V+ V  +  EYA +V Q ++ AG + D D    L ++R++   +   YN   ++GQ+E   R V+VR          DL E +++ 
Sbjct:  500 GTPECPVLIHRAVLGSVERLLGVLAESCGGKWPLWLSPLQVVVIPVRTEQEEYARQVQQCLQAAGLVSDLDADSGLTLSRRVRRAQLAHYNFQFVVGQREQSQRTVNVRTRDNRQLGERDLAESVQRL 627          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. UniProt/SwissProt
Match: sp|Q9D0R2|SYTC_MOUSE (Threonine--tRNA ligase 1, cytoplasmic OS=Mus musculus OX=10090 GN=Tars1 PE=1 SV=2)

HSP 1 Score: 508.064 bits (1307), Expect = 9.231e-172
Identity = 245/504 (48.61%), Postives = 337/504 (66.87%), Query Frame = 3
Query:  204 KYSDDDKFIKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLI-ERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
            K + D K IKV   +G      + K TPY I    +  L+++ +++KVN + WDL++PL  D  +E L FE++ A+  +W S+A ++   +E ++          + GF  D  L+   +SS  F S+E      +     FER+++  E   ++F ++  K  ++ E++++     ++YRC  LID+C  P VR+TG++K LKI ++ S       +  +LQRIYG+SFP+ +LL  W   QEEA  R+HR IG +QEL+FFH  SPGS F LP+G +I N L++ IR +YRKRGF EV TP IF + LW TSGHW HY EN+F   ++ KE+F++KPMNCP HCL++ H+ R  ++LPLRLADFG LHR EL+G L+GLTR+R+F QDDAHIFC  +QIE EI+  LDF++ VY +  F F L+LSTRP+ FLGDIEIWN AE+QL+ SL +FG+ W LN GDGAFYGPKIDI IKDA+ R HQCATIQLDFQLP+RFNL Y
Sbjct:   74 KAAKDSKPIKVTLPDGKQVDAESWKTTPYQIACGISQGLADNTVVAKVNKVVWDLDRPLETDCTLELLKFEDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLEEGGVSSNDFSSLETLCKKIIKEKQTFERLEVKKETLLEMFKYNKFKCRILNEKVNTPT--TTVYRCGPLIDLCRGPHVRHTGKIKTLKIHKNSSTYWEGKADMETLQRIYGISFPDPKLLKEWEKFQEEAKNRDHRKIGRDQELYFFHELSPGSCFFLPKGAYIYNTLMEFIRSEYRKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFSFEVE-KEQFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAMEQIEDEIKGCLDFLRTVYSVFGFSFKLNLSTRPEKFLGDIEIWNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTY 574          

HSP 2 Score: 119.783 bits (299), Expect = 9.231e-172
Identity = 60/126 (47.62%), Postives = 84/126 (66.67%), Query Frame = 2
Query: 1778 ERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDL-RNLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVRKGHGEDHESWDLQELIKKFK 2152
            +RPVI+HRAILGSVER +AIL E+  GKWPFWL+PRQV+VV V     EYA +V QQ  DA F+ DTDL     + +KI N +  +YN IL++G+KE  S  V++R    + H    ++E +++ +
Sbjct:  583 KRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQFHDAKFMADTDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKASGTVNIRTRDNKVHGERTVEETVRRLQ 708          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. UniProt/SwissProt
Match: sp|Q5XHY5|SYTC_RAT (Threonine--tRNA ligase 1, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Tars1 PE=1 SV=1)

HSP 1 Score: 507.294 bits (1305), Expect = 4.733e-170
Identity = 245/504 (48.61%), Postives = 337/504 (66.87%), Query Frame = 3
Query:  204 KYSDDDKFIKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLI-ERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
            K + D K IKV   +G      + K TPY I    +  L+++ +++KVN + WDL++PL  D  +E L FE++ A+  +W S+A ++   +E ++          + GF  D  L+   +SS  F S+E      +     FER+++  E   ++F ++  K  ++ E++++     ++YRC  LID+C  P VR+TG++K LKI ++ S       +  +LQRIYG+SFP+ +LL  W   QEEA  R+HR IG +QEL+FFH  SPGS F LP+G +I N L++ IR +YRKRGF EV TP IF + LW TSGHW HY EN+F   ++ KE+F++KPMNCP HCL++ H+ R  ++LPLRLADFG LHR EL+G L+GLTR+R+F QDDAHIFC  +QIE EI+  LDF++ VY +  F F L+LSTRP+ FLGDIEIWN AE+QL+ SL +FG+ W LN GDGAFYGPKIDI IKDA+ R HQCATIQLDFQLP+RFNL Y
Sbjct:   47 KAAKDSKPIKVTLPDGKQVDAESWKTTPYQIACGISQGLADNTVVAKVNKVVWDLDRPLETDCTLELLKFEDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLEEGGVSSNDFSSLETLCKKIIKEKQTFERLEVKKETLLEMFKYNKFKCRILNEKVNTPT--TTVYRCGPLIDLCRGPHVRHTGKIKTLKIHKNSSTYWEGKADMETLQRIYGISFPDPKLLKEWEKFQEEAKNRDHRKIGRDQELYFFHELSPGSCFFLPKGAYIYNTLMEFIRSEYRKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFSFEVE-KEQFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAMEQIEDEIKGCLDFLRTVYSVFGFSFKLNLSTRPEKFLGDIEIWNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTY 547          

HSP 2 Score: 114.775 bits (286), Expect = 4.733e-170
Identity = 60/115 (52.17%), Postives = 78/115 (67.83%), Query Frame = 2
Query: 1778 ERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDL-RNLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVR----KGHGE 2107
            +RPVI+HRAILGSVER +AIL E+  GKWPFWL+PRQV+VV V     EYA +V Q+  DA F+ D DL     + +KI N +  +YN IL++G+KE  S  V++R    K HGE
Sbjct:  556 KRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQEFHDAKFMVDIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKASGTVNIRTRDNKVHGE 670          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. UniProt/SwissProt
Match: sp|P26639|SYTC_HUMAN (Threonine--tRNA ligase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS1 PE=1 SV=3)

HSP 1 Score: 504.212 bits (1297), Expect = 1.663e-169
Identity = 245/504 (48.61%), Postives = 335/504 (66.47%), Query Frame = 3
Query:  204 KYSDDDKFIKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLI-ERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
            K   D K IKV   +G      + K TPY I    +  L+++ +I+KVN + WDL++PL  D  +E L FE++ A+  +W S+A ++   +E ++          + GF  D  L+   +SS  F S+E      +     FER+++  E    +F ++  K  ++ E++++     ++YRC  LID+C  P VR+TG++K LKI ++ S       +  +LQRIYG+SFP+ ++L  W   QEEA  R+HR IG +QEL+FFH  SPGS F LP+G +I N LI+ IR +YRKRGF EV TP IF + LW TSGHW HY EN+F   ++ KE F++KPMNCP HCL++ H+ R  ++LPLRLADFG LHR EL+G L+GLTR+R+F QDDAHIFC  +QIE EI+  LDF++ VY +  F F L+LSTRP+ FLGDIE+W+ AE+QL+ SL +FG+ W LNSGDGAFYGPKIDI IKDA+ R HQCATIQLDFQLP+RFNL Y
Sbjct:   75 KAEKDSKPIKVTLPDGKQVDAESWKTTPYQIACGISQGLADNTVIAKVNNVVWDLDRPLEEDCTLELLKFEDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLEEGGVSSNDFSSLEALCKKIIKEKQAFERLEVKKETLLAMFKYNKFKCRILNEKVNTPT--TTVYRCGPLIDLCRGPHVRHTGKIKALKIHKNSSTYWEGKADMETLQRIYGISFPDPKMLKEWEKFQEEAKNRDHRKIGRDQELYFFHELSPGSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFSFEVE-KELFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAMEQIEDEIKGCLDFLRTVYSVFGFSFKLNLSTRPEKFLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTY 575          

HSP 2 Score: 115.931 bits (289), Expect = 1.663e-169
Identity = 60/126 (47.62%), Postives = 82/126 (65.08%), Query Frame = 2
Query: 1778 ERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDL-RNLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVRKGHGEDHESWDLQELIKKFK 2152
            +RPVI+HRAILGSVER +AIL E+  GKWPFWL+PRQV+VV V     EYA +V QQ  DA F+ D DL     + +KI N +  +YN IL++G+KE  S  V++R    + H    + E I++ +
Sbjct:  584 KRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERTISETIERLQ 709          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. UniProt/SwissProt
Match: sp|Q54J66|SYTC1_DICDI (Probable threonine--tRNA ligase 1, cytoplasmic OS=Dictyostelium discoideum OX=44689 GN=thrS1 PE=3 SV=1)

HSP 1 Score: 491.115 bits (1263), Expect = 6.247e-169
Identity = 237/516 (45.93%), Postives = 335/516 (64.92%), Query Frame = 3
Query:  174 LWKDLLDKNTKYSDD--DKFIKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNG-LFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLIERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
            +W+ L  K+ +   D  ++ I V   +G +   +  K TPY I +  +  L++SI+ SKVNG   WD+++PL  D +++   F+++  +  FW S+A +L   +E ++  +     +  +GF  D  + +K +S+  ++ I +     V     FER+ +P +IA  +F F+  K ++I ++  E+  +SLYRC  L+D+C  P V NT  +K   + ++ S         + LQR+YG+SFP+K+ ++ +     EA  R+HR +G+ QELFFFH  SPGSAF LP GT I NKL++ IRE+Y +RGF+EV +P IF  +LWE SGHW  Y EN+F + +  K+ FS+KPMNCP HCL++  +QR  ++LPLR ADFG LHR EL G L+GLTR+RKF QDDAHIFC  + IE EI   L F+++VYGI  FEF L LSTRPDNFLG+I  W++AE  L+K+L KFGK W LN  DGAFYGPKIDI I D L R HQCATIQLDFQLP+RF+L+Y
Sbjct:   56 IWESLKAKHLESLKDMKEEPINVTLPDGKVVAGIKNKTTPYDIAKGISRGLADSIVSSKVNGEQIWDISRPLEADCNLQLCKFDSEEGKKTFWHSSAHILGQAMERIYGGQLCIGPATSEGFYYDMAMGDKIVSAEDYKLINEVAQKIVQEKQPFERLAVPRDIALTMFKFNKYKTEIISKIPQEDT-VSLYRCGTLVDLCRGPHVPNTSYIKSFAVTKNSSAYWLGKAENDDLQRVYGISFPDKKQMEEYENFMREAALRDHRNVGKAQELFFFHPYSPGSAFFLPHGTRIYNKLVEFIREEYHRRGFTEVISPSIFSQKLWEQSGHWQKYSENMFVLPV-DKDNFSLKPMNCPGHCLMFGSRQRSYRELPLRFADFGVLHRNELAGALTGLTRVRKFQQDDAHIFCTTEMIEDEINSCLGFMQYVYGIFGFEFGLELSTRPDNFLGEIAQWDIAEASLEKALNKFGKPWKLNPKDGAFYGPKIDIHITDCLKRSHQCATIQLDFQLPIRFDLEY 569          

HSP 2 Score: 127.102 bits (318), Expect = 6.247e-169
Identity = 59/125 (47.20%), Postives = 85/125 (68.00%), Query Frame = 2
Query: 1778 ERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDLRNLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVRKGHGEDHESWDLQELIKKFK 2152
            +RPVIIHRAILGSVER +AILIE   GKWP W++PRQ +VV+V+    EY  +VC++I DAGF CD D  +  +++K+   +  +YN IL++GQ+E++   V+VR        S  + +LI +FK
Sbjct:  579 KRPVIIHRAILGSVERMMAILIEHTGGKWPLWVSPRQAIVVTVNKTHNEYGQKVCKEISDAGFYCDIDDSDKTISKKVREAQLAQYNYILVVGQEEINGNTVNVRTRDNVVRGSLTVNDLISEFK 703          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. UniProt/SwissProt
Match: sp|Q0V9S0|SYTC2_XENTR (Threonine--tRNA ligase 2, cytoplasmic OS=Xenopus tropicalis OX=8364 GN=tars3 PE=2 SV=1)

HSP 1 Score: 501.901 bits (1291), Expect = 2.105e-168
Identity = 236/504 (46.83%), Postives = 335/504 (66.47%), Query Frame = 3
Query:  201 TKYSDDDKFIKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLIERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
             + +   K IK+   +G      + K TPY +    +  L+++++I+KVN   WDL++PL  DS++E L F+++ A+  +W S+A +L   +E+ +          + GF  D  L  + +SS +F S+E+     +     FER+++  ++  ++F ++  K  ++     +    ++YRC  LID+C  P VR+TG++K LKI ++ S       +  +LQRIYG+SFP+ +L+  W   QEEA  R+HR IG +QELFFFH+ SPGS F LPRG HI N L D I+ +Y+ R F+EV +P I+ ++LWE SGHW HY EN+F   ++ KE F++KPMNCP HCL++ H+ R  ++LPLR ADFG LHR EL+G LSGLTR+R+F QDDAHIFC  DQI++E+   L F++ VY +  F F LHLSTRP+N+LG+IEIWN AE+QL+ SL +FG+ W LN GDGAFYGPKIDI IKDA+ R HQCATIQLDFQLP+RFNL Y
Sbjct:  165 ARAAHQSKPIKITLADGKQVDGESWKTTPYQVAIGISKGLADNVVIAKVNNELWDLDRPLEQDSNVELLKFDSEEAQAVYWHSSAHILGETMENFYGGCLCYGPPIENGFYYDMYLDGRGVSSNEFPSLENMCKAIIKEKQPFERLEVSKDLLLEMFKYNKFKCRILNE-KVDTPTTTVYRCGPLIDLCRGPHVRHTGKIKTLKIYKNSSTYWEGRADMETLQRIYGISFPDSKLMKEWEQFQEEAKNRDHRKIGRDQELFFFHDLSPGSCFFLPRGAHIYNTLTDFIKGEYQIRNFTEVASPNIYNSKLWEMSGHWQHYSENMFSFEVE-KETFALKPMNCPGHCLMFGHRPRSWRELPLRFADFGVLHRNELSGTLSGLTRVRRFQQDDAHIFCTMDQIQEEMNGCLQFLQSVYKVFGFTFQLHLSTRPENYLGEIEIWNEAEKQLESSLNQFGEPWKLNPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIRFNLTY 666          

HSP 2 Score: 114.775 bits (286), Expect = 2.105e-168
Identity = 59/126 (46.83%), Postives = 82/126 (65.08%), Query Frame = 2
Query: 1778 ERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDL-RNLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVRKGHGEDHESWDLQELIKKFK 2152
            +RPVIIHRAILGSVER +AIL E+  GKWPFWL+PRQV+V+ V     EYA +VC+ + +AGF+ + DL  +  + +KI N +  + N IL++G+KE     V+VR    + H    L   I+K K
Sbjct:  675 KRPVIIHRAILGSVERMIAILCENYGGKWPFWLSPRQVMVIPVGPSCDEYAQQVCKDVFEAGFMAEVDLDHSCTLNKKIRNAQLAQCNFILVVGEKEKTDSAVNVRTRDNKVHGEILLTSAIEKLK 800          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. TrEMBL
Match: A0A218UNN2 (Putative threonine--tRNA ligase 2, cytoplasmic OS=Lonchura striata domestica OX=299123 GN=TARSL2 PE=3 SV=1)

HSP 1 Score: 525.013 bits (1351), Expect = 1.513e-175
Identity = 246/504 (48.81%), Postives = 348/504 (69.05%), Query Frame = 3
Query:  204 KYSDDDKFIKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLI-ERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
            + ++  + IKV   +G      + K TPY +    +  L+++ +I+KVNG  WDL++PL  D  +E L F+N+ A+  +W S+A +L   +E  F          + GF  D  ++++S+SS +F  +E++  N +     FER+++  EI  D+F ++  K  ++ E++ +     ++YRC  LID+C+ P VR+TG++K LKI++S S       +  +LQRIYG+SFP+ +++  W   QEEA  R+HR IG+EQELFFFH+ SPGS F LPRG  + N L+D IR +YR+R F+EV +P +F ++LWE SGHW HY EN+F   ++ KE F++KPMNCP HCL+++H+ R  ++LPLRLADFG LHR EL+G LSGLTR+R+F QDDAHIFC  +QIE+EI+  LDF+K VY +  F F LHLSTRP+N+LGD+EIW+ AE+QL+ SL  FG+ W+LN GDGAFYGPKIDI IKDA+ R HQCATIQLDFQLP+RFNL Y
Sbjct:  142 RAANQSRSIKVTLTDGETVEGESWKTTPYQLAVGISQVLASNAVIAKVNGELWDLDRPLEGDCTLELLTFDNEEAKAVYWHSSAHILGEAMEGYFGGCLCYGPPIENGFHYDMYIEDRSVSSTEFPLLENRCKNIIKEKQAFERLEVKKEILLDMFKYNKFKCRILNEKVKTPT--TTVYRCGPLIDLCKGPHVRHTGKIKALKIIKSSSTYWEGKSDMETLQRIYGISFPDNKMMKEWEKIQEEAKNRDHRKIGKEQELFFFHDLSPGSCFFLPRGAFLYNTLVDFIRGEYRRRNFTEVVSPNVFNSKLWEASGHWQHYSENMFSFEIE-KETFALKPMNCPGHCLMFAHRPRSWRELPLRLADFGVLHRNELSGTLSGLTRVRRFQQDDAHIFCTMEQIEEEIKDCLDFLKSVYAVFGFTFQLHLSTRPENYLGDLEIWDHAEKQLQNSLNNFGEQWNLNPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIRFNLTY 642          

HSP 2 Score: 123.25 bits (308), Expect = 1.513e-175
Identity = 67/130 (51.54%), Postives = 90/130 (69.23%), Query Frame = 2
Query: 1778 ERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDL-RNLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVR----KGHGEDHESWDLQELIKKFK 2152
            +RPVIIHRAILGSVER +AIL E+  GKWPFWL+PRQV+VV V     +YA +VC Q  +AGF+ D DL ++  + +KI N +  +YN IL++G+KE  +  V+VR    K HGE   S  +++L KKFK
Sbjct:  651 KRPVIIHRAILGSVERMIAILAENYGGKWPFWLSPRQVMVVPVGPTSEQYAQQVCDQFFEAGFMSDVDLDQSCTLNKKIRNAQLAQYNFILVVGEKEKANNAVNVRTRDNKVHGEISVSSTIEKL-KKFK 779          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. TrEMBL
Match: A0A091JGJ5 (Putative threonine--tRNA ligase 2, cytoplasmic (Fragment) OS=Egretta garzetta OX=188379 GN=Z169_06632 PE=3 SV=1)

HSP 1 Score: 525.783 bits (1353), Expect = 1.646e-175
Identity = 244/504 (48.41%), Postives = 349/504 (69.25%), Query Frame = 3
Query:  204 KYSDDDKFIKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLI-ERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
            + ++  K IK+   +G +    + K TPY +    +  L+++ +I+KVNG  WDL++PL  D  +E L+F+N+ A+  +W S+A +L   +E  F          + GF  D   +++ +SS +F  +E++  N +     FER+++  EI  D+F ++  K  ++ E++++     ++YRC  LID+C  P VR+TG++K LKIV++ S       +  +LQRIYG+SFP+ +++  W   QEEA  R+HR IG+EQELFFFH+ SPGS F LPRG  + N L+D IRE+Y +R F+EV +P IF ++LWE SGHW HY EN+F   ++ KE F++KPMNCP HCL+++H+ R  +++PLRLADFG LHR EL+G LSGLTR+R+F QDDAHIFC  +QIE+EI+  LDF+K VY +  F F LHLSTRP+N+LG++EIW+ AE+QL+ SL+ FG+ W+LN GDGAFYGPKIDI IKDA+ R HQCATIQLDFQLP+RFNL Y
Sbjct:   25 RAANQSKTIKITLTDGKMAEGESWKTTPYQVAVGISQMLASNAVIAKVNGELWDLDRPLEGDCTLELLMFDNEEAKAVYWHSSAHILGEAMEGYFGGCLCYGPPIENGFYYDMYTEDRGVSSTEFPLLENRCKNIIKEKQAFERLEVKKEILLDMFKYNKFKCRILNEKVNTPT--TTIYRCGPLIDLCRGPHVRHTGKIKTLKIVKNSSTYWEGKSDMETLQRIYGISFPDNKMMKEWEKFQEEARNRDHRKIGKEQELFFFHDLSPGSCFFLPRGAFLYNTLVDFIREEYHRRNFTEVVSPNIFNSKLWEASGHWQHYSENMFSFEIE-KETFALKPMNCPGHCLMFAHRPRSWREMPLRLADFGVLHRNELSGTLSGLTRVRRFQQDDAHIFCTIEQIEEEIKGCLDFLKSVYAVFGFTFQLHLSTRPENYLGELEIWDHAEKQLQNSLDNFGEQWNLNPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIRFNLTY 525          

HSP 2 Score: 122.479 bits (306), Expect = 1.646e-175
Identity = 67/130 (51.54%), Postives = 90/130 (69.23%), Query Frame = 2
Query: 1778 ERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDL-RNLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVR----KGHGEDHESWDLQELIKKFK 2152
            +RPVIIHRAILGSVER +AIL E+  GKWPFWL+PRQV+VV V     EYA +VC +  +AGF+ D DL ++  + +KI N +  +YN IL++G+KE  +  V+VR    K HGE   S  +++L KKFK
Sbjct:  534 KRPVIIHRAILGSVERMIAILAENYGGKWPFWLSPRQVMVVPVGPASEEYAQQVCSKFFEAGFMSDVDLDQSCTLNKKIRNAQLAQYNFILVVGEKEKANNAVNVRTRDNKVHGEISVSSAIEKL-KKFK 662          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. TrEMBL
Match: A0A3L8SKS5 (AA_TRNA_LIGASE_II domain-containing protein OS=Chloebia gouldiae OX=44316 GN=DV515_00006282 PE=3 SV=1)

HSP 1 Score: 524.628 bits (1350), Expect = 4.580e-175
Identity = 244/503 (48.51%), Postives = 345/503 (68.59%), Query Frame = 3
Query:  204 KYSDDDKFIKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLIERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
            + ++  K IK+   +G      + K TPY +    +  L+++ +I+KVNG  WDL++PL  D  +E L F+N+ A+  +W S+A +L   +E  F          + GF  D  ++++S+SS +F  +E++  N +     FER+++  EI  D+F ++  K  ++     +    ++YRC  LID+C+ P VR+TG++K LK+++S S       +  +LQRIYG+SFP+ +++  W   QEEA  R+HR IG+EQELFFFH+ SPGS F LPRG  + N L+D IR +YR+R F+EV +P +F ++LWE SGHW HY EN+F   ++ KE F++KPMNCP HCL+++H+ R  ++LPLRLADFG LHR EL+G LSGLTR+R+F QDDAHIFC  +QIE+EI+  LDF+K VY +  F F LHLSTRP+N+LGD+EIW+ AE+QL+ SL  FG+ W+LN GDGAFYGPKIDI IKDA+ R HQCATIQLDFQLP+RFNL Y
Sbjct:   76 RAANQSKSIKITLTDGKTVEGESWKTTPYQLAVGISQVLASNAVIAKVNGELWDLDRPLEGDCTLELLTFDNEEAKAVYWHSSAHILGEAMEGYFGGCLCYGPPIENGFHYDMYMEDRSVSSTEFPLLENRCKNIIKEKQAFERLEVKKEILLDMFKYNKFKCRILNE-KVKTPTTTVYRCGPLIDLCKGPHVRHTGKIKALKVIKSSSTYWEGKSDMETLQRIYGISFPDNKMMKEWEKVQEEAKNRDHRKIGKEQELFFFHDLSPGSCFFLPRGAFLYNTLVDFIRGEYRRRNFTEVVSPNVFNSKLWEASGHWQHYSENMFSFEIE-KETFALKPMNCPGHCLMFAHRPRSWRELPLRLADFGVLHRNELSGTLSGLTRVRRFQQDDAHIFCTMEQIEEEIKDCLDFLKSVYAVFGFTFQLHLSTRPENYLGDLEIWDHAEKQLQNSLNNFGEQWNLNPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIRFNLTY 576          

HSP 2 Score: 122.094 bits (305), Expect = 4.580e-175
Identity = 67/130 (51.54%), Postives = 90/130 (69.23%), Query Frame = 2
Query: 1778 ERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDL-RNLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVR----KGHGEDHESWDLQELIKKFK 2152
            +RPVIIHRAILGSVER +AIL E+  GKWPFWL+PRQV+VV V     +YA +VC Q  +AGF+ D DL ++  + +KI N +  +YN IL++G+KE  +  V+VR    K HGE   S  +++L KKFK
Sbjct:  585 KRPVIIHRAILGSVERMIAILAENYGGKWPFWLSPRQVMVVPVGPASEQYAQQVCDQFFEAGFMSDVDLDQSCTLNKKIRNAQLAQYNFILVVGEKEKVNNAVNVRTRDNKIHGEISVSSTIEKL-KKFK 713          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. TrEMBL
Match: H0Z5V3 (Threonyl-tRNA synthetase like 2 OS=Taeniopygia guttata OX=59729 GN=TARSL2 PE=3 SV=1)

HSP 1 Score: 523.857 bits (1348), Expect = 4.736e-175
Identity = 245/503 (48.71%), Postives = 345/503 (68.59%), Query Frame = 3
Query:  204 KYSDDDKFIKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLIERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
            + ++  + IK+   +G      + K TPY +    +  L+++ +I+KVNG  WDL++PL  D  +E L F+N+ A+  +W S+A +L   +E  F          + GF  D  ++++S+SS +F  +E++  N +     FER+++  EI  D+F ++  K  ++     +    ++YRC  LID+C+ P VR+TG++K LKI++S S       +  +LQRIYG+SFP+ +++  W   QEEA  R+HR IG+EQELFFFH+ SPGS F LPRG  + N L+D IR +YR+R F+EV +P +F ++LWE SGHW HY EN+F   ++ KE F+IKPMNCP HCL+++H+ R  ++LPLRLADFG LHR EL+G LSGLTR+R+F QDDAHIFC  +QIE+EI+  LDF+K VY +  F F LHLSTRP+N+LGD+EIW+ AE+QL+ SL  FG+ W+LN GDGAFYGPKIDI IKDA+ R HQCATIQLDFQLP+RFNL Y
Sbjct:   25 RAANQSRSIKITWTDGETVEGESWKTTPYQLAVGISQVLASNAVIAKVNGELWDLDRPLEGDCTLELLTFDNEEAKAVYWHSSAHILGEAMEGYFGGCLCYGPPIENGFHYDMYIEDRSVSSTEFPLLENRCKNIIKEKQAFERLEVKKEILLDMFKYNKFKCRILNE-KVKTPTTTVYRCGPLIDLCKGPHVRHTGKIKALKIIKSSSTYWEGKSDMETLQRIYGISFPDNKMMKEWEKIQEEAKNRDHRKIGKEQELFFFHDLSPGSCFFLPRGAFLYNTLVDFIRGEYRRRNFTEVVSPNVFNSKLWEASGHWQHYSENMFSFEVE-KETFAIKPMNCPGHCLMFAHRPRSWRELPLRLADFGVLHRNELSGTLSGLTRVRRFQQDDAHIFCTMEQIEEEIKDCLDFLKSVYAVFGFTFQLHLSTRPENYLGDLEIWDHAEKQLQNSLNNFGEQWNLNPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIRFNLTY 525          

HSP 2 Score: 122.865 bits (307), Expect = 4.736e-175
Identity = 67/130 (51.54%), Postives = 90/130 (69.23%), Query Frame = 2
Query: 1778 ERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDL-RNLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVR----KGHGEDHESWDLQELIKKFK 2152
            +RPVIIHRAILGSVER +AIL E+  GKWPFWL+PRQV+VV V     +YA +VC Q  +AGF+ D DL ++  + +KI N +  +YN IL++G+KE  +  V+VR    K HGE   S  +++L KKFK
Sbjct:  534 KRPVIIHRAILGSVERMIAILAENYGGKWPFWLSPRQVMVVPVGPASEQYAQQVCDQFFEAGFMSDVDLDQSCTLNKKIRNAQLAQYNFILVVGEKEKANNAVNVRTRDNKVHGEISVSSTIEKL-KKFK 662          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. TrEMBL
Match: U3KDA9 (Threonyl-tRNA synthetase like 2 OS=Ficedula albicollis OX=59894 GN=TARSL2 PE=3 SV=1)

HSP 1 Score: 522.702 bits (1345), Expect = 1.053e-174
Identity = 246/504 (48.81%), Postives = 346/504 (68.65%), Query Frame = 3
Query:  204 KYSDDDKFIKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLI-ERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
            + ++  K IKV   +G +    + + TPY +    +  L+++ +I+KVNG  WDL++PL  D  +E L F+N+ A+  +W S+A +L   +E  F          + GF  D  ++++S+SS +F  +E++  N +     FER+++  EI  D+F ++  K  ++ E++ +     ++YRC  LID+C  P VR+TG++K LKI++S S       +  +LQRIYG+SFP+ +++  W   QEEA  R+HR IG+EQELFFFH+ SPGS F LPRG  + N L D IR +YR+R F+EV +P I+ ++LWE SGHW HY EN+F   ++ KE F++KPMNCP HCL+++H+ R  ++LPLRLADFG LHR EL+G LSGLTR+R+F QDDAHIFC  +QIE+EI+  LDF+K VY +  F F LHLSTRP+N+LGD EIW+ AE+QL+ SL  FG+ W+LN GDGAFYGPKIDI IKDA+ R HQCATIQLDFQLP+RFNL Y
Sbjct:   93 RAANQSKSIKVTLTDGEMVEGESWRTTPYELAVGISQVLASNAVIAKVNGELWDLDRPLEGDCTLELLTFDNEEAKAVYWHSSAHILGEAMEGYFGGCLCYGPPIENGFHYDMYIEDRSVSSTEFPLLENRCKNIIKEKQAFERLEVKKEILLDMFKYNKFKCRILNEKVKTPT--TTVYRCGPLIDLCRGPHVRHTGKIKALKIIKSSSTYWEGKSDMETLQRIYGISFPDNKMMKEWEKVQEEAKNRDHRKIGKEQELFFFHDLSPGSCFFLPRGAFLYNTLTDFIRGEYRRRNFTEVVSPNIYNSKLWEASGHWQHYSENMFSFEIE-KETFALKPMNCPGHCLMFAHRPRSWRELPLRLADFGVLHRNELSGTLSGLTRVRRFQQDDAHIFCTMEQIEEEIKGCLDFLKSVYAVFGFTFQLHLSTRPENYLGDSEIWDHAEKQLQNSLNNFGEQWNLNPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIRFNLTY 593          

HSP 2 Score: 122.865 bits (307), Expect = 1.053e-174
Identity = 67/130 (51.54%), Postives = 90/130 (69.23%), Query Frame = 2
Query: 1778 ERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDL-RNLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVR----KGHGEDHESWDLQELIKKFK 2152
            +RPVIIHRAILGSVER +AIL E+  GKWPFWL+PRQV+VV V     +YA +VC Q  +AGF+ D DL ++  + +KI N +  +YN IL++G+KE  +  V+VR    K HGE   S  +++L KKFK
Sbjct:  602 KRPVIIHRAILGSVERMIAILAENYGGKWPFWLSPRQVMVVPVGPTSEQYAQQVCSQFFEAGFMSDVDLDQSCTLNKKIRNAQLAQYNFILVVGEKEKANNAVNVRTRDNKVHGEISVSSAIEKL-KKFK 730          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Cavefish
Match: tars3 (threonyl-tRNA synthetase 3 [Source:ZFIN;Acc:ZDB-GENE-081104-490])

HSP 1 Score: 491.5 bits (1264), Expect = 1.767e-167
Identity = 234/505 (46.34%), Postives = 334/505 (66.14%), Query Frame = 3
Query:  201 TKYSDDDKFIKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFIL-KNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLIERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
             K + + + I V+  +G      +   TPY +    +  L+++ +I++V+G  WDL++PL  D  +E L F+++ A+  +W S+A +L   +E  +          + GF  D  L + K +SS +F  +E    + +     FER++I  E   ++F ++  K  ++     E    ++YRC  LID+C  P VR+TG++K LKI ++ +       +  +LQRIYG+SFP+ ++L  W   QEEA  R+HR IG++QELFFFH+ SPGS F LPRG +I N L + IRE+Y +RGF EV +P I+ ++LWETSGHW HY EN+F   ++ ++ F++KPMNCP HCL++ H+ R  ++LPLRLADFG LHR EL+G L+GLTR+R+F QDDAHIFC  +QIE E++  LDF++ VY +  F F LHLSTRP+ FLGDI +WN AE+QL+ SL +FG+ W LN GDGAFYGPKIDI IKDA+ R HQCATIQLDFQLP+RF+L Y
Sbjct:  206 AKQAANSQPISVVLPDGQKVEAQSWITTPYQLACGISQGLADNCVIARVDGGLWDLDRPLQKDCSLELLRFDHEDAQAVYWHSSAHILGEAMERFYGGCLCYGPPIENGFYYDMFLDEQKGVSSTEFGDLETLCKSIMKDKQPFERLEISKETLLEMFKYNKFKCRILNE-KVETPTTTVYRCGPLIDLCRGPHVRHTGKIKALKIYKNSATYWEGRSDMETLQRIYGISFPDSKMLKEWERFQEEAKNRDHRKIGKDQELFFFHDLSPGSCFFLPRGAYIYNTLTEFIREEYWRRGFQEVASPNIYNSKLWETSGHWQHYSENMFSFPVE-QDVFALKPMNCPGHCLMFGHRPRSWRELPLRLADFGVLHRNELSGTLTGLTRVRRFQQDDAHIFCTMEQIESEMKGCLDFLRCVYDVFGFSFQLHLSTRPEKFLGDIAVWNQAEKQLENSLNEFGEPWKLNPGDGAFYGPKIDINIKDAIGRYHQCATIQLDFQLPIRFDLTY 708          

HSP 2 Score: 119.013 bits (297), Expect = 1.767e-167
Identity = 60/114 (52.63%), Postives = 82/114 (71.93%), Query Frame = 2
Query: 1781 RPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDL-RNLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVR----KGHGE 2107
            RPVIIHRAILGSVER +AIL E+ +GKWP WL+PRQV++V V+    EYA++VC+Q  +AGF+ D DL  +  + +KI N +  +YN IL++G+KE  +  V+VR    K HGE
Sbjct:  718 RPVIIHRAILGSVERMIAILTENYAGKWPLWLSPRQVMLVPVNPSLEEYASKVCKQFVEAGFMADADLDSSCLLNKKIRNAQLAQYNFILVVGEKEKMTNSVNVRTRDNKVHGE 831          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Cavefish
Match: tars1 (threonyl-tRNA synthetase 1 [Source:NCBI gene;Acc:103026572])

HSP 1 Score: 497.664 bits (1280), Expect = 8.384e-167
Identity = 236/500 (47.20%), Postives = 337/500 (67.40%), Query Frame = 3
Query:  216 DDKFIKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLI-ERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
            D K IK+   +G +    + K TPY +    +  L+++ +I+KVN   WDL++PL  D  ++ L F+++ A+  +W S+A ++   +E ++          + GF  D  L+N+ +SS  F  +E+     +     FER++I  E   ++F ++  K  ++ E++ +     ++YRC  LID+C  P VR+TG++K LKI ++ S       +  SLQR+YG+SFP+ ++L  W   QEEA  R+HR +G EQ+LFFFH+ SPGS F LP+G ++ N L++ IR +YRKRGF EV TP I+ ++LW+TSGHW HY EN+F   ++ KE F++KPMNCP HCL++ H+ R  ++LPLRLADFG LHR EL+G L+GLTR+R+F QDDAHIFC  DQIE EI+  LDF++ VY +  F F L+LSTRP+ FLG+ E+W+ AE+QL+ SL +FG+ W LN GDGAFYGPKIDI IKDA+ R HQCATIQLDFQLP+RFNL Y
Sbjct:   81 DSKPIKITLPDGKVVDGESWKTTPYQVACGISQGLADNTVIAKVNNAVWDLDRPLEEDCSLQLLKFDDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMFLENEGVSSNDFPCLENLCKKIIKEKQPFERLEIKKETLLEMFKYNKFKCRILNEKVTTPT--TTVYRCGPLIDLCRGPHVRHTGKIKALKIHKNSSTYWEGKADMESLQRLYGISFPDPKMLKEWEKFQEEAKNRDHRKLGREQDLFFFHDLSPGSCFFLPKGAYLYNTLVEFIRSEYRKRGFQEVVTPNIYNSKLWQTSGHWQHYSENMFSFEVE-KEIFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCTMDQIESEIKGCLDFLRTVYDVFGFTFKLNLSTRPEKFLGEPEVWDQAEKQLENSLNEFGEKWVLNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLSY 577          

HSP 2 Score: 110.923 bits (276), Expect = 8.384e-167
Identity = 59/115 (51.30%), Postives = 75/115 (65.22%), Query Frame = 2
Query: 1778 ERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDL-RNLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVR----KGHGE 2107
            +RPVIIHRAILGSVER +AIL E+  GKWP WL+PRQV+VV V     EYA  V  +  +AG + D DL     + +KI N +  +YN IL++G+KE  S  V+VR    K HGE
Sbjct:  586 KRPVIIHRAILGSVERMIAILTENYGGKWPLWLSPRQVMVVPVGPTCEEYAQRVQNEFHNAGLMTDVDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKSSDTVNVRTRDNKVHGE 700          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Cavefish
Match: ENSAMXT00000012886.2 (threonine--tRNA ligase, cytoplasmic-like [Source:NCBI gene;Acc:103023620])

HSP 1 Score: 461.84 bits (1187), Expect = 2.845e-154
Identity = 216/503 (42.94%), Postives = 316/503 (62.82%), Query Frame = 3
Query:  204 KYSDDDKFIKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLIERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
            K ++  + + V   +G     +    TP  I Q    +     ++ +VNG  W+L +PL  D ++  L F++   R   WR+ A +L  ++E  F++   R   +D    CD+ L N   S+L  + +E++            R+++ +    +LF   +++L L E        IS+YRC   + +C  PL+ +TG +   K+++   V ++       + R+ GVSFP ++  + W+  QEEA +R+HR IG++QELFFF++ SPGS F LP+G HI N L D I+ +Y+ RGFSEV TP +F   LWE SGHW+HY EN+F +  +    F++KPMNCPAHC++Y  + R  ++LPLR ADFGALHR E +G L GLTR+R+F QDDAHIFC P+Q+E+EI   LDF++ VY +  F F   LSTRP ++LG+  +W+ AE+QL++SLE+FG+ W LN GDGAFYGPK+DI I+DA+ RQHQCATIQLDFQLP+RFNL+Y
Sbjct:   52 KAAEPGQNLSVRLADGKTVKAVAGITTPLQIAQRTRIK---GAVVGRVNGELWELARPLEADCELHLLSFDSLEGRQVVWRTGACVLGAVMETHFTAHVCREGVSDTALYCDYRLDN---SALSLEEVEERCKEMAGLKLPITRLELNVHELGELFQ-DALRLQLAEEQIQGKNTISVYRCGQSVGVCSGPLLPHTGFIHSFKMLQVSPVTLSGGTEALGVMRMIGVSFPGEKEKEQWVQEQEEARRRDHRRIGKDQELFFFNDVSPGSCFFLPKGAHIYNTLTDFIKSEYKSRGFSEVVTPTLFSTTLWERSGHWEHYSENMFTVKCEP-HTFALKPMNCPAHCVMYEQRVRSWRELPLRWADFGALHRNEHSGALGGLTRVRRFCQDDAHIFCTPEQLEEEITACLDFVRSVYCVFGFTFHCLLSTRPSSYLGETALWDSAEQQLERSLEQFGERWELNPGDGAFYGPKVDIQIRDAIGRQHQCATIQLDFQLPIRFNLQY 546          

HSP 2 Score: 105.145 bits (261), Expect = 2.845e-154
Identity = 50/131 (38.17%), Postives = 81/131 (61.83%), Query Frame = 2
Query: 1763 NEGSFERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDT-DLRNLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVRKGHGEDHESWDLQELIKKFK 2152
            ++G   RPV++HRA+LGS+ER +AIL E+  GKWP WL+P QV+V+ V     +Y  EV  ++K AGF+ D  D     + ++I + +  +YN I ++G+KE +S  VSVR   G+      L++++   +
Sbjct:  549 SDGGMHRPVMVHRAVLGSLERMIAILAENFGGKWPLWLSPAQVMVLPVGGDSKQYGREVVHRLKKAGFMADVDDDHGATLNKRIRSAQLAQYNYIFVVGEKERESGTVSVRTRGGKQLGQRSLEDVMTSLE 679          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Cavefish
Match: mrpl39 (mitochondrial ribosomal protein L39 [Source:NCBI gene;Acc:103046218])

HSP 1 Score: 68.1662 bits (165), Expect = 5.653e-12
Identity = 48/187 (25.67%), Postives = 81/187 (43.32%), Query Frame = 3
Query:  282 TPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFEN---DIARDAFWRSTAFLLNGILEHLFSSE-------TYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFM----NYVASGADFERIDIPIEIARDLFSFSSMKLDLIER--LHSENKPISLYRCLDLIDICEAPLVRNTG 794
            TPY   ++  +   +S  ++ V+G  W L++PL     +  L F++    +   A+WRS A LL  +LE  F  E                 F CDF+L  +  + +  +     F       +     +E +++   +A ++FS S  K + +E     S N  +SLYRC   + +   PLV  TG
Sbjct:   82 TPYSCSRHLTDWHVSSAALALVDGEPWHLHRPLTRSCSLTLLTFKDANPQLPNQAYWRSCAALLGQVLEGAFKEEYNVELLRIPEVPVTAGAFCCDFVLDPQLDAWIPTEESLRSFTRDANQLIHQNLPWEPLEVAPPVALEIFSHSRCKQEEVEEKAAQSPNGTVSLYRCGHHVVLAGGPLVGRTG 268          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Cavefish
Match: mrpl39 (mitochondrial ribosomal protein L39 [Source:NCBI gene;Acc:103046218])

HSP 1 Score: 67.781 bits (164), Expect = 1.093e-11
Identity = 48/187 (25.67%), Postives = 81/187 (43.32%), Query Frame = 3
Query:  282 TPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFEN---DIARDAFWRSTAFLLNGILEHLFSSE-------TYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFM----NYVASGADFERIDIPIEIARDLFSFSSMKLDLIER--LHSENKPISLYRCLDLIDICEAPLVRNTG 794
            TPY   ++  +   +S  ++ V+G  W L++PL     +  L F++    +   A+WRS A LL  +LE  F  E                 F CDF+L  +  + +  +     F       +     +E +++   +A ++FS S  K + +E     S N  +SLYRC   + +   PLV  TG
Sbjct:   75 TPYSCSRHLTDWHVSSAALALVDGEPWHLHRPLTRSCSLTLLTFKDANPQLPNQAYWRSCAALLGQVLEGAFKEEYNVELLRIPEVPVTAGAFCCDFVLDPQLDAWIPTEESLRSFTRDANQLIHQNLPWEPLEVAPPVALEIFSHSRCKQEEVEEKAAQSPNGTVSLYRCGHHVVLAGGPLVGRTG 261          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Sea Lamprey
Match: tars1 (threonyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-041010-218])

HSP 1 Score: 494.197 bits (1271), Expect = 4.384e-166
Identity = 236/510 (46.27%), Postives = 345/510 (67.65%), Query Frame = 3
Query:  186 LLDKNTKYSDDDKFIKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLI-ERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
            LL++ T  S   K I V   +G      + K TPY +    +  L+++++I++VNG  WDL++PL +D+ ++ L F+++ A+  +W S+A +L   +E ++          + GF  D  L +  +SS  F S+E    N +     FER++I  ++  ++F ++  K+ ++ E++++     ++YRC  LID+C+ P VR+TG++K LKI ++ S       +  SLQR+YG+SFP+ ++L  W   QEEA  R+HR IG++QELFFFH+ SPGS F LP+G  I N L+D I+ +Y+KRGF+EV +P I+ ++LW+TSGHWD+Y EN+F   ++ KE F++KPMNCP HCL++ H+ R  ++LP+R ADFG LHR EL+G L+GLTR+R+F QDDAHIFC  +QIE EI   LDF++ VY +  F F L LSTRP N++GD+E WN AE+QL+ SL KFG+ W LN GDGAFYGPKIDI IKD + R HQCATIQLDFQLP+RF+L +
Sbjct:  165 LLERATNQS---KPITVTLPDGKTVEAESWKTTPYQLAAGISKGLADNVVIARVNGNLWDLDRPLESDTTLQLLKFDDEEAQAVYWHSSAHILGEAMERVYGGCLCYGPPIENGFYYDMFLDDGGVSSNDFPSLEGLCKNIMKEKQPFERLEIQKDVLLEMFKYNKFKVRILNEKVNTPT--TTVYRCGPLIDLCQGPHVRHTGKIKALKIHKNSSTYWEGKADMESLQRVYGISFPDTKMLKEWERMQEEAKNRDHRKIGKDQELFFFHDLSPGSCFFLPKGAFIYNTLVDFIKSEYQKRGFTEVVSPNIYNSKLWKTSGHWDNYSENMFAFEVE-KEMFALKPMNCPGHCLMFDHRPRSWRELPIRFADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCTMEQIESEIAGCLDFLRCVYEVFGFNFKLFLSTRPKNYMGDVEEWNQAEKQLENSLNKFGEPWKLNPGDGAFYGPKIDIQIKDGIGRYHQCATIQLDFQLPIRFDLNF 668          

HSP 2 Score: 109.383 bits (272), Expect = 4.384e-166
Identity = 58/115 (50.43%), Postives = 79/115 (68.70%), Query Frame = 2
Query: 1778 ERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDL-RNLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVR----KGHGE 2107
            +RPVIIHRAILGSVER +AIL E+  GKWP WL+P+QV+VV V     ++A +V Q+  D GF+ +T+L   L + +KI N +  +YN IL++G+KE  S  V+VR    K HGE
Sbjct:  677 KRPVIIHRAILGSVERMIAILTENYGGKWPLWLSPQQVMVVPVGPTCNDFAQKVWQRFHDVGFMVNTELDPGLTLNKKIRNAQLAQYNFILVVGEKEKLSDTVNVRTRDNKVHGE 791          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Sea Lamprey
Match: pars2 (prolyl-tRNA synthetase 2, mitochondrial [Source:ZFIN;Acc:ZDB-GENE-030131-4219])

HSP 1 Score: 53.1434 bits (126), Expect = 1.535e-7
Identity = 35/135 (25.93%), Postives = 58/135 (42.96%), Query Frame = 3
Query:  984 FFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYS-KDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIF 1385
                ++PG   +LPR      KL+ LI ++       +++ P +   E W  SG WD     LF++  ++  +  + P +  A   + + +   S + LPLRL       R E      GL R R+F   D + F
Sbjct:   21 LIQPAAPGCYHLLPRAVRAVEKLVSLIDQEMVSINGHKISMPCLTMAEAWRASGRWDLMGSELFRLRDRTGADLCLGPTHEEAVTRLLAAQGVASYRQLPLRLYQVTQKFRDE-PRPCHGLLRGREFLMKDLYTF 154          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Yeast
Match: THS1 (Threonyl-tRNA synthetase; essential cytoplasmic protein; human homolog TARS can complement yeast null mutant [Source:SGD;Acc:S000001340])

HSP 1 Score: 462.996 bits (1190), Expect = 1.063e-161
Identity = 220/509 (43.22%), Postives = 326/509 (64.05%), Query Frame = 3
Query:  228 IKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSD----IEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKN----------KSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLIERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
            +K++  +G +    + + TP  I +  +  L++ + ISKVNG  WDL++P   +++    +E L FE+D  +  FW S+A +L    E    +        D GF  +  +++          +++S   F  +E    N +     FER+ +  E    +F +S  K  L++    +    ++YRC  LID+C  P + +TG++K  K++++ S         +SLQR+YG+SFP+K+L+D  L    EA  R+HR IG+EQELF F+  SPGS F LP GT I N L+DL+R +YRKRG+ EV TP ++ ++LWETSGHW +Y+EN+F   ++ KE F +KPMNCP HCL++  ++R  ++LP R+ADFG +HR E +G LSGLTR+R+F QDDAHIFC  DQIE EIE   +F++++YG+  FEF + LSTRP+ ++G IE W+ AE +L+ +L+K+G +W +N+GDGAFYGPKIDI+I DAL R HQCATIQLDFQLP RF L++
Sbjct:   75 LKIVLKDGAVKEATSWETTPMDIAKGISKSLADRLCISKVNGQLWDLDRPFEGEANEEIKLELLDFESDEGKKVFWHSSAHVLGESCECHLGAHICLGPPTDDGFFYEMAVRDSMKDISESPERTVSQADFPGLEGVAKNVIKQKQKFERLVMSKEDLLKMFHYSKYKTYLVQTKVPDGGATTVYRCGKLIDLCVGPHIPHTGRIKAFKLLKNSSCYFLGDATNDSLQRVYGISFPDKKLMDAHLKFLAEASMRDHRKIGKEQELFLFNEMSPGSCFWLPHGTRIYNTLVDLLRTEYRKRGYEEVITPNMYNSKLWETSGHWANYKENMFTFEVE-KETFGLKPMNCPGHCLMFKSRERSYRELPWRVADFGVIHRNEFSGALSGLTRVRRFQQDDAHIFCTHDQIESEIENIFNFLQYIYGVFGFEFKMELSTRPEKYVGKIETWDAAESKLESALKKWGGNWEINAGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPNRFELEF 582          

HSP 2 Score: 125.561 bits (314), Expect = 1.063e-161
Identity = 57/107 (53.27%), Postives = 78/107 (72.90%), Query Frame = 2
Query: 1772 SFERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDLRNLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVR 2092
            S+ERPV+IHRAILGSVER  AIL E  +GKWPFWL+PRQVLVV V  K+  YA +V  ++ DAGF  D DL    + +K+ NG+  +YN I I+G++E++ + V++R
Sbjct:  591 SYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVLVVPVGVKYQGYAEDVRNKLHDAGFYADVDLTGNTLQKKVRNGQMLKYNFIFIVGEQEMNEKSVNIR 697          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Yeast
Match: MST1 (Mitochondrial threonyl-tRNA synthetase; aminoacylates both the canonical threonine tRNA tT(UGU)Q1 and the unusual threonine tRNA tT(UAG)Q2 in vitro; lacks a typical editing domain, but has pre-transfer editing activity stimulated by the unusual tRNA-Thr [Source:SGD;Acc:S000001677])

HSP 1 Score: 288.5 bits (737), Expect = 2.376e-98
Identity = 141/265 (53.21%), Postives = 183/265 (69.06%), Query Frame = 3
Query:  957 LIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYR-KRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISL--KSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYG-ILNF---------EFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
            ++ + Q+LF     SPGS F LP G  I NKLI+ ++ Q + K GF+EV TP I+K  LWE SGHW++Y +++FK+    + KEE+ +KPMNCP HCLI+  K R   +LPLR +DF  LHR E +G LSGLTRLRKFHQDD HIFC P Q++ EI  SL  I  VY  I  F          + ++ STRPD+F+GD+++WN AE+ LK+ LE+ GK W LN GDGAFYGPK+DI++ D L + HQ ATIQLDFQLP RF+LK+
Sbjct:   41 MVSQRQDLFMTDPLSPGSMFFLPNGAKIFNKLIEFMKLQQKFKFGFNEVVTPLIYKKTLWEKSGHWENYADDMFKVETTDEEKEEYGLKPMNCPGHCLIFGKKDRSYNELPLRFSDFSPLHRNEASGALSGLTRLRKFHQDDGHIFCTPSQVKSEIFNSLKLIDIVYNKIFPFVKGGSGAESNYFINFSTRPDHFIGDLKVWNHAEQVLKEILEESGKPWKLNPGDGAFYGPKLDIMVTDHLRKTHQVATIQLDFQLPERFDLKF 305          

HSP 2 Score: 88.5817 bits (218), Expect = 2.376e-98
Identity = 42/128 (32.81%), Postives = 77/128 (60.16%), Query Frame = 2
Query: 1766 EGSFERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIK------------------DAGFLCDTDLRNLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVRK 2095
            + S++RP++IHRA  GS+ERF+A+LI+SN G+WPFWLNP Q +++ V+ K ++   ++C  ++                  D  F  D D+RN  +  +I +   + Y+ ++I+G +EV  ++ ++R+
Sbjct:  309 DNSYKRPIMIHRATFGSIERFMALLIDSNEGRWPFWLNPYQAVIIPVNTKNVQQL-DMCTALQKKLRNELEADDMEPVPLNDWHFNVDLDIRNEPVGYRIKSAILKNYSYLIIVGDEEVQLQKYNIRE 435          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Nematostella
Match: EDO31193 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYN6])

HSP 1 Score: 441.81 bits (1135), Expect = 2.401e-152
Identity = 206/398 (51.76%), Postives = 276/398 (69.35%), Query Frame = 3
Query:  519 DKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLIERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
            ++G+  D  L+ + +SS  F S+++           FER+++  E   ++F ++  K  ++     +    ++YRC  LID+C  P VR+TG++K + + ++ +          SLQRIYG+SFPN + +  W   QEEA KR+HR IG +QELFFFH  SPGS F LP+G  I N LI+ I+EQY KRGF EV +P I+  +LWETSGHW HY E++F   ++ KE +++KPMNCP HCL++ H+ R  ++LPLR+ADFG LHR EL+G LSGLTR+R+F QDDAHIFC  DQI QEI   LDF+KHVYG+  F F L+LSTRP+ +LG IE+WN AE++L+ +L  FG++W LN GDGAFYGPKIDI I+DAL R HQCATIQLDFQLP RFNL Y
Sbjct:   16 EEGYYYDMHLEGRQVSSNDFSSLDNLTKKITKEKQPFERLEMKKEDLLEMFKYNEFKCRILNN-KVKTPTTTVYRCGPLIDLCRGPHVRHTGKIKSIAVTKNSATYWEGNCEAESLQRIYGISFPNDKQMKEWKKFQEEAAKRDHRKIGRDQELFFFHELSPGSCFFLPKGAVIYNTLINFIKEQYWKRGFQEVVSPNIYSTKLWETSGHWQHYSEHMFSFEVE-KESYALKPMNCPGHCLMFDHRPRSWRELPLRMADFGVLHRNELSGTLSGLTRVRRFQQDDAHIFCTADQIGQEIISCLDFLKHVYGVFGFTFKLNLSTRPEKYLGKIELWNQAEKELEAALNGFGQAWVLNPGDGAFYGPKIDIQIQDALRRYHQCATIQLDFQLPERFNLTY 411          

HSP 2 Score: 116.701 bits (291), Expect = 2.401e-152
Identity = 55/125 (44.00%), Postives = 81/125 (64.80%), Query Frame = 2
Query: 1778 ERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDL-RNLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVRKGHGEDHESWDLQELIKKF 2149
            +RPVI+HRAILGSVER +AIL ES  GKWPFWL+PRQ +V+ +  K+ EYA +V   I  AG+  D DL     + +K+ N +  +YN I ++G+KE  +  V+VR    + H  + ++ ++ KF
Sbjct:  420 KRPVIVHRAILGSVERMIAILTESFGGKWPFWLSPRQAIVIPIGPKYDEYAQKVMSDILAAGYHVDADLDHGTTLNKKVRNAQLAQYNFIFVVGEKEATTGTVNVRTRDNKVHGEFSVEAVLNKF 544          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Nematostella
Match: EDO27279 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9P4])

HSP 1 Score: 150.984 bits (380), Expect = 1.501e-55
Identity = 70/105 (66.67%), Postives = 83/105 (79.05%), Query Frame = 3
Query: 1398 QIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
            +I QEI   LDF+KHVYG+  F F L+LSTRP+ +LG IE+WN AE++L+ +L  FG+ W LN GDGAFYGPKIDI I+DAL R HQCATIQLDFQLP RFNL Y
Sbjct:    3 KIGQEIISCLDFLKHVYGVFGFTFKLNLSTRPEKYLGKIELWNQAEKELEAALNGFGQPWVLNPGDGAFYGPKIDIQIQDALRRYHQCATIQLDFQLPERFNLTY 107          

HSP 2 Score: 84.7297 bits (208), Expect = 1.501e-55
Identity = 36/55 (65.45%), Postives = 45/55 (81.82%), Query Frame = 2
Query: 1778 ERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVC 1942
            +RPVI+HRAILGSVER +AIL ES  GKWPFWL+PRQ +V+ +  K+ EYA +VC
Sbjct:  116 KRPVIVHRAILGSVERMIAILTESFGGKWPFWLSPRQAIVIPIGPKYDEYAQKVC 170          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Medaka
Match: tars3 (threonine--tRNA ligase, cytoplasmic [Source:NCBI gene;Acc:101167193])

HSP 1 Score: 498.049 bits (1281), Expect = 5.914e-168
Identity = 239/505 (47.33%), Postives = 335/505 (66.34%), Query Frame = 3
Query:  201 TKYSDDDKFIKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKN-KSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLIERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
             K S + K I V   +G      +   TPY +    +  L+++ +IS+VNG  WDL++PL  D  +E L F+N+ A+  +W S+A +L   +E  +          + GF  D  L + K+ISS +F  +E    + +     FER+++  E    +F ++  K  ++    S     ++YRC  LID+C  P VR+TG++K +KI ++ S       +  +LQRIYG+SFP+ ++L  W   QEEA  R+HR IG++QELFFFH+ SPGS F LPRG +I N L + IR++Y +RGF EV +P ++ ++LWETSGHW HY EN+F   ++ ++ F++KPMNCP HCL++SH+ R  ++LPLRLADFG LHR EL+G L+GLTR+R+F QDDAHIFC  DQIE E++  LDF++ VY +  F F LHLSTRP+ +LGDIE+WN AE+QL+ SL +FG+ W LN GDGAFYGPKIDI IKDA+ R HQCATIQLDFQLP+RFNL +
Sbjct:  127 AKRSQNSKDITVELPDGQKVAAKSWVTTPYQVACEISQGLADNAVISRVNGELWDLDRPLQQDCSLELLRFDNEDAQAVYWHSSAHVLGEAMERFYGGCLCYGPPIENGFYYDMFLGDQKAISSSEFGDLEVLCKSVMKEKQPFERLELSKETLLKMFKYNKFKCRILNEKVS-TPTTTVYRCGPLIDLCRGPHVRHTGKIKAMKIYKNSSTYWEGRSDMETLQRIYGISFPDSKMLKEWERFQEEAKTRDHRKIGKDQELFFFHDLSPGSCFFLPRGAYIYNTLTEFIRDEYWRRGFQEVASPNVYNSKLWETSGHWQHYSENMFSFPVE-EDVFALKPMNCPGHCLMFSHRPRSWRELPLRLADFGVLHRNELSGTLTGLTRVRRFQQDDAHIFCTMDQIESEMKGCLDFLRGVYNVFGFSFQLHLSTRPEKYLGDIEVWNQAEKQLENSLNEFGEPWKLNPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIRFNLTF 629          

HSP 2 Score: 114.005 bits (284), Expect = 5.914e-168
Identity = 56/124 (45.16%), Postives = 84/124 (67.74%), Query Frame = 2
Query: 1781 RPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDL-RNLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVRKGHGEDHESWDLQELIKKF 2149
            RPVIIHRAILGSVER +AIL E+ +GKWP WL+P QV++V V+    EYA +VC+Q  +AGF+ + DL  +  + +KI N +  +YN IL++G+KE  + +V+VR    + H    + E++ + 
Sbjct:  639 RPVIIHRAILGSVERMIAILTENYAGKWPLWLSPCQVMLVPVNPSCEEYAKKVCKQFTEAGFMAEADLDSSCLLNKKIRNAQLAQYNFILVVGEKEKMTNRVNVRTRDNKVHGELSVSEVMARL 762          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Medaka
Match: tars3 (threonine--tRNA ligase, cytoplasmic [Source:NCBI gene;Acc:101167193])

HSP 1 Score: 497.664 bits (1280), Expect = 9.039e-168
Identity = 239/505 (47.33%), Postives = 335/505 (66.34%), Query Frame = 3
Query:  201 TKYSDDDKFIKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKN-KSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLIERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
             K S + K I V   +G      +   TPY +    +  L+++ +IS+VNG  WDL++PL  D  +E L F+N+ A+  +W S+A +L   +E  +          + GF  D  L + K+ISS +F  +E    + +     FER+++  E    +F ++  K  ++    S     ++YRC  LID+C  P VR+TG++K +KI ++ S       +  +LQRIYG+SFP+ ++L  W   QEEA  R+HR IG++QELFFFH+ SPGS F LPRG +I N L + IR++Y +RGF EV +P ++ ++LWETSGHW HY EN+F   ++ ++ F++KPMNCP HCL++SH+ R  ++LPLRLADFG LHR EL+G L+GLTR+R+F QDDAHIFC  DQIE E++  LDF++ VY +  F F LHLSTRP+ +LGDIE+WN AE+QL+ SL +FG+ W LN GDGAFYGPKIDI IKDA+ R HQCATIQLDFQLP+RFNL +
Sbjct:  162 AKRSQNSKDITVELPDGQKVAAKSWVTTPYQVACEISQGLADNAVISRVNGELWDLDRPLQQDCSLELLRFDNEDAQAVYWHSSAHVLGEAMERFYGGCLCYGPPIENGFYYDMFLGDQKAISSSEFGDLEVLCKSVMKEKQPFERLELSKETLLKMFKYNKFKCRILNEKVS-TPTTTVYRCGPLIDLCRGPHVRHTGKIKAMKIYKNSSTYWEGRSDMETLQRIYGISFPDSKMLKEWERFQEEAKTRDHRKIGKDQELFFFHDLSPGSCFFLPRGAYIYNTLTEFIRDEYWRRGFQEVASPNVYNSKLWETSGHWQHYSENMFSFPVE-EDVFALKPMNCPGHCLMFSHRPRSWRELPLRLADFGVLHRNELSGTLTGLTRVRRFQQDDAHIFCTMDQIESEMKGCLDFLRGVYNVFGFSFQLHLSTRPEKYLGDIEVWNQAEKQLENSLNEFGEPWKLNPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIRFNLTF 664          

HSP 2 Score: 114.005 bits (284), Expect = 9.039e-168
Identity = 56/124 (45.16%), Postives = 84/124 (67.74%), Query Frame = 2
Query: 1781 RPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDL-RNLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVRKGHGEDHESWDLQELIKKF 2149
            RPVIIHRAILGSVER +AIL E+ +GKWP WL+P QV++V V+    EYA +VC+Q  +AGF+ + DL  +  + +KI N +  +YN IL++G+KE  + +V+VR    + H    + E++ + 
Sbjct:  674 RPVIIHRAILGSVERMIAILTENYAGKWPLWLSPCQVMLVPVNPSCEEYAKKVCKQFTEAGFMAEADLDSSCLLNKKIRNAQLAQYNFILVVGEKEKMTNRVNVRTRDNKVHGELSVSEVMARL 797          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Medaka
Match: tars1 (threonine--tRNA ligase, cytoplasmic [Source:NCBI gene;Acc:101171337])

HSP 1 Score: 484.952 bits (1247), Expect = 9.120e-165
Identity = 235/505 (46.53%), Postives = 335/505 (66.34%), Query Frame = 3
Query:  204 KYSDDDKFIKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFIL-KNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLI-ERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
            + + + + IKV   +G +    + K TPY +    +  L+++ +I+KVN   WDL++PL +D  ++ L F+++ A+  +W S+A +L   +E ++          + GF  D  L  N+ +SS  F  +E+     +     FER++I  E   ++F ++  K  ++ E++ +     ++YRC  LID+C  P VR+TG++K LKI ++ S       +  +LQRIYG+SFP+ ++L  W   QEEA  R+HR +G EQ+LFFFH  SPGS F LP+G  I N LI+ IR +YR RGF EV TP I+ ++LW TSGHW HY EN+F   ++ KE F++KPMNCP HCL++ H+ R  ++LPLR+ADFG LHR EL+G L+GLTR+R+F QDDAHIFC  DQIE+EI+  L F++ VY +  F F L+LSTRP+ FLG+ E+W+ AE+QL+ SL +FG+ W LN GDGAFYGPKIDI IKDA+ R HQCATIQLDFQLP+RFNL Y
Sbjct:   76 RAAKESRPIKVTLPDGKVLEAESWKTTPYQLACGISQGLADNTVIAKVNNSVWDLDRPLEDDCSLQLLKFDDEEAQAVYWHSSAHILGEAMEKVYGGCLCYGPPIESGFYYDMFLDNNEGVSSNDFPCLENLCKKIIKEKQPFERLEIKKETLLEMFKYNKFKCRILNEKVTTPT--TTVYRCGPLIDLCRGPHVRHTGKIKALKIHKNSSTYWEGKADMETLQRIYGISFPDPKMLKEWEKFQEEAKNRDHRKLGREQDLFFFHELSPGSCFFLPKGAFIYNTLIEFIRSEYRNRGFQEVVTPNIYNSKLWVTSGHWQHYSENMFSFEVE-KEIFALKPMNCPGHCLMFDHRPRSWRELPLRMADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCSMDQIEEEIKGCLHFLRAVYDVFGFTFKLNLSTRPEKFLGEPEMWDQAEKQLENSLNEFGEKWVLNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLAY 577          

HSP 2 Score: 116.701 bits (291), Expect = 9.120e-165
Identity = 59/126 (46.83%), Postives = 83/126 (65.87%), Query Frame = 2
Query: 1778 ERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDL-RNLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVRKGHGEDHESWDLQELIKKFK 2152
            +RPVIIHRAILGSVER +AIL E+  GKWP WL+PRQV++V V     EYA +V Q+   +GF+ D DL  +  + +KI N +  +YN IL++G+KE  S  V+VR    + H    ++E I++ K
Sbjct:  586 KRPVIIHRAILGSVERMIAILTENYGGKWPLWLSPRQVMLVPVGPTCEEYAEKVKQEFHSSGFMADVDLDPSCTLNKKIRNAQLSQYNFILVVGEKEKTSNTVNVRTRDNKVHGECSVEECIQRLK 711          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Medaka
Match: ENSORLT00000040837.1 (threonine--tRNA ligase, cytoplasmic [Source:NCBI gene;Acc:101157805])

HSP 1 Score: 464.151 bits (1193), Expect = 1.994e-154
Identity = 233/498 (46.79%), Postives = 325/498 (65.26%), Query Frame = 3
Query:  219 DKFIKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLIERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
            +K +++   NG          TP  + Q+   +     L+SKVNG  W+L +PL  D +++ L F+    + A WR+ A +L G+LE  F++E YR  +   GF CD +L N   S+L    +E +     A      R+D+ IE  R LF  S ++L L E   +    +++YRC D + +C +PL+ +TG LK  K+++  SV +      + L+R+ GV+FP ++  + W   QEEA +R+HR IG +QELFFFH+ SPGS F LP+G HI N L D I+ +YR+RGFSEV TP ++   LWE SGHW+HY EN+F ++L+  + F++KPMNCPAHCL++  + R  ++LPLR ADFGALHR EL+G L GLTR+R+F QDDAHIFC  +Q+E EI   LDF++ VY +  F F   LSTRP   LG+ E W+ AE+QL+ SL++FG+ W LN GDGAFYGPK+DI+IKDA+ RQHQCATIQLDFQLP RF+L+Y
Sbjct:   53 EKPLRIHLGNGRTVKGTASVTTPLTVAQSVRVK---GALVSKVNGELWELGRPLEADCELQLLGFDTVEGKQAAWRTAACILGGVLERTFAAEVYREGATAFGFFCDHVLDN---SALSLTDVELQCQAAAALNLPLSRLDLNIEEFRKLFQGSDLRLQLAED-QTNGSTVTVYRCGDSLAVCSSPLLPHTGFLKVFKMLQLSSVTLGDQTGPSDLRRLLGVAFPGEKEREEWEREQEEARRRDHRRIGTDQELFFFHDVSPGSCFFLPKGAHIYNTLTDFIKSEYRRRGFSEVVTPTLYSTALWERSGHWEHYSENMFTVTLEDSQTFALKPMNCPAHCLMFEQRVRSWRELPLRWADFGALHRNELSGALGGLTRVRRFCQDDAHIFCTTEQLEVEILSCLDFVRSVYQVFGFSFHCLLSTRPTPCLGEPEQWDNAEQQLQSSLQQFGEHWELNPGDGAFYGPKVDILIKDAIGRQHQCATIQLDFQLPSRFDLQY 543          

HSP 2 Score: 86.6557 bits (213), Expect = 3.198e-17
Identity = 40/95 (42.11%), Postives = 59/95 (62.11%), Query Frame = 2
Query: 1766 EGSFERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDL-RNLRMARKILNGEQQRYNCIL 2047
            +G   RPV+IHRA+LGS+ER +AIL E+  GKWP WL+P Q++V+        YA +V QQ  +AGF+ D +  +     +KI + +  +YN I 
Sbjct:  547 DGQLHRPVMIHRAVLGSLERMMAILAENFGGKWPLWLSPAQIMVLPAGGNSEPYARQVVQQFNEAGFMVDLNADQGTTFNKKIRSAQLAQYNYIF 641          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Medaka
Match: ENSORLT00000013023.2 (threonine--tRNA ligase, cytoplasmic [Source:NCBI gene;Acc:101157805])

HSP 1 Score: 464.151 bits (1193), Expect = 4.084e-154
Identity = 233/498 (46.79%), Postives = 325/498 (65.26%), Query Frame = 3
Query:  219 DKFIKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLIERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKY 1712
            +K +++   NG          TP  + Q+   +     L+SKVNG  W+L +PL  D +++ L F+    + A WR+ A +L G+LE  F++E YR  +   GF CD +L N   S+L    +E +     A      R+D+ IE  R LF  S ++L L E   +    +++YRC D + +C +PL+ +TG LK  K+++  SV +      + L+R+ GV+FP ++  + W   QEEA +R+HR IG +QELFFFH+ SPGS F LP+G HI N L D I+ +YR+RGFSEV TP ++   LWE SGHW+HY EN+F ++L+  + F++KPMNCPAHCL++  + R  ++LPLR ADFGALHR EL+G L GLTR+R+F QDDAHIFC  +Q+E EI   LDF++ VY +  F F   LSTRP   LG+ E W+ AE+QL+ SL++FG+ W LN GDGAFYGPK+DI+IKDA+ RQHQCATIQLDFQLP RF+L+Y
Sbjct:   63 EKPLRIHLGNGRTVKGTASVTTPLTVAQSVRVK---GALVSKVNGELWELGRPLEADCELQLLGFDTVEGKQAAWRTAACILGGVLERTFAAEVYREGATAFGFFCDHVLDN---SALSLTDVELQCQAAAALNLPLSRLDLNIEEFRKLFQGSDLRLQLAED-QTNGSTVTVYRCGDSLAVCSSPLLPHTGFLKVFKMLQLSSVTLGDQTGPSDLRRLLGVAFPGEKEREEWEREQEEARRRDHRRIGTDQELFFFHDVSPGSCFFLPKGAHIYNTLTDFIKSEYRRRGFSEVVTPTLYSTALWERSGHWEHYSENMFTVTLEDSQTFALKPMNCPAHCLMFEQRVRSWRELPLRWADFGALHRNELSGALGGLTRVRRFCQDDAHIFCTTEQLEVEILSCLDFVRSVYQVFGFSFHCLLSTRPTPCLGEPEQWDNAEQQLQSSLQQFGEHWELNPGDGAFYGPKVDILIKDAIGRQHQCATIQLDFQLPSRFDLQY 553          

HSP 2 Score: 100.523 bits (249), Expect = 1.553e-21
Identity = 47/115 (40.87%), Postives = 72/115 (62.61%), Query Frame = 2
Query: 1766 EGSFERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDL-RNLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVRKGHGE 2107
            +G   RPV+IHRA+LGS+ER +AIL E+  GKWP WL+P Q++V+        YA +V QQ  +AGF+ D +  +     +KI + +  +YN I ++G KE +S  V++R   G+
Sbjct:  557 DGQLHRPVMIHRAVLGSLERMMAILAENFGGKWPLWLSPAQIMVLPAGGNSEPYARQVVQQFNEAGFMVDLNADQGTTFNKKIRSAQLAQYNYIFVVGDKENESGTVNIRSRGGK 671          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Planmine SMEST
Match: SMESG000047630.1 (SMESG000047630.1)

HSP 1 Score: 1127.46 bits (2915), Expect = 0.000e+0
Identity = 550/554 (99.28%), Postives = 552/554 (99.64%), Query Frame = 3
Query:   57 MILRKIHYFSFVNKLILNKFLKRSLSENELLKVQQIKQFLWKDLLDKNTKYSDDDKFIKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLIERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKYFP 1718
            MILRKIHYFSFVNKLILNKFLKR+LSE ELLKVQQIKQFLWKDLLDKNTKYSDDDKFIKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLIE LHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNR+HQCATIQLDFQLPLRFNLKYFP
Sbjct:    1 MILRKIHYFSFVNKLILNKFLKRNLSEKELLKVQQIKQFLWKDLLDKNTKYSDDDKFIKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLIEMLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRRHQCATIQLDFQLPLRFNLKYFP 554          

HSP 2 Score: 275.404 bits (703), Expect = 4.510e-82
Identity = 131/133 (98.50%), Postives = 133/133 (100.00%), Query Frame = 2
Query: 1763 NEGSFERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDLRNLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVRKGHGEDHESWDLQELIKKFKYWE 2161
            NEGSFERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANE+CQQIKDAGFLCDTDLRNLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVRKGHGEDHESWDL+ELIKKFKYWE
Sbjct:  555 NEGSFERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEICQQIKDAGFLCDTDLRNLRMARKILNGEQQRYNCILIIGQKEVDSRQVSVRKGHGEDHESWDLEELIKKFKYWE 687          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Planmine SMEST
Match: SMESG000061707.1 (SMESG000061707.1)

HSP 1 Score: 497.664 bits (1280), Expect = 1.806e-167
Identity = 228/479 (47.60%), Postives = 331/479 (69.10%), Query Frame = 3
Query:  282 TPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLI-ERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNLKYF 1715
            +PYI M+     ++++ +I+KVNG+ WDL++PL NDS +E L F++      FW S+A +L   +E  ++       + ++GF  D  LK++ +   +++++++K    V     FER+++ I+   ++F ++  K  ++ ER+ ++    ++YRC DLID+C+ P VRNTG++K L ++++ +          SLQRIYG+SFP+ + +  W   QEEA KR+HR IG +Q+LF FH  SPGS F LP+GT I NKL+D ++EQY  RGF+EV +P ++ ++LWETSGHW+HY+EN+F+  ++ K +F++KPMNCP HCL++    R  +DLP+RLADFG LHR E +G L+GLTR+R+F QDDAHIFCR DQI +EIE  LDF+ + Y +  F+F L LSTRP+ FLG+I +W+ AE QL  +L  FGK W LN  DGAFYGPKIDI I DAL R HQCATIQLDFQLP+RF+L+Y 
Sbjct:   52 SPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEAMELEYAGHLCYGPAIEEGFYYDMFLKDRQVKPEEYKTLDEKCKKIVKEKQKFERLEVSIDRLLEMFDYNEFKCRILKERVKTDK--TTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIE-KCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYM 527          

HSP 2 Score: 109.768 bits (273), Expect = 1.178e-24
Identity = 54/131 (41.22%), Postives = 85/131 (64.89%), Query Frame = 2
Query: 1772 SFERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEVCQQIKDAGFLCDTDLRNLRM-ARKILNGEQQRYNCILIIGQKEVDSRQVSVRKGHGEDHESWDLQELIKKFKYWE 2161
            +  RPVIIHRAILGSVER  AIL E+  GKWPFWL+P Q +V+  +    EYA  + + + DAGF  D DL    +  +KI   ++ +YN +L++G+KEV+++ V++R    + H    ++++I++F+  E
Sbjct:  541 TLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELE 671          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Planmine SMEST
Match: SMESG000067020.1 (SMESG000067020.1)

HSP 1 Score: 65.0846 bits (157), Expect = 5.187e-11
Identity = 66/267 (24.72%), Postives = 120/267 (44.94%), Query Frame = 3
Query:  180 KDLLDK--------NTKYSDDDKFIKVMTLNGHLNYKLNEK-PTPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFEND---IARDAFWRSTAFLLNGILEHLFSSE------TYRSHSNDKG-FICDF-ILKNKS-------ISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLIERL--HSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFP 893
            +DL DK        NT++ +    +    L+  +  K+N+   TP+    +    L+N  +++ VN    D++KPL  D ++EFL F +D       +FWRS +F+ N ILE+ F  +      ++   +   G F+CD  IL   S       I+++  +SI       +    ++  + +    A ++F    +K+  I  +  ++    I +Y+    +DIC  PL+ NT  +    +    SV    T++   L R  GV+ P
Sbjct:   22 RDLFDKEFNENLQLNTRHLEKVT-VHCKNLSQQITLKMNKNISTPHDCAIHIQEYLANKSVMALVNNQPHDMHKPLFEDCELEFLNFHSDNCIPVNLSFWRSCSFITNWILENCFHEDFQVNLCSFPYPNLQSGSFVCDVQILYKDSPEFDEQLITTVNLKSISTTARKIMLENYNYIPLSVNQSTAEEMFRDCPLKMKQIPFMMENANQNKIRIYKVGQHVDICRGPLISNTSHVGRYSLT---SVYPIKTNDYGRLFRFQGVAIP 284          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Planmine SMEST
Match: SMESG000039017.1 (SMESG000039017.1)

HSP 1 Score: 51.9878 bits (123), Expect = 1.175e-6
Identity = 42/179 (23.46%), Postives = 84/179 (46.93%), Query Frame = 3
Query:  951 HRLIGEEQELFFFHN----SSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMN-CPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIF-CRPDQIEQEIERSLDFIKHVYGILNFEF 1469
            ++ + + Q+L  + N    SS G+  ++P      +KLI LI ++       ++T P + ++ +W+ SG WD   + L+K   +  +E  ++P +      L+ + +   +KD+P+ L       R E+  +  GL R R+F   D + F C         ER +    +++  L+ +F
Sbjct:   21 NKYLSKSQKLLLYCNLISPSSFGTYTIMPILQRSLDKLIVLINKEMEFINAQKITMPSLGRSSIWKQSGRWDLLGKELYKFMDRDSKEMCLQPTHEEEVTSLLSTFQPLSTKDMPILLYQITPKFRNEVAPKY-GLLRGREFLMKDLYSFDCDESSAMLTYERVVQQYHNLFQQLDVKF 198          
The following BLAST results are available for this feature:
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TARS13.760e-17048.61threonyl-tRNA synthetase 1 [Source:HGNC Symbol;Acc... [more]
TARS13.760e-17048.61threonyl-tRNA synthetase 1 [Source:HGNC Symbol;Acc... [more]
TARS31.830e-16846.67threonyl-tRNA synthetase 3 [Source:HGNC Symbol;Acc... [more]
TARS31.830e-16846.67threonyl-tRNA synthetase 3 [Source:HGNC Symbol;Acc... [more]
TARS31.839e-16846.67threonyl-tRNA synthetase 3 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tars-14.146e-16246.18Threonine--tRNA ligase, cytoplasmic [Source:UniPr... [more]
tars-14.146e-16246.18Threonine--tRNA ligase, cytoplasmic [Source:UniPr... [more]
tars-14.146e-16246.18Threonine--tRNA ligase, cytoplasmic [Source:UniPr... [more]
tars-11.631e-16146.18Threonine--tRNA ligase, cytoplasmic [Source:UniPr... [more]
back to top
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ThrRS6.905e-16646.46gene:FBgn0027081 transcript:FBtr0080333[more]
ThrRS6.905e-16646.46gene:FBgn0027081 transcript:FBtr0080331[more]
ThrRS8.154e-16646.46gene:FBgn0027081 transcript:FBtr0080332[more]
ThrRS8.154e-16646.46gene:FBgn0027081 transcript:FBtr0346436[more]
mRpL394.306e-1323.83gene:FBgn0036462 transcript:FBtr0075672[more]
back to top
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tars12.896e-16647.22threonyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GE... [more]
tars19.621e-15244.44threonyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GE... [more]
tars14.010e-14943.45threonyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GE... [more]
tars13.475e-14844.44threonyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GE... [more]
tars14.774e-14543.45threonyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tars3.657e-17047.32threonyl-tRNA synthetase 1 [Source:NCBI gene;Acc:4... [more]
tars4.734e-17047.54threonyl-tRNA synthetase 1 [Source:NCBI gene;Acc:4... [more]
tars7.435e-17047.32threonyl-tRNA synthetase 1 [Source:NCBI gene;Acc:4... [more]
tars1.311e-16947.32threonyl-tRNA synthetase 1 [Source:NCBI gene;Acc:4... [more]
tars2.485e-16947.32threonyl-tRNA synthetase 1 [Source:NCBI gene;Acc:4... [more]
back to top
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tars1.519e-17248.61threonyl-tRNA synthetase [Source:MGI Symbol;Acc:MG... [more]
Tarsl25.829e-16744.65threonyl-tRNA synthetase-like 2 [Source:MGI Symbol... [more]
Tars22.499e-15343.13threonyl-tRNA synthetase 2, mitochondrial (putativ... [more]
Tars28.168e-13739.74threonyl-tRNA synthetase 2, mitochondrial (putativ... [more]
Tars24.333e-13351.96threonyl-tRNA synthetase 2, mitochondrial (putativ... [more]
back to top
BLAST of Threonine--tRNA ligase, cytoplasmic vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9D0R2|SYTC_MOUSE9.231e-17248.61Threonine--tRNA ligase 1, cytoplasmic OS=Mus muscu... [more]
sp|Q5XHY5|SYTC_RAT4.733e-17048.61Threonine--tRNA ligase 1, cytoplasmic OS=Rattus no... [more]
sp|P26639|SYTC_HUMAN1.663e-16948.61Threonine--tRNA ligase 1, cytoplasmic OS=Homo sapi... [more]
sp|Q54J66|SYTC1_DICDI6.247e-16945.93Probable threonine--tRNA ligase 1, cytoplasmic OS=... [more]
sp|Q0V9S0|SYTC2_XENTR2.105e-16846.83Threonine--tRNA ligase 2, cytoplasmic OS=Xenopus t... [more]
back to top
BLAST of Threonine--tRNA ligase, cytoplasmic vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A218UNN21.513e-17548.81Putative threonine--tRNA ligase 2, cytoplasmic OS=... [more]
A0A091JGJ51.646e-17548.41Putative threonine--tRNA ligase 2, cytoplasmic (Fr... [more]
A0A3L8SKS54.580e-17548.51AA_TRNA_LIGASE_II domain-containing protein OS=Chl... [more]
H0Z5V34.736e-17548.71Threonyl-tRNA synthetase like 2 OS=Taeniopygia gut... [more]
U3KDA91.053e-17448.81Threonyl-tRNA synthetase like 2 OS=Ficedula albico... [more]
back to top
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tars31.767e-16746.34threonyl-tRNA synthetase 3 [Source:ZFIN;Acc:ZDB-GE... [more]
tars18.384e-16747.20threonyl-tRNA synthetase 1 [Source:NCBI gene;Acc:1... [more]
ENSAMXT00000012886.22.845e-15442.94threonine--tRNA ligase, cytoplasmic-like [Source:N... [more]
mrpl395.653e-1225.67mitochondrial ribosomal protein L39 [Source:NCBI g... [more]
mrpl391.093e-1125.67mitochondrial ribosomal protein L39 [Source:NCBI g... [more]
back to top
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tars14.384e-16646.27threonyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GE... [more]
pars21.535e-725.93prolyl-tRNA synthetase 2, mitochondrial [Source:ZF... [more]
back to top
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
THS11.063e-16143.22Threonyl-tRNA synthetase; essential cytoplasmic pr... [more]
MST12.376e-9853.21Mitochondrial threonyl-tRNA synthetase; aminoacyla... [more]
back to top
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO311932.401e-15251.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO272791.501e-5566.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tars35.914e-16847.33threonine--tRNA ligase, cytoplasmic [Source:NCBI g... [more]
tars39.039e-16847.33threonine--tRNA ligase, cytoplasmic [Source:NCBI g... [more]
tars19.120e-16546.53threonine--tRNA ligase, cytoplasmic [Source:NCBI g... [more]
ENSORLT00000040837.11.994e-15446.79threonine--tRNA ligase, cytoplasmic [Source:NCBI g... [more]
ENSORLT00000013023.24.084e-15446.79threonine--tRNA ligase, cytoplasmic [Source:NCBI g... [more]
back to top
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000047630.14.510e-8299.28SMESG000047630.1[more]
SMESG000061707.11.806e-16747.60SMESG000061707.1[more]
SMESG000067020.15.187e-1124.72SMESG000067020.1[more]
SMESG000039017.11.175e-623.46SMESG000039017.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035804 ID=SMED30035804|Name=Threonine--tRNA ligase, cytoplasmic|organism=Schmidtea mediterranea sexual|type=transcript|length=2161bp
GTTTTATCTATTGAACTATTTTAAATTATTTTTATATTATTTAATGAATT
ACTGACATGATTCTACGTAAAATTCATTATTTTTCTTTTGTAAATAAGTT
GATTCTCAACAAATTTTTAAAAAGGAGCTTAAGTGAAAATGAATTGTTAA
AAGTTCAACAGATAAAACAATTTCTGTGGAAAGATTTATTGGATAAAAAT
ACTAAATATTCTGATGATGATAAATTTATAAAAGTTATGACTTTAAATGG
TCATTTAAATTATAAATTAAATGAGAAACCTACTCCATATATAATTATGC
AAAATGATAATAATCAATTATCGAATTCTATTTTAATATCCAAAGTAAAT
GGATTATTTTGGGACCTCAATAAACCATTAGTTAATGATAGCGATATAGA
ATTTTTATTATTTGAAAATGATATTGCTCGGGATGCATTTTGGAGATCAA
CTGCATTTTTATTAAATGGAATATTAGAGCATTTATTCAGCTCAGAAACT
TATCGAAGCCATTCAAATGACAAAGGATTTATTTGTGATTTTATTTTGAA
AAACAAATCTATTTCCTCATTGCAATTTCAATCCATTGAGGATAAATTTA
TGAATTATGTTGCTTCAGGTGCGGATTTTGAGAGAATTGACATCCCAATA
GAGATTGCTAGAGATTTATTTTCATTTAGTTCAATGAAATTGGATTTAAT
AGAGAGGTTGCACTCGGAAAACAAACCAATCAGTCTTTACCGATGCTTGG
ATTTGATTGATATTTGTGAAGCTCCACTTGTTAGAAATACAGGGCAATTA
AAATACCTAAAAATAGTTAGAAGTGGATCTGTCCAAATGAATTCCACTGA
CAATTGCAACTCTCTGCAACGGATTTACGGGGTATCGTTTCCTAACAAGG
AGCTGCTTGATGGTTGGTTGCTGCACCAGGAAGAAGCTGGTAAAAGAAAT
CATCGACTTATTGGAGAGGAACAAGAATTATTTTTTTTCCATAATTCTTC
TCCGGGATCTGCATTTATGCTTCCACGAGGCACACATATTTGCAATAAAT
TGATCGATCTCATCAGGGAGCAATATAGAAAAAGAGGATTTTCCGAGGTA
ACCACGCCACAAATATTTAAAAATGAATTATGGGAAACCAGTGGGCATTG
GGATCATTATCAAGAAAATCTCTTTAAAATTTCTTTAAAATCAAAAGAAG
AATTTTCTATTAAACCGATGAATTGCCCGGCACATTGTTTGATTTATTCT
CATAAACAAAGATATTCAAAGGATTTGCCATTAAGATTGGCAGATTTTGG
TGCCCTTCATCGTTTTGAACTTACTGGAGAATTGAGTGGGTTAACGAGAC
TACGAAAATTTCATCAGGATGATGCTCACATTTTTTGTCGCCCCGATCAG
ATTGAACAAGAAATTGAAAGATCTTTAGATTTTATCAAACATGTTTATGG
GATATTGAATTTTGAATTTGACTTGCATCTGTCAACGAGGCCAGATAATT
TTCTCGGAGATATTGAAATTTGGAATCTCGCTGAAGAGCAATTAAAAAAA
AGCCTCGAAAAATTTGGAAAATCTTGGTCATTAAATTCTGGTGATGGCGC
ATTTTACGGTCCGAAAATCGATATCATCATTAAAGATGCTCTAAATAGGC
AGCATCAATGTGCAACAATCCAATTAGATTTTCAGCTGCCTTTGAGGTTT
AATCTCAAATATTTTCCGTTGGTTTAGTATAATCTATTATGGATGTGTAA
CTCGCGCTTAGAAATGAAGGCTCATTTGAACGACCAGTTATAATTCATCG
AGCAATTCTTGGATCTGTTGAGAGATTTCTGGCGATTTTGATTGAATCGA
ATTCGGGAAAATGGCCATTTTGGCTGAATCCACGACAAGTTCTTGTTGTT
TCCGTGTCAGACAAATTCATTGAATATGCCAATGAGGTTTGCCAGCAAAT
AAAAGATGCGGGATTCTTATGTGATACCGATTTGAGGAATTTAAGAATGG
CAAGGAAAATTCTGAACGGAGAACAGCAAAGATATAATTGTATACTAATC
ATTGGACAAAAAGAAGTGGACAGTCGGCAAGTCAGTGTTAGGAAAGGACA
TGGAGAAGATCACGAATCGTGGGATCTGCAGGAATTAATTAAGAAATTCA
AATATTGGGAG
back to top

protein sequence of SMED30035804-orf-1

>SMED30035804-orf-1 ID=SMED30035804-orf-1|Name=SMED30035804-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=557bp
MILRKIHYFSFVNKLILNKFLKRSLSENELLKVQQIKQFLWKDLLDKNTK
YSDDDKFIKVMTLNGHLNYKLNEKPTPYIIMQNDNNQLSNSILISKVNGL
FWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYR
SHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEI
ARDLFSFSSMKLDLIERLHSENKPISLYRCLDLIDICEAPLVRNTGQLKY
LKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHR
LIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTT
PQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHK
QRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIE
QEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSL
EKFGKSWSLNSGDGAFYGPKIDIIIKDALNRQHQCATIQLDFQLPLRFNL
KYFPLV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR033728ThrRS_core
IPR002320Thr-tRNA-ligase_IIa
IPR004154Anticodon-bd
IPR012947tRNA_SAD
IPR002314aa-tRNA-synt_IIb
IPR012675Beta-grasp_dom_sf
IPR006195aa-tRNA-synth_II
IPR018163Thr/Ala-tRNA-synth_IIc_edit
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004829threonine-tRNA ligase activity
GO:0016876ligase activity, forming aminoacyl-tRNA and related compounds
GO:0000166nucleotide binding
GO:0004812aminoacyl-tRNA ligase activity
GO:0016874ligase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006435threonyl-tRNA aminoacylation
GO:0043039tRNA aminoacylation
GO:0006418tRNA aminoacylation for protein translation
GO:0006412translation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002320Threonine-tRNA ligase, class IIaPRINTSPR01047TRNASYNTHTHRcoord: 385..413
score: 47.54
coord: 519..547
score: 58.0
coord: 418..441
score: 61.31
IPR002320Threonine-tRNA ligase, class IIaTIGRFAMTIGR00418TIGR00418coord: 132..553
e-value: 2.7E-119
score: 397.6
IPR002320Threonine-tRNA ligase, class IIaPANTHERPTHR11451TRNA SYNTHETASE-RELATEDcoord: 32..552
IPR012947Threonyl/alanyl tRNA synthetase, SADSMARTSM00863tRNA_SAD_4coord: 225..274
e-value: 0.0022
score: 27.3
IPR002314Aminoacyl-tRNA synthetase, class II (G/ P/ S/T)PFAMPF00587tRNA-synt_2bcoord: 374..552
e-value: 1.4E-26
score: 93.6
IPR012675Beta-grasp domain superfamilyGENE3DG3DSA:3.10.20.30coord: 57..117
e-value: 4.3E-8
score: 35.2
NoneNo IPR availableGENE3DG3DSA:3.30.980.10coord: 122..277
e-value: 1.3E-32
score: 114.9
NoneNo IPR availableGENE3DG3DSA:3.30.930.10coord: 278..554
e-value: 3.9E-112
score: 376.6
NoneNo IPR availablePANTHERPTHR11451:SF46FI05224Pcoord: 32..552
NoneNo IPR availableCDDcd01667TGS_ThrRScoord: 72..122
e-value: 9.48644E-7
score: 44.4009
NoneNo IPR availableSUPERFAMILYSSF55681Class II aaRS and biotin synthetasescoord: 298..552
IPR006195Aminoacyl-tRNA synthetase, class IIPROSITEPS50862AA_TRNA_LIGASE_IIcoord: 330..537
score: 19.599
IPR033728Threonine-tRNA ligase catalytic core domainCDDcd00771ThrRS_corecoord: 297..552
e-value: 3.32686E-135
score: 392.684
IPR018163Threonyl/alanyl tRNA synthetase, class II-like, putative editing domain superfamilySUPERFAMILYSSF55186ThrRS/AlaRS common domaincoord: 124..297