TLC domain-containing protein

Overview
NameTLC domain-containing protein
Smed IDSMED30035772
Length (bp)1214
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TLC domain-containing protein (SMED30035772) t-SNE clustered cells

Violin plots show distribution of expression levels for TLC domain-containing protein (SMED30035772) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TLC domain-containing protein (SMED30035772) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TLC domain-containing protein (SMED30035772) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035772

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30035772h1SMcG0019076 dd_Smed_v4_6951_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035772h1SMcG0019076 dd_Smed_v4_6951_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TLC domain-containing protein vs. Ensembl Human
Match: TLCD1 (TLC domain containing 1 [Source:HGNC Symbol;Acc:HGNC:25177])

HSP 1 Score: 95.1301 bits (235), Expect = 7.433e-22
Identity = 61/230 (26.52%), Postives = 118/230 (51.30%), Query Frame = 1
Query:  103 FHVLNRVIGYFFIPIFIRSKGKDEIWKWCNLLMSWVHALIVGSWDLLCFYYYPELTDDLVDFKNSFCYYLIVFSTGYFLYDFADMIYNKKVLKMWELTLHHLAVISTFLYNLCTMTCVGYNVVALLCEVNSFFLHSRKLLQLYHVPFRHVGYRCVAVVNLITFAIFRGIALVTITYGMYVEEKLNDRFYFICLCISMTIMNLLNPILFWIILKNDFLRQFKKPKHIGNGK 792
            F  L R +    +P+ +R+      W+W NLL+S+ H+++ G W LLC +  P++  ++    +   Y L+ FS GYF++D  D++ + +    WE  +HH+  +  F   +   + VG  V+ LL EV++ FL  R ++++ +    H+ YR    VNL+ + +FR      +T+  +    +N R     L   + +++++  I F  +L++DF      P+H+   +
Sbjct:   19 FRALRRALCRLPLPVHVRAD-PLRTWRWHNLLVSFAHSIVSGIWALLCVWQTPDMLVEIETAWSLSGYLLVCFSAGYFIHDTVDIVASGQTRASWEYLVHHVMAMGAFFSGIFWSSFVGGGVLTLLVEVSNIFLTIRMMMKISNAQ-DHLLYRVNKYVNLVMYFLFRLAPQAYLTH--FFLRYVNQRTLGTFLLGILLMLDVMIIIYFSRLLRSDFC-----PEHVPKKQ 239          
BLAST of TLC domain-containing protein vs. Ensembl Human
Match: TLCD2 (TLC domain containing 2 [Source:HGNC Symbol;Acc:HGNC:33522])

HSP 1 Score: 92.8189 bits (229), Expect = 6.847e-21
Identity = 71/264 (26.89%), Postives = 118/264 (44.70%), Query Frame = 1
Query:   76 GAMFLVIGYFHVLNRVIGYFFIPIFIRSKGKDEIWKWCNLLMSWVHALIVGSWDLLCFYYYPELTDDLVDFKNSFCYYLIVFSTGYFLYDFADMIYNKKVLKMWELTLHHLAVISTFLYNLCTMTCVGYNVVALLCEVNS-------FFLHSRKLLQLYHVPFRHVGYRCVAVVNLITFAIFRGIALVTITYGMYVEEKLNDRFYFICLCISMTIMNLLNPILFWIILKNDFLRQFKKPKHIGNGKIVSNGVQNSHLPTQESSD 846
            GA FL     H      G   +P    S  +D  W+W NL +S  H+L+ G+  LL    YP++  D +     +   L+  S GYFL D AD+++N+ + K W+L  HHL V+S     + +   VG+++V+LL E+NS         L SR+   L         +   +  +L T A+FR + L  ++  ++ +             I +  + +++ IL   IL ND L+    P   G+ K      +  + P   +S 
Sbjct:   10 GASFLAFRGLH-----WGLRRLPT-PESAARDR-WQWWNLCVSLAHSLLSGTGALLGLSLYPQMAADPIHGHPRWALVLVAVSVGYFLADGADLLWNQTLGKTWDLLCHHLVVVSCLSTAVLSGHYVGFSMVSLLLELNSACLHLRKLLLLSRQAPSL--------AFSVTSWASLATLALFRLVPLGWMSLWLFRQHHQVPLALVTLGGIGLVTVGIMSIILGIRILVNDVLQSRPHPPSPGHEKTRGTRTRRDNGPVTSNSS 258          
BLAST of TLC domain-containing protein vs. Ensembl Human
Match: TLCD2 (TLC domain containing 2 [Source:HGNC Symbol;Acc:HGNC:33522])

HSP 1 Score: 92.8189 bits (229), Expect = 6.847e-21
Identity = 71/264 (26.89%), Postives = 118/264 (44.70%), Query Frame = 1
Query:   76 GAMFLVIGYFHVLNRVIGYFFIPIFIRSKGKDEIWKWCNLLMSWVHALIVGSWDLLCFYYYPELTDDLVDFKNSFCYYLIVFSTGYFLYDFADMIYNKKVLKMWELTLHHLAVISTFLYNLCTMTCVGYNVVALLCEVNS-------FFLHSRKLLQLYHVPFRHVGYRCVAVVNLITFAIFRGIALVTITYGMYVEEKLNDRFYFICLCISMTIMNLLNPILFWIILKNDFLRQFKKPKHIGNGKIVSNGVQNSHLPTQESSD 846
            GA FL     H      G   +P    S  +D  W+W NL +S  H+L+ G+  LL    YP++  D +     +   L+  S GYFL D AD+++N+ + K W+L  HHL V+S     + +   VG+++V+LL E+NS         L SR+   L         +   +  +L T A+FR + L  ++  ++ +             I +  + +++ IL   IL ND L+    P   G+ K      +  + P   +S 
Sbjct:   10 GASFLAFRGLH-----WGLRRLPT-PESAARDR-WQWWNLCVSLAHSLLSGTGALLGLSLYPQMAADPIHGHPRWALVLVAVSVGYFLADGADLLWNQTLGKTWDLLCHHLVVVSCLSTAVLSGHYVGFSMVSLLLELNSACLHLRKLLLLSRQAPSL--------AFSVTSWASLATLALFRLVPLGWMSLWLFRQHHQVPLALVTLGGIGLVTVGIMSIILGIRILVNDVLQSRPHPPSPGHEKTRGTRTRRDNGPVTSNSS 258          
BLAST of TLC domain-containing protein vs. Ensembl Human
Match: TLCD1 (TLC domain containing 1 [Source:HGNC Symbol;Acc:HGNC:25177])

HSP 1 Score: 67.0106 bits (162), Expect = 2.722e-12
Identity = 54/220 (24.55%), Postives = 103/220 (46.82%), Query Frame = 1
Query:  124 IGYFFIP-IFIRSKGKDEIWKWCNLLMSWVHALIVGSWDLLCFYYYPELTDDLVDFKNSFCYYLIVFSTGYFLYDFADMIYNKKVLKMWELTLHHLAVISTFLYNLCTMTCVGYNVVALLCEVNSFFLHSRKLLQLYHVPFRHVGYRCVAVVNLITFAIFRGIALVTITYGMYVEEKLNDRFYFICLCISMTIMNLLNPILFWIILKNDFLRQFKKPKHI 780
            +GY  +P    R +G+D +W+  ++L+      I  +W L                     Y L+ FS GYF++D  D++ + +    WE  +HH+  +  F   +   + VG  V+ LL EV++ FL  R ++++ +    H+ YR    VNL+ + +FR      +T+  +    +N R     L   + +++++  I F  +L++DF      P+H+
Sbjct:    1 MGYSAVPKCPPRGRGRDSVWQTPDMLVE-----IETAWSL-------------------SGYLLVCFSAGYFIHDTVDIVASGQTRASWEYLVHHVMAMGAFFSGIFWSSFVGGGVLTLLVEVSNIFLTIRMMMKISNAQ-DHLLYRVNKYVNLVMYFLFRLAPQAYLTH--FFLRYVNQRTLGTFLLGILLMLDVMIIIYFSRLLRSDFC-----PEHV 188          
BLAST of TLC domain-containing protein vs. Ensembl Human
Match: TLCD1 (TLC domain containing 1 [Source:HGNC Symbol;Acc:HGNC:25177])

HSP 1 Score: 59.3066 bits (142), Expect = 4.811e-10
Identity = 32/100 (32.00%), Postives = 56/100 (56.00%), Query Frame = 1
Query:  304 YYLIVFSTGYFLYDFADMIYNKKVLKMWELTLHHLAVISTFLYNLCTMTCVGYNVVALLCEVNSFFLHSRKLLQLYHVPFRHVGYRCVAVVNLITFAIFR 603
            Y L+ FS GYF++D  D++ + +    WE  +HH+  +  F   +   + VG  V+ LL EV++ FL  R ++++ +    H+ YR    VNL+ + +FR
Sbjct:   14 YLLVCFSAGYFIHDTVDIVASGQTRASWEYLVHHVMAMGAFFSGIFWSSFVGGGVLTLLVEVSNIFLTIRMMMKISNAQ-DHLLYRVNKYVNLVMYFLFR 112          
BLAST of TLC domain-containing protein vs. Ensembl Celegans
Match: Y63D3A.8 (pep chromosome:WBcel235:I:14114194:14118650:1 gene:WBGene00013407.1 transcript:Y63D3A.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y63D3A.8)

HSP 1 Score: 101.293 bits (251), Expect = 1.037e-23
Identity = 68/230 (29.57%), Postives = 114/230 (49.57%), Query Frame = 1
Query:  178 WKWCNLLMSWVHALIVGSWDLLCFYYYPELTDDLVDFKNSFCYYLIVFSTGYFLYDFADMIYNKKVLKMWELTLHHLAVISTFLYNLCTMTCVGYNVVALLCEVNSFFLHSRKLLQLYHVPFRHVGYRCVAVVNLITFAIFRGIALVTITYGMYVEEKLNDRFYFICLCISMTIMNLL--NPILFWIILKNDFL----RQFKKPKHIGNGKIVSNGVQNSHLPTQ-ESSD 846
            W+  N  +S  H++I G W      YY +L  DLV+++      L++ S GY  +D  D++ N++  ++ EL  HH+ V+S F   +     +G  V  LL E+NS FLHSR LL LY V  +   +R +A++N++T   FR      + Y  +V   + D  +++ +   + I +L   N +L + +L  D L    R  + P      ++    V++  L TQ E  D
Sbjct:  105 WRISNECVSLFHSVISGLWAAYALLYYKQLVQDLVNYRCDVAINLVLMSAGYLFHDLVDLLVNEQSARIIELLFHHVVVLSAFAVTMFFNRFLGVVVFGLLMELNSIFLHSRSLLNLYGVDKKSPSFRIIALLNMVTLFAFRLCVSAYLVY--FVVVSIPDLEWYVSIINGLVIASLASTNTVLTYRLLAADGLLGSRRTRRTPAATAETQV--GDVESGPLRTQVEDED 330          
BLAST of TLC domain-containing protein vs. Ensembl Celegans
Match: K12H6.6 (pep chromosome:WBcel235:II:2828594:2831233:-1 gene:WBGene00019686.1 transcript:K12H6.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K12H6.6)

HSP 1 Score: 89.7373 bits (221), Expect = 6.132e-20
Identity = 69/241 (28.63%), Postives = 109/241 (45.23%), Query Frame = 1
Query:  178 WKWCNLLMSWVHALIVGSWDLLCFYYYPELTDDLVDFKNSFCYY------LIVFSTGYFLYDFADMIYNKKVLKMWELTLHHLAVISTFLYNLCTMTCVGYNVVALLCEVNSFFLHSRKLLQLYHVPFRHVGYRCVAVVNLITFAIFRGIALVTITYGMYVEEKLNDRFYFICLCISMTIMNLLNPILFWIILKNDFL----RQFKKPKHIGNGKIVSNGVQNSHLPTQESSDQPNDFEDG 870
            W+  N  +S VH+ I G W        PEL      FK+   Y+      L++  TGY L D  D+I N++ +++ EL  HH+ V+S F   L     +G  V  LL E+NS FLH R L+ LY    +   +R   ++N+IT  +FR I  V + Y ++    ++  +    +C+ +  +   N +L + +L  D      RQ + P        V   V   H    +   Q +D  DG
Sbjct:   78 WRISNESVSMVHSAISGFWAAYALIVDPEL------FKSPILYHCIVGRNLVLMMTGYLLNDLVDLICNERSVRIVELLFHHVVVLSAFTICLFYDLMLGIVVAGLLMELNSIFLHIRSLMNLYGFDKKLTAFRVTVILNIITLVVFRLIVNVYMIYFVFASFSMSPWYIASTICVLILCLASSNMVLTYRLLAADGFCGASRQRQVPAR------VETEVPPEHQNLVKQVVQGSDQNDG 306          
BLAST of TLC domain-containing protein vs. Ensembl Celegans
Match: F41H10.5 (pep chromosome:WBcel235:IV:5360891:5362161:1 gene:WBGene00018318.1 transcript:F41H10.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F41H10.5)

HSP 1 Score: 75.0998 bits (183), Expect = 4.591e-15
Identity = 60/190 (31.58%), Postives = 99/190 (52.11%), Query Frame = 1
Query:  190 NLLMSWVHALIVGSWDLLCFYYYP-ELTDDLVDFKNSFCYYLIVFSTGYFLYDFADMIYNKKVLKMWELTLHHLAVISTFLYNLCTMTCVGYNVVALLCEVNSFFLHSRKLLQLYHVPFRHVG-YRCVAVVNLITFAIFRGIALVTIT-YGMYVEEKLNDRFYFICLCISMTIM-NLLNPILFWIILKND 747
            NL + W+HA+IVG  DL+  + +P E+  D++D+ N     L + S  YF  D  DM+  +      EL LHH A  +  +    T         ALL EVNS FLH+R +LQ+  +  +  G +R V   N+I+F  FR ++ +  T + +Y    L+  +Y++ + +   I+   +N +LF  +L +D
Sbjct:   63 NLTVCWLHAVIVGGGDLILMFSHPHEIFHDVIDWYNPIAAQLPLISVAYFFQDAFDMLMYEWNSYTLELLLHHFATCAALVAPGLTGKFTLAAGWALLMEVNSIFLHARTILQICGLSTQFPGVFRVVVYSNIISFFFFRIVSQILWTNWAIYNVPGLH--WYYVLVGLGGPIIFGCINGMLFLRLLASD 250          
BLAST of TLC domain-containing protein vs. Ensembl Celegans
Match: M02B1.3 (pep chromosome:WBcel235:IV:12836510:12840674:1 gene:WBGene00010828.1 transcript:M02B1.3a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:M02B1.3)

HSP 1 Score: 56.9954 bits (136), Expect = 7.377e-9
Identity = 48/148 (32.43%), Postives = 73/148 (49.32%), Query Frame = 1
Query:  190 NLLMSWVHALIVGSWDLLCFYYYPELTDDLVDFKNSFCYY------LIVFSTGYFLYDFADMIYNKKV-LKMWELTLHHLAVISTFLYNLCTMTCVGYNVVALLCEVNSFFLHSRKLLQLYHVPFRH-VGY-RCVAVVNLITFAIFRG 606
            NL  S +H+ I G +    F Y  +L      F     YY      +I  S GYF YD  D++ N K+ +    L  HH+A I      + +   + Y   A+L EV+S FLH+R +L +  +     +G+ + V+ +NLITF +FRG
Sbjct:   91 NLTTSLIHSTISGLYLFAFFCYNTKLM-----FAAPLHYYTYLDSQIITLSIGYFFYDGIDLVMNDKLSISTGVLLFHHVASIYVLSTAVLSKKFLLYAYWAMLMEVSSIFLHTRSILHISKLSTTSMIGFSKVVSYLNLITFIVFRG 233          
BLAST of TLC domain-containing protein vs. Ensembl Celegans
Match: M02B1.3 (pep chromosome:WBcel235:IV:12836510:12840411:1 gene:WBGene00010828.1 transcript:M02B1.3a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:M02B1.3)

HSP 1 Score: 56.9954 bits (136), Expect = 7.377e-9
Identity = 48/148 (32.43%), Postives = 73/148 (49.32%), Query Frame = 1
Query:  190 NLLMSWVHALIVGSWDLLCFYYYPELTDDLVDFKNSFCYY------LIVFSTGYFLYDFADMIYNKKV-LKMWELTLHHLAVISTFLYNLCTMTCVGYNVVALLCEVNSFFLHSRKLLQLYHVPFRH-VGY-RCVAVVNLITFAIFRG 606
            NL  S +H+ I G +    F Y  +L      F     YY      +I  S GYF YD  D++ N K+ +    L  HH+A I      + +   + Y   A+L EV+S FLH+R +L +  +     +G+ + V+ +NLITF +FRG
Sbjct:   91 NLTTSLIHSTISGLYLFAFFCYNTKLM-----FAAPLHYYTYLDSQIITLSIGYFFYDGIDLVMNDKLSISTGVLLFHHVASIYVLSTAVLSKKFLLYAYWAMLMEVSSIFLHTRSILHISKLSTTSMIGFSKVVSYLNLITFIVFRG 233          
BLAST of TLC domain-containing protein vs. Ensembl Zebrafish
Match: tlcd2 (TLC domain containing 2 [Source:NCBI gene;Acc:559420])

HSP 1 Score: 154.451 bits (389), Expect = 4.504e-44
Identity = 78/222 (35.14%), Postives = 135/222 (60.81%), Query Frame = 1
Query:   94 IGYFHVLNRVIGYFFIPIFIRSKGKDEIWKWCNLLMSWVHALIVGSWDLLCFYYYPELTDDLVDFKNSFCYYLIVFSTGYFLYDFADMIYNKKVLKMWELTLHHLAVISTFLYNLCTMTCVGYNVVALLCEVNSFFLHSRKLLQLYHVPFRHVGYRCVAVVNLITFAIFRGIALVTITYGMYVEEKLNDRFYFICLCISMTIMNLLNPILFWIILKNDFLRQ 759
            +G+F ++N  +G   IP       +   WKW N+  S+VH+LI G W +LCF  +P++ +DL++  + F + L+  S GYF+YDF DM+ N+K++  WEL  HH+ VI+ F  ++ T   VG+ VVALL E+NS FLH R++L++ ++  +   YR  +++NL T+ +FR   L  +T  + +   L   F +    + + IM  +N +LF+ ++++DF++ 
Sbjct:   14 VGFFKLVNYGLGKLPIP----ETARRNAWKWNNISTSFVHSLITGVWSVLCFCMHPQMAEDLIETHSVFSHALVSVSIGYFIYDFLDMVINQKIIHSWELLFHHVVVITCFGISVLTCRYVGFAVVALLVEINSVFLHLRQVLRMANLA-KSTFYRVNSMINLGTYVVFRINTLAWMTRWLVLNRDLIPLFSYTIGSVGLAIMTAMNIVLFYRLMRSDFMKA 230          
BLAST of TLC domain-containing protein vs. Ensembl Zebrafish
Match: tlcd1 (TLC domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-041010-173])

HSP 1 Score: 125.176 bits (313), Expect = 5.455e-33
Identity = 78/221 (35.29%), Postives = 119/221 (53.85%), Query Frame = 1
Query:  157 SKGKDEIWKWCNLLMSWVHALIVGSWDLLCFYYYPELTDDLVDFKNSFCYYLIVFSTGYFLYDFADMIYNKKVLKMWELTLHHLAVISTFLYNLCTMTCVGYNVVALLCEVNSFFLHSRKLLQLYHVPFRHVGYRCVAVVNLITFAIFR-GIALVTITYGMYVEEKLNDRFYFICLCISMTIMNLLNPILFWIILKNDFLRQFKKPKHIGNGKIVSNGVQN 816
            +K + + WKW NL +S VH+L+ G+W + C  YYP +  ++        Y L+V S+GYF+ D AD++++      WE  LHH+ V+  FLY + T   V   VVAL  EVNS FLH+R LL L  V    + Y    V+N++T+  FR G       Y  Y    L+   YF+   I+M +MN++  I F+ ++++DF   F K +       + NG+Q 
Sbjct:   40 TKDRWKTWKWRNLSVSLVHSLLTGTWAVACVIYYPAMVHEIHSTYTPSAYMLVVVSSGYFIEDAADIVFSGHAKASWEFLLHHVLVLWCFLYAVFTHQYVAGAVVALFVEVNSVFLHTRLLLNLAKVAHSSLIYTVNKVLNVVTYVTFRLGAQFYLTWYLTYHYSSLDYALYFL---ITMMLMNIMILIYFYRLIRSDF---FTKRR-------IQNGIQK 247          
BLAST of TLC domain-containing protein vs. Ensembl Xenopus
Match: TLCD2 (TLC domain containing 2 [Source:NCBI gene;Acc:100497270])

HSP 1 Score: 150.984 bits (380), Expect = 1.209e-42
Identity = 86/234 (36.75%), Postives = 135/234 (57.69%), Query Frame = 1
Query:   73 IGAMFLVIGYFHVLNRVIGYFFIPIFIRSKGKDEIWKWCNLLMSWVHALIVGSWDLLCFYYYPELTDDLVDFKNSFCYYLIVFSTGYFLYDFADMIYNKKVLKMWELTLHHLAVISTFLYNLCTMTCVGYNVVALLCEVNSFFLHSRKLLQLYHVPFRHVGYRCVAVVNLITFAIFRGIALVTITYGMYVEEKLNDRFYFICLCISMTIMNLLNPILFWIILKNDFLRQFKKPK 774
            +GA F    +F +LNR +     P    S      WKW N+  S+VH+LI GSW LL FY +PE+ +DL+   + F + L+  S GYF++DF DM+ N+K+ + WEL  HH  VI+ F  ++     VG+ VVALL E+NS FLH R++L + ++  +   YR  +++NL T+ IFR   L  +T  + +         +    + M IM ++N ILF  +L++DFL+  ++P+
Sbjct:    6 VGASF---AFFRLLNRELHRLVPP---PSSALRNPWKWGNIWTSFVHSLITGSWALLGFYLHPEMAEDLISTHSLFSHSLVAVSIGYFIHDFLDMLQNQKLHQSWELLFHHTVVITCFGISVVLHHYVGFAVVALLVEINSIFLHLRQILLMANL-LKTTFYRLNSLLNLGTYVIFRISTLAWMTRWLVLNRDNIPLVIYTIGSVGMAIMTVMNIILFCRLLRSDFLKSTREPQ 232          
BLAST of TLC domain-containing protein vs. Ensembl Mouse
Match: Tlcd1 (TLC domain containing 1 [Source:MGI Symbol;Acc:MGI:1915572])

HSP 1 Score: 88.1965 bits (217), Expect = 1.080e-19
Identity = 46/161 (28.57%), Postives = 85/161 (52.80%), Query Frame = 1
Query:  103 FHVLNRVIGYFFIPIFIRSKGKDEIWKWCNLLMSWVHALIVGSWDLLCFYYYPELTDDLVDFKNSFCYYLIVFSTGYFLYDFADMIYNKKVLKMWELTLHHLAVISTFLYNLCTMTCVGYNVVALLCEVNSFFLHSRKLLQLYHVP----FRHVGYRCVAV 573
            F  L RV+     P  +++      W+W NLL+S+ H+++ G W LLC +  PE+  ++    ++  Y L+ FS GYF++D  D++ +K+    WE  +HH+  +  F   +     VG  V+ LL EV++ FL  R ++++ +      +++ G R +  
Sbjct:   19 FRALRRVLCRLPQPAHVQTD-PLRTWRWHNLLVSFTHSIVSGIWALLCLWQTPEMLVEIETAWSASGYLLVCFSAGYFIHDTVDIVVSKQTRASWEYLVHHVMAMGAFFSGIFWKRFVGGGVLTLLVEVSNIFLTLRMMMKINNAQDLLLYKYAGQRTLGT 178          
BLAST of TLC domain-containing protein vs. Ensembl Mouse
Match: Tlcd1 (TLC domain containing 1 [Source:MGI Symbol;Acc:MGI:1915572])

HSP 1 Score: 88.5817 bits (218), Expect = 1.208e-19
Identity = 49/167 (29.34%), Postives = 90/167 (53.89%), Query Frame = 1
Query:  103 FHVLNRVIGYFFIPIFIRSKGKDEIWKWCNLLMSWVHALIVGSWDLLCFYYYPELTDDLVDFKNSFCYYLIVFSTGYFLYDFADMIYNKKVLKMWELTLHHLAVISTFLYNLCTMTCVGYNVVALLCEVNSFFLHSRKLLQLYHVPFRHVGYRCVAVVNLITFAIFR 603
            F  L RV+     P  +++      W+W NLL+S+ H+++ G W LLC +  PE+  ++    ++  Y L+ FS GYF++D  D++ +K+    WE  +HH+  +  F   +     VG  V+ LL EV++ FL  R ++++ +     + Y+    +NL+ + +FR
Sbjct:   19 FRALRRVLCRLPQPAHVQTD-PLRTWRWHNLLVSFTHSIVSGIWALLCLWQTPEMLVEIETAWSASGYLLVCFSAGYFIHDTVDIVVSKQTRASWEYLVHHVMAMGAFFSGIFWKRFVGGGVLTLLVEVSNIFLTLRMMMKINNAQ-DLLLYKVNKYINLVMYFLFR 183          
BLAST of TLC domain-containing protein vs. Ensembl Mouse
Match: Tlcd2 (TLC domain containing 2 [Source:MGI Symbol;Acc:MGI:1917141])

HSP 1 Score: 76.2554 bits (186), Expect = 9.146e-16
Identity = 36/122 (29.51%), Postives = 69/122 (56.56%), Query Frame = 1
Query:  130 YFFIPIFIRSKGKDEIWKWCNLLMSWVHALIVGSWDLLCFYYYPELTDDLVDFKNSFCYYLIVFSTGYFLYDFADMIYNKKVLKMWELTLHHLAVISTFLYNLCTMTCVGYNVVALLCEVNS 495
            ++ + +    K   + W W N+ +S +H+L+ G   L+  + +P++  D ++    +   L+  S GYF  D  DM++N+ + + W+L  HHLAV+S     + +   VG+++V+LL E+NS
Sbjct:   20 HWGLQLLPTPKSVRDRWMWRNIFVSLIHSLLSGVGALVGLWQFPQMVTDPINDHPPWARVLVAVSVGYFAADGVDMLWNQTLAQAWDLLCHHLAVVSCLSTAVVSGHYVGFSMVSLLLELNS 141          
BLAST of TLC domain-containing protein vs. Ensembl Mouse
Match: Tlcd2 (TLC domain containing 2 [Source:MGI Symbol;Acc:MGI:1917141])

HSP 1 Score: 77.411 bits (189), Expect = 2.103e-15
Identity = 36/112 (32.14%), Postives = 65/112 (58.04%), Query Frame = 1
Query:  160 KGKDEIWKWCNLLMSWVHALIVGSWDLLCFYYYPELTDDLVDFKNSFCYYLIVFSTGYFLYDFADMIYNKKVLKMWELTLHHLAVISTFLYNLCTMTCVGYNVVALLCEVNS 495
            K   + W W N+ +S +H+L+ G   L+  + +P++  D ++    +   L+  S GYF  D  DM++N+ + + W+L  HHLAV+S     + +   VG+++V+LL E+NS
Sbjct:   30 KSVRDRWMWRNIFVSLIHSLLSGVGALVGLWQFPQMVTDPINDHPPWARVLVAVSVGYFAADGVDMLWNQTLAQAWDLLCHHLAVVSCLSTAVVSGHYVGFSMVSLLLELNS 141          
BLAST of TLC domain-containing protein vs. Ensembl Mouse
Match: Tlcd1 (TLC domain containing 1 [Source:MGI Symbol;Acc:MGI:1915572])

HSP 1 Score: 73.1738 bits (178), Expect = 2.265e-15
Identity = 34/104 (32.69%), Postives = 59/104 (56.73%), Query Frame = 1
Query:  103 FHVLNRVIGYFFIPIFIRSKGKDEIWKWCNLLMSWVHALIVGSWDLLCFYYYPELTDDLVDFKNSFCYYLIVFSTGYFLYDFADMIYNKKVLKMWELTLHHLAV 414
            F  L RV+     P  +++      W+W NLL+S+ H+++ G W LLC +  PE+  ++    ++  Y L+ FS GYF++D  D++ +K+    WE  +HH+ V
Sbjct:   19 FRALRRVLCRLPQPAHVQTDPL-RTWRWHNLLVSFTHSIVSGIWALLCLWQTPEMLVEIETAWSASGYLLVCFSAGYFIHDTVDIVVSKQTRASWEYLVHHVMV 121          
BLAST of TLC domain-containing protein vs. UniProt/SwissProt
Match: sp|A8WGS4|TLCD2_DANRE (TLC domain-containing protein 2 OS=Danio rerio OX=7955 GN=tlcd2 PE=2 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 3.400e-43
Identity = 78/222 (35.14%), Postives = 135/222 (60.81%), Query Frame = 1
Query:   94 IGYFHVLNRVIGYFFIPIFIRSKGKDEIWKWCNLLMSWVHALIVGSWDLLCFYYYPELTDDLVDFKNSFCYYLIVFSTGYFLYDFADMIYNKKVLKMWELTLHHLAVISTFLYNLCTMTCVGYNVVALLCEVNSFFLHSRKLLQLYHVPFRHVGYRCVAVVNLITFAIFRGIALVTITYGMYVEEKLNDRFYFICLCISMTIMNLLNPILFWIILKNDFLRQ 759
            +G+F ++N  +G   IP       +   WKW N+  S+VH+LI G W +LCF  +P++ +DL++  + F + L+  S GYF+YDF DM+ N+K++  WEL  HH+ VI+ F  ++ T   VG+ VVALL E+NS FLH R++L++ ++  +   YR  +++NL T+ +FR   L  +T  + +   L   F +    + + IM  +N +LF+ ++++DF++ 
Sbjct:   14 VGFFKLVNYGLGKLPIP----ETARRNAWKWNNISTSFVHSLITGVWSVLCFCMHPQMAEDLIETHSVFSHALVSVSIGYFIYDFLDMVINQKIIHSWELLFHHVVVITCFGISVLTCRYVGFAVVALLVEINSVFLHLRQVLRMANLA-KSTFYRVNSMINLGTYVVFRINTLAWMTRWLVLNRDLIPLFSYTIGSVGLAIMTAMNIVLFYRLMRSDFMKA 230          
BLAST of TLC domain-containing protein vs. UniProt/SwissProt
Match: sp|G5EF48|FLD1_CAEEL (TLC domain-containing protein fld-1 OS=Caenorhabditis elegans OX=6239 GN=fld-1 PE=1 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 1.319e-22
Identity = 68/230 (29.57%), Postives = 114/230 (49.57%), Query Frame = 1
Query:  178 WKWCNLLMSWVHALIVGSWDLLCFYYYPELTDDLVDFKNSFCYYLIVFSTGYFLYDFADMIYNKKVLKMWELTLHHLAVISTFLYNLCTMTCVGYNVVALLCEVNSFFLHSRKLLQLYHVPFRHVGYRCVAVVNLITFAIFRGIALVTITYGMYVEEKLNDRFYFICLCISMTIMNLL--NPILFWIILKNDFL----RQFKKPKHIGNGKIVSNGVQNSHLPTQ-ESSD 846
            W+  N  +S  H++I G W      YY +L  DLV+++      L++ S GY  +D  D++ N++  ++ EL  HH+ V+S F   +     +G  V  LL E+NS FLHSR LL LY V  +   +R +A++N++T   FR      + Y  +V   + D  +++ +   + I +L   N +L + +L  D L    R  + P      ++    V++  L TQ E  D
Sbjct:  105 WRISNECVSLFHSVISGLWAAYALLYYKQLVQDLVNYRCDVAINLVLMSAGYLFHDLVDLLVNEQSARIIELLFHHVVVLSAFAVTMFFNRFLGVVVFGLLMELNSIFLHSRSLLNLYGVDKKSPSFRIIALLNMVTLFAFRLCVSAYLVY--FVVVSIPDLEWYVSIINGLVIASLASTNTVLTYRLLAADGLLGSRRTRRTPAATAETQV--GDVESGPLRTQVEDED 330          
BLAST of TLC domain-containing protein vs. UniProt/SwissProt
Match: sp|F1NZP5|TLCD1_CHICK (TLC domain-containing protein 1 OS=Gallus gallus OX=9031 GN=TLCD1 PE=1 SV=2)

HSP 1 Score: 97.0561 bits (240), Expect = 7.958e-22
Identity = 64/208 (30.77%), Postives = 113/208 (54.33%), Query Frame = 1
Query:  151 IRSKGKDEIWKWCNLLMSWVHALIVGSWDLLCFYYYPELTDDLVDFKNSFCYYLIVFSTGYFLYDFADMIYNKKVLKMWELTLHHLAVISTFLYNLCTMTCVGYNVVALLCEVNSFFLHSRKLLQLYHVPFRHVGYRCVAVVNLITFAIFRGIALVTIT--YGMYVEEKLNDRFYFICLCISMTIMNLLNPILFWIILKNDFLRQFKK 768
            +RS+    +W+W NLL+S+ H+++ G W L   +  PEL  D+ D  +   + L+ FS+GYF++D  D+I+N++    WE  +HH   IS F+  + T   +   ++ LL EV++ FL  R LL++ +VP   + Y     VNL+ +  FR    V +T  +  YVE +    F    L  ++ +++ +  + F  +L++DF    +K
Sbjct:   36 VRSR-PGRVWRWRNLLVSFAHSVLAGLWALFSLWQSPELLSDIQDGYSVSGHLLVCFSSGYFIHDSLDIIFNQQSRSSWEYLVHHAMAISAFVSLIITGRFLVAAMLLLLVEVSNIFLTIRMLLKMSNVPSPAL-YEANKYVNLVMYFAFRLAPQVYLTWYFVRYVEVQGQGAF----LMANLLLLDAMILMYFSRLLRSDFFPSLRK 237          
BLAST of TLC domain-containing protein vs. UniProt/SwissProt
Match: sp|Q96CP7|TLCD1_HUMAN (TLC domain-containing protein 1 OS=Homo sapiens OX=9606 GN=TLCD1 PE=1 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 3.570e-21
Identity = 61/230 (26.52%), Postives = 118/230 (51.30%), Query Frame = 1
Query:  103 FHVLNRVIGYFFIPIFIRSKGKDEIWKWCNLLMSWVHALIVGSWDLLCFYYYPELTDDLVDFKNSFCYYLIVFSTGYFLYDFADMIYNKKVLKMWELTLHHLAVISTFLYNLCTMTCVGYNVVALLCEVNSFFLHSRKLLQLYHVPFRHVGYRCVAVVNLITFAIFRGIALVTITYGMYVEEKLNDRFYFICLCISMTIMNLLNPILFWIILKNDFLRQFKKPKHIGNGK 792
            F  L R +    +P+ +R+      W+W NLL+S+ H+++ G W LLC +  P++  ++    +   Y L+ FS GYF++D  D++ + +    WE  +HH+  +  F   +   + VG  V+ LL EV++ FL  R ++++ +    H+ YR    VNL+ + +FR      +T+  +    +N R     L   + +++++  I F  +L++DF      P+H+   +
Sbjct:   19 FRALRRALCRLPLPVHVRAD-PLRTWRWHNLLVSFAHSIVSGIWALLCVWQTPDMLVEIETAWSLSGYLLVCFSAGYFIHDTVDIVASGQTRASWEYLVHHVMAMGAFFSGIFWSSFVGGGVLTLLVEVSNIFLTIRMMMKISNAQ-DHLLYRVNKYVNLVMYFLFRLAPQAYLTH--FFLRYVNQRTLGTFLLGILLMLDVMIIIYFSRLLRSDFC-----PEHVPKKQ 239          
BLAST of TLC domain-containing protein vs. UniProt/SwissProt
Match: sp|A6NGC4|TLCD2_HUMAN (TLC domain-containing protein 2 OS=Homo sapiens OX=9606 GN=TLCD2 PE=3 SV=3)

HSP 1 Score: 92.8189 bits (229), Expect = 3.288e-20
Identity = 71/264 (26.89%), Postives = 118/264 (44.70%), Query Frame = 1
Query:   76 GAMFLVIGYFHVLNRVIGYFFIPIFIRSKGKDEIWKWCNLLMSWVHALIVGSWDLLCFYYYPELTDDLVDFKNSFCYYLIVFSTGYFLYDFADMIYNKKVLKMWELTLHHLAVISTFLYNLCTMTCVGYNVVALLCEVNS-------FFLHSRKLLQLYHVPFRHVGYRCVAVVNLITFAIFRGIALVTITYGMYVEEKLNDRFYFICLCISMTIMNLLNPILFWIILKNDFLRQFKKPKHIGNGKIVSNGVQNSHLPTQESSD 846
            GA FL     H      G   +P    S  +D  W+W NL +S  H+L+ G+  LL    YP++  D +     +   L+  S GYFL D AD+++N+ + K W+L  HHL V+S     + +   VG+++V+LL E+NS         L SR+   L         +   +  +L T A+FR + L  ++  ++ +             I +  + +++ IL   IL ND L+    P   G+ K      +  + P   +S 
Sbjct:   10 GASFLAFRGLH-----WGLRRLPT-PESAARDR-WQWWNLCVSLAHSLLSGTGALLGLSLYPQMAADPIHGHPRWALVLVAVSVGYFLADGADLLWNQTLGKTWDLLCHHLVVVSCLSTAVLSGHYVGFSMVSLLLELNSACLHLRKLLLLSRQAPSL--------AFSVTSWASLATLALFRLVPLGWMSLWLFRQHHQVPLALVTLGGIGLVTVGIMSIILGIRILVNDVLQSRPHPPSPGHEKTRGTRTRRDNGPVTSNSS 258          
BLAST of TLC domain-containing protein vs. TrEMBL
Match: A0A1I8JCR1 (TLC domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013606g1 PE=4 SV=1)

HSP 1 Score: 271.937 bits (694), Expect = 2.417e-85
Identity = 139/280 (49.64%), Postives = 180/280 (64.29%), Query Frame = 1
Query:   40 NESYFLNTKCGIGAMFLVIGYFHVLNRVIGYFFIPIFIRSKG---KDEIWKWCNLLMSWVHALIVGSWDLLCFYYYPELTDDLVDFKNSFCYYLIVFSTGYFLYDFADMIYNKKVLKMWELTLHHLAVISTFLYNLCTMTCVGYNVVALLCEVNSFFLHSRKLLQLYHVPFRHVGYRCVAVVNLITFAIFRGIALVTITYGMYVEEKLNDRFYFICLCISMTIMNLLNPILFWIILKNDFLR-----QFKKPKHIGNGKIVSNGVQNSHLPTQESSDQPN 855
            N +  ++ + G G M   I +F++LNR++ Y  +P+ +       ++E WKW NLL+SW+HA IVG WD+LCFYYYPE+  DL+     F YY++  STGYF+YDF D+I  KKVL+MW+LTLHH+AV S F YNL T  CV YNVVAL+ E+NSFFLHSRKL+Q+    F    YR  A+VNL+TF   RG  L  ITYGM VE    D  YF  L  SM IMN++NP LF I+LKNDFLR     +  K +  G+G+ V   VQN   PT+ +   P 
Sbjct:   12 NNTDVVSVQGGYGVMIGTIIFFNILNRIVSYIGVPVAVVKHAVNKEEEAWKWKNLLLSWIHAFIVGLWDILCFYYYPEIWQDLITHITPFTYYMVAVSTGYFMYDFGDLIVQKKVLEMWQLTLHHIAVTSMFFYNLTTRRCVAYNVVALMAEINSFFLHSRKLMQMQQFKFSSPIYRANALVNLVTFLFCRGFGLGRITYGMIVEGHRVDSVYFYTLTGSMFIMNMINPGLFIILLKNDFLRKDYHSKATKKQLRGSGESVKP-VQNGLHPTESTDSLPG 290          
BLAST of TLC domain-containing protein vs. TrEMBL
Match: A0A267DGA2 (TLC domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003140g1 PE=4 SV=1)

HSP 1 Score: 271.552 bits (693), Expect = 2.782e-85
Identity = 139/280 (49.64%), Postives = 180/280 (64.29%), Query Frame = 1
Query:   40 NESYFLNTKCGIGAMFLVIGYFHVLNRVIGYFFIPIFIRSKG---KDEIWKWCNLLMSWVHALIVGSWDLLCFYYYPELTDDLVDFKNSFCYYLIVFSTGYFLYDFADMIYNKKVLKMWELTLHHLAVISTFLYNLCTMTCVGYNVVALLCEVNSFFLHSRKLLQLYHVPFRHVGYRCVAVVNLITFAIFRGIALVTITYGMYVEEKLNDRFYFICLCISMTIMNLLNPILFWIILKNDFLR-----QFKKPKHIGNGKIVSNGVQNSHLPTQESSDQPN 855
            N +  ++ + G G M   I +F++LNR++ Y  +P+ +       ++E WKW NLL+SW+HA IVG WD+LCFYYYPE+  DL+     F YY++  STGYF+YDF D+I  KKVL+MW+LTLHH+AV S F YNL T  CV YNVVAL+ E+NSFFLHSRKL+Q+    F    YR  A+VNL+TF   RG  L  ITYGM VE    D  YF  L  SM IMN++NP LF I+LKNDFLR     +  K +  G+G+ V   VQN   PT+ +   P 
Sbjct:   12 NNTDVVSVQGGYGVMIGTIIFFNILNRIVSYIGVPVAVVKHAVNKEEEAWKWKNLLLSWIHAFIVGLWDILCFYYYPEIWQDLITHITPFTYYMVAVSTGYFMYDFGDLIVQKKVLEMWQLTLHHIAVTSMFFYNLTTRRCVAYNVVALMAEINSFFLHSRKLMQMQQFKFSSPIYRANALVNLVTFLFCRGFGLGRITYGMIVEGHRVDSVYFYTLTGSMFIMNMINPGLFIILLKNDFLRKDYHSKATKKQLRGSGESVKP-VQNGLHPTESTDSLPG 290          
BLAST of TLC domain-containing protein vs. TrEMBL
Match: A0A267GUP4 (TLC domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017238g1 PE=4 SV=1)

HSP 1 Score: 269.626 bits (688), Expect = 1.475e-84
Identity = 138/280 (49.29%), Postives = 180/280 (64.29%), Query Frame = 1
Query:   40 NESYFLNTKCGIGAMFLVIGYFHVLNRVIGYFFIPIFIRSKG---KDEIWKWCNLLMSWVHALIVGSWDLLCFYYYPELTDDLVDFKNSFCYYLIVFSTGYFLYDFADMIYNKKVLKMWELTLHHLAVISTFLYNLCTMTCVGYNVVALLCEVNSFFLHSRKLLQLYHVPFRHVGYRCVAVVNLITFAIFRGIALVTITYGMYVEEKLNDRFYFICLCISMTIMNLLNPILFWIILKNDFLR-----QFKKPKHIGNGKIVSNGVQNSHLPTQESSDQPN 855
            N +  ++ + G G M   I +F++LNR++ Y  +P+ +       ++E WKW NLL+SW+HA IVG WD+LCFYYYPE+  DL+     F YY++  STGYF+YDF D+I  KKVL+MW+LTLHH+AV S F YNL T  CV YNVVAL+ E+NSFFLHSRKL+Q+    F    Y+  A+VNL+TF   RG  L  ITYGM VE    D  YF  L  SM IMN++NP LF I+LKNDFLR     +  K +  G+G+ V   VQN   PT+ +   P 
Sbjct:   12 NNTDVVSVQGGYGVMIGTIIFFNILNRIVSYIGVPVAVVKHAVNKEEEAWKWKNLLLSWIHAFIVGLWDILCFYYYPEIWQDLITHITPFTYYMVAVSTGYFMYDFGDLIVQKKVLEMWQLTLHHIAVTSMFFYNLTTRRCVAYNVVALMAEINSFFLHSRKLMQMQQFKFSSPIYQANALVNLVTFLFCRGFGLGRITYGMIVEGHRVDSVYFYTLTGSMFIMNMINPGLFIILLKNDFLRKDYHSKATKKQLRGSGESVKP-VQNGLHPTESTDSLPG 290          
BLAST of TLC domain-containing protein vs. TrEMBL
Match: A0A2H1CD96 (Putative transmembrane protein 56 OS=Fasciola hepatica OX=6192 GN=D915_004796 PE=4 SV=1)

HSP 1 Score: 268.855 bits (686), Expect = 7.846e-84
Identity = 138/264 (52.27%), Postives = 172/264 (65.15%), Query Frame = 1
Query:   58 NTKCGIGAMFLVIGYFHVLNRVIGYFFIPIFIRSKGKDEIWKWCNLLMSWVHALIVGSWDLLCFYYYPELTDDLVDFKNSFCYYLIVFSTGYFLYDFADMIYNKKVLKMWELTLHHLAVISTFLYNLCTMTCVGYNVVALLCEVNSFFLHSRKLLQLYHVPFRHVGYRCVAVVNLITFAIFRGIALVTITYGMYVEEKLNDRFYFICLCISMTIMNLLNPILFWIILKNDFLRQFKKPKHIGNGKIVS------NGVQNSHLPT 831
             TK G+    L I  F  L+  +     P  I SKG ++IW+W N+++SWVHAL+VG+WD+LCFYYYP L +DLVD    F YY++  STGYFL+DF DM   KK L+MWELTLHH AV+S F+YN+ T+  + Y VVALL EVNS FLH+RKL+Q++ VPF    YR  AV+NL+TFA  RG AL  ITYGMY E      FYF  LC SM IMNLLNP+LF I+L+NDFLR  K      N   ++          NSH+ T
Sbjct:   23 ETKFGVICTVLSIIAFKTLDNALKSVTPPEAILSKGPEQIWRWRNMVVSWVHALLVGTWDILCFYYYPTLMNDLVDHVVPFTYYMVAISTGYFLFDFWDMCVQKKTLRMWELTLHHFAVLSAFIYNIVTVKYIAYTVVALLAEVNSIFLHTRKLMQMHKVPFTTSVYRFNAVLNLLTFAGCRGFALFRITYGMYTEPYRMSPFYFALLCASMLIMNLLNPVLFCILLRNDFLRSTKPSTESKNDDDLTPKPVKLTNSSNSHVST 286          
BLAST of TLC domain-containing protein vs. TrEMBL
Match: A0A074ZIG2 (TLC domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_06054 PE=4 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 8.653e-84
Identity = 130/242 (53.72%), Postives = 166/242 (68.60%), Query Frame = 1
Query:   82 MFLVIGYFHVLNRVIGYFFIPIFIRSKGKDEIWKWCNLLMSWVHALIVGSWDLLCFYYYPELTDDLVDFKNSFCYYLIVFSTGYFLYDFADMIYNKKVLKMWELTLHHLAVISTFLYNLCTMTCVGYNVVALLCEVNSFFLHSRKLLQLYHVPFRHVGYRCVAVVNLITFAIFRGIALVTITYGMYVEEKLNDRFYFICLCISMTIMNLLNPILFWIILKNDFLRQFKKPKHIGNGKIVSNG 807
            M L I +F  L++ +  +  P  +  KG D +WKW N+++SWVHAL+VG+WD+LCFYYYP L +DLV+    F YY++  STGYFL+DF DM   +KV K+ EL+LHH AV+S F+YNL T+  +GY VVALL EVNS FLH+RKL+Q++ V F +  YR  AV+NLITFA  RG  L  ITYGMY+E      FY + LC SM IMN+LNPILFWI+ +NDFLR    P      K  SNG
Sbjct:    1 MSLSIAFFKSLDQALQGYSPPPEVARKGPDSVWKWRNMMVSWVHALLVGTWDILCFYYYPSLMNDLVEHVVPFTYYMVAISTGYFLFDFWDMYKQRKVFKLLELSLHHFAVLSAFIYNLLTVRFIGYTVVALLAEVNSIFLHTRKLMQMHRVSFTNPMYRLNAVLNLITFAGCRGYCLFRITYGMYMEPHRMSPFYLVLLCFSMGIMNILNPILFWILFRNDFLRPPPPPAERHADKTSSNG 242          
BLAST of TLC domain-containing protein vs. Ensembl Cavefish
Match: tlcd2 (TLC domain-containing protein 2 [Source:NCBI gene;Acc:103028751])

HSP 1 Score: 155.606 bits (392), Expect = 1.572e-44
Identity = 78/224 (34.82%), Postives = 134/224 (59.82%), Query Frame = 1
Query:   94 IGYFHVLNRVIGYFFIPIFIRSKGKDEIWKWCNLLMSWVHALIVGSWDLLCFYYYPELTDDLVDFKNSFCYYLIVFSTGYFLYDFADMIYNKKVLKMWELTLHHLAVISTFLYNLCTMTCVGYNVVALLCEVNSFFLHSRKLLQLYHVPFRHVGYRCVAVVNLITFAIFRGIALVTITYGMYVEEKLNDRFYFICLCISMTIMNLLNPILFWIILKNDFLRQFK 765
            +G+F    R   Y F  + +    +   WKW N+  S++H+LI G W +LCFY +P++ +DL++  + F + L+  S GYF+YDF DM+ N+K+ + WEL  HH+ VI+ F  ++ T   +G+ VVALL E+NS FLH R++L++ +V  +   YR  +++NL T+ +FR   L  +T  + +   L     +    + + IM ++N +LF+ +L+ DFL+  +
Sbjct:   14 VGFF----RAANYGFSKLPVPETAQRNTWKWRNICTSFIHSLITGVWAVLCFYMHPQMAEDLIETHSVFSHALVSVSIGYFIYDFLDMVLNQKIYQSWELLFHHVVVITCFGLSVLTCRYIGFAVVALLVEINSIFLHLRQMLRMANVS-KSTFYRVNSMINLGTYVVFRINTLAWMTRWLVLNRDLIPLLSYTVGSVGLAIMTVMNIVLFYRLLRTDFLKSSR 232          
BLAST of TLC domain-containing protein vs. Ensembl Cavefish
Match: tlcd1 (TLC domain containing 1 [Source:NCBI gene;Acc:103044061])

HSP 1 Score: 110.538 bits (275), Expect = 1.253e-27
Identity = 74/204 (36.27%), Postives = 110/204 (53.92%), Query Frame = 1
Query:  178 WKWCNLLMSWVHALIVGSWDLLCFYYYPELTDDLVDFKNSFCYYLIVFSTGYFLYDFADMIYNKKVLKMWELTLHHLAVISTFLYNLCTMTCVGYNVVALLCEVNSFFLHSRKLLQLYHVPFRHVGYRCVAVVNLITFAIFRGIALVTITYGMYVEEKLNDRFYFICLCISMTIMNLLNPILFWIILKNDFLRQFKKPKHIGNG 789
            W+W NL +S VH+L+ G+W + C   YP +  DL        Y L+V STGYF+ D  D+I++    + WE  +HH+ VISTF+Y L T   V   V+AL  EVNS FLH R LL+L  VP   + Y    ++N+ T+  FR  A   +++ +       D   F  +C  M +MN++  + F+ +L+ DF      P+   NG
Sbjct:   47 WRWENLSVSLVHSLLSGAWAVFCVLQYPLMVHDLHSSFTPLAYLLVVISTGYFIQDAGDIIFSGHARESWEFLIHHVLVISTFMYALITSVYVAGAVIALFVEVNSVFLHLRLLLKLAGVPRDSLLYTVNKLINVATYISFRLGAQFYLSWYIIYNYSWLDHALFFLVC--MMLMNIMILVYFYRLLQTDFF----TPRSHQNG 244          
BLAST of TLC domain-containing protein vs. Ensembl Cavefish
Match: TLCD1 (calfacilitin-like [Source:NCBI gene;Acc:103023685])

HSP 1 Score: 106.301 bits (264), Expect = 4.473e-26
Identity = 77/246 (31.30%), Postives = 126/246 (51.22%), Query Frame = 1
Query:  103 FHVLNRVIGYFFIPIFIRSKGKDEI--WKWCNLLMSWVHALIVGSWDLLCFYYYPELTDDLVDFKNSFCYYLIVFSTGYFLYDFADMIYNKKVLKMWELTLHHLAVISTFLYNLCTMTCVGYNVVALLCEVNSFFLHSRKLLQLYHVPFRHVGYRCVAVVNLITFAIFRGIALVTITYGMYVEEK-LNDRFYFICLCISMTIMNLLNPILFWIILKNDFLRQFKKPKHIGNGKIVSNGVQNSHLPT 831
            F V++R++     P   ++   DE+  WKW NL +S VHA++ G W + C   +PE+  ++  +     Y L+  STGYFL D  D++ +      WE  LHH  V+  FLY+L T   V   V+ALL E+NS  LH+R LL+L       + Y    ++NL T+  FR  A   +++ +      L+  +YF+   +++ +MN +  I F+ +L+ DF  + K        ++  NG  +S   T
Sbjct:   25 FRVVHRLLRCLPAP---KAVQLDEVRCWKWRNLCVSLVHAMLTGPWAVTCVCLWPEMLSNIHSYYTPMSYLLLCVSTGYFLQDTGDILLSGHARGSWEFLLHHFLVLWCFLYSLYTQRYVSGMVIALLVELNSVTLHARLLLKLAGAQASQL-YHTNKLLNLFTYITFRLSAQFYLSWYLLKNLSWLDHSYYFL---VTVVLMNTMILIYFYRLLRADFFPRRKL-------QLEMNGTHSSSSST 256          
BLAST of TLC domain-containing protein vs. Ensembl Sea Lamprey
Match: tlcd1 (TLC domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-041010-173])

HSP 1 Score: 85.5001 bits (210), Expect = 5.924e-20
Identity = 65/185 (35.14%), Postives = 95/185 (51.35%), Query Frame = 1
Query:  253 YYPELTDDLVDFKNSFCYYLIVFSTGYFLYDFADMIYNKKVLKMWELTLHHLAVISTFLYNLCTMTCVGYNVVALLCEVNSFFLHSRKLLQLYHVPFR-HVGYRCVAVVNLITFAIFRGIALVTITYGMYVEEKLNDRFYFICLCISMTIMNLLNPILFWIILKNDFLRQFKKPKHIGNGKIVSN 804
            ++PE+  DL  +       L+  STGYFL D  D++++ +V   WE   HH  V+S F Y+L T   V    VALL EVNS FLH+R L++L          YR    +N  T+ IFR  A   +T  + V+ +L     F   CI + +MN++  I F+ +L  DF  + K+     N K VS+
Sbjct:    3 FFPEVLTDLTSYTLPM-NVLLAISTGYFLQDTLDIVWSGQVKASWEFLFHHALVLSCFGYSLLTRQYVAGTTVALLVEVNSVFLHARLLMKLAGANAGCSRAYRLNRYLNAFTYVIFRLGAQAYLTAYVIVQWQLLMHPLF--FCIVLNLMNIIMLIYFYRLLLTDFCPRLKQ---CNNNKFVSD 181          
BLAST of TLC domain-containing protein vs. Ensembl Nematostella
Match: EDO35196 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM93])

HSP 1 Score: 98.2117 bits (243), Expect = 1.370e-23
Identity = 55/158 (34.81%), Postives = 84/158 (53.16%), Query Frame = 1
Query:  130 YFFIPIFIRSKGKDEIWKWCNLLMSWVHALIVGSWDLLCFYYYPELTDDLVDFKNSFCYYLIVFSTGYFLYDFADMIYNKKVLKMWELTLHHLAVISTFLYNLCTMTCVGYNVVALLCEVNSFFLHSRKLLQLYHVPFRHVGYRCVAVVNLITFAIFR 603
            Y  +P  I    + + W + N+ +S +H+ +   W L CFY  P +  D++    S  Y+L+  STGYFL+DF DM+ N  + +   L +HH  V+  FL  + T    GY   +LL EVNS FLHSR+++  + V  +   Y    ++ L TF  FR
Sbjct:   31 YIALPNSIVHGPRRKQWLYYNISISLIHSTVTAIWSLYCFYNEPAMLSDMIGVWTSSSYFLLCLSTGYFLHDFLDMLLN-DLSRSTVLLIHHTLVVVAFLIAILTKNYCGYGTCSLLMEVNSVFLHSRRIMLFHDVDRKSTLYELNGLLMLATFVFFR 187          
BLAST of TLC domain-containing protein vs. Ensembl Medaka
Match: tlcd2 (TLC domain containing 2 [Source:NCBI gene;Acc:101172260])

HSP 1 Score: 144.05 bits (362), Expect = 3.309e-40
Identity = 77/232 (33.19%), Postives = 134/232 (57.76%), Query Frame = 1
Query:   94 IGYFHVLNRVIGYFFIPIFIRSKGKDEIWKWCNLLMSWVHALIVGSWDLLCFYYYPELTDDLVDFKNSFCYYLIVFSTGYFLYDFADMIYNKKVLKMWELTLHHLAVISTFLYNLCTMTCVGYNVVALLCEVNSFFLHSRKLLQLYHVPFRHVGYRCVAVVNLITFAIFRGIALVTITYGMYVEEKLNDRFYFICLCISMTIMNLLNPILFWIILKNDFL----RQFKKPKH 777
            +G+F ++N  +    +P       +   WKW N+  S+VH+ I   W +LCF+ +P++ +DL++  + F + L+ FS GYF+YDF DM+ ++K+ + WEL  HH+ VI+ F  ++ +   +G+ VVALL E+NS FLH R++L++  +    + YR  +++NL T+ +FR   L  +T  + +         +    + M IM  +N +LF  +L++DFL    R+ KK K 
Sbjct:   14 VGFFRLVNTGVSKLPMP----ESARRNAWKWRNISTSFVHSFITAIWAVLCFFLHPQMAEDLIETFSWFSHALVSFSIGYFIYDFLDMVVHQKLSQSWELLFHHIVVITCFGLSVLSNRYLGFAVVALLVEINSVFLHLRQILRMASMASGTL-YRVNSMINLGTYVVFRINTLAWMTRWLVLNRDKVPLLAYTLGSVGMAIMTAMNIVLFCRLLRSDFLKSSTRETKKEKE 240          
BLAST of TLC domain-containing protein vs. Ensembl Medaka
Match: tlcd1 (TLC domain containing 1 [Source:NCBI gene;Acc:101163189])

HSP 1 Score: 110.923 bits (276), Expect = 1.051e-27
Identity = 78/229 (34.06%), Postives = 111/229 (48.47%), Query Frame = 1
Query:  139 IPIFIRSKGKDEIWKWCNLLMSWVHALIVGSWDLLCFYYYPELTDDLVDFKNSFCYYLIVFSTGYFLYDFADMIYNKKVLKMWELTLHHLAVISTFLYNLCTMTCVGYNVVALLCEVNSFFLHSRKLLQLYHVPFRHVGYRCVAVVNLITFAIFRGIALVTITYGMYVE-EKLNDRFYFICLCISMTIMNLLNPILFWIILKNDFLRQFKKPKHIGNGKIVSNGVQNSH 822
            +P  +R       WKW NL +S VH+++  +W L CF   PEL  ++  +     Y L+  STGYF+ D AD+I        WE  LHH  VI  FLY L T   +   V+AL  EVNS  LH R +L+L       + Y     VNLIT+  FR  A   +T+ +      L    YF+    S+ +MN++  I F+ +L+ DF   F +  H        NGV  ++
Sbjct:   35 VPKVVRQDAFRS-WKWKNLSVSMVHSVLTAAWALTCFVVSPELLSNIRSYNTPLSYLLVCISTGYFVQDAADIILTGHAKGSWEFLLHHAVVIWCFLYTLYTHLFIAGAVIALFVEVNSITLHLRLMLKLASAQDSSL-YYVNKFVNLITYVTFRLSAQFYLTWYLTSNYSSLEHSGYFLT---SIMVMNIMILIYFYRLLRADF---FPRKTHFAG----QNGVHRNN 251          
BLAST of TLC domain-containing protein vs. Planmine SMEST
Match: SMESG000026799.1 (SMESG000026799.1)

HSP 1 Score: 583.563 bits (1503), Expect = 0.000e+0
Identity = 284/287 (98.95%), Postives = 285/287 (99.30%), Query Frame = 1
Query:   28 MTNLNESYFLNTKCGIGAMFLVIGYFHVLNRVIGYFFIPIFIRSKGKDEIWKWCNLLMSWVHALIVGSWDLLCFYYYPELTDDLVDFKNSFCYYLIVFSTGYFLYDFADMIYNKKVLKMWELTLHHLAVISTFLYNLCTMTCVGYNVVALLCEVNSFFLHSRKLLQLYHVPFRHVGYRCVAVVNLITFAIFRGIALVTITYGMYVEEKLNDRFYFICLCISMTIMNLLNPILFWIILKNDFLRQFKKPKHIGNGKIVSNGVQNSHLPTQESSDQPNDFEDGDEMKIE 888
            MTNLNESYFLNTKCGIGAMFLVIG FHVLNRVIGYFFIPIFIRSKGKDEIWKWCNLLMSWVHALIVGSWDLLCFYYYPELTDDLVDFKNSFCYYLIVFSTGYFLYDFADMIYNKKVLKMWELTLHHLAVISTFLYNLCTMTCVGYNVVALLCEVNSFFLHSRKLLQLYHVPFRHVGYRCVAVVNLITFAIFRGIALVTITYGMYVEEKLNDRFYFICLCISMTIMNLLNPILFWIILKNDFLRQFKKPKHIGNGKIVSNGVQNSHLPTQE+SDQPNDFED DEMKIE
Sbjct:    1 MTNLNESYFLNTKCGIGAMFLVIGCFHVLNRVIGYFFIPIFIRSKGKDEIWKWCNLLMSWVHALIVGSWDLLCFYYYPELTDDLVDFKNSFCYYLIVFSTGYFLYDFADMIYNKKVLKMWELTLHHLAVISTFLYNLCTMTCVGYNVVALLCEVNSFFLHSRKLLQLYHVPFRHVGYRCVAVVNLITFAIFRGIALVTITYGMYVEEKLNDRFYFICLCISMTIMNLLNPILFWIILKNDFLRQFKKPKHIGNGKIVSNGVQNSHLPTQENSDQPNDFEDVDEMKIE 287          
BLAST of TLC domain-containing protein vs. Planmine SMEST
Match: SMESG000026799.1 (SMESG000026799.1)

HSP 1 Score: 545.428 bits (1404), Expect = 0.000e+0
Identity = 266/269 (98.88%), Postives = 267/269 (99.26%), Query Frame = 1
Query:   82 MFLVIGYFHVLNRVIGYFFIPIFIRSKGKDEIWKWCNLLMSWVHALIVGSWDLLCFYYYPELTDDLVDFKNSFCYYLIVFSTGYFLYDFADMIYNKKVLKMWELTLHHLAVISTFLYNLCTMTCVGYNVVALLCEVNSFFLHSRKLLQLYHVPFRHVGYRCVAVVNLITFAIFRGIALVTITYGMYVEEKLNDRFYFICLCISMTIMNLLNPILFWIILKNDFLRQFKKPKHIGNGKIVSNGVQNSHLPTQESSDQPNDFEDGDEMKIE 888
            MFLVIG FHVLNRVIGYFFIPIFIRSKGKDEIWKWCNLLMSWVHALIVGSWDLLCFYYYPELTDDLVDFKNSFCYYLIVFSTGYFLYDFADMIYNKKVLKMWELTLHHLAVISTFLYNLCTMTCVGYNVVALLCEVNSFFLHSRKLLQLYHVPFRHVGYRCVAVVNLITFAIFRGIALVTITYGMYVEEKLNDRFYFICLCISMTIMNLLNPILFWIILKNDFLRQFKKPKHIGNGKIVSNGVQNSHLPTQE+SDQPNDFED DEMKIE
Sbjct:    1 MFLVIGCFHVLNRVIGYFFIPIFIRSKGKDEIWKWCNLLMSWVHALIVGSWDLLCFYYYPELTDDLVDFKNSFCYYLIVFSTGYFLYDFADMIYNKKVLKMWELTLHHLAVISTFLYNLCTMTCVGYNVVALLCEVNSFFLHSRKLLQLYHVPFRHVGYRCVAVVNLITFAIFRGIALVTITYGMYVEEKLNDRFYFICLCISMTIMNLLNPILFWIILKNDFLRQFKKPKHIGNGKIVSNGVQNSHLPTQENSDQPNDFEDVDEMKIE 269          
BLAST of TLC domain-containing protein vs. Planmine SMEST
Match: SMESG000046759.1 (SMESG000046759.1)

HSP 1 Score: 256.914 bits (655), Expect = 3.396e-83
Identity = 134/255 (52.55%), Postives = 177/255 (69.41%), Query Frame = 1
Query:   55 LNTKCGIGAMFLVIGYFHVLNRVI-GYFFIPIFIRSKGKDEIWKWCNLLMSWVHALIVGSWDLLCFYYYPELTDDLVDFKNSFCYYLIVFSTGYFLYDFADMIYNKKVLKMWELTLHHLAVISTFLYNLCTMTCVGYNVVALLCEVNSFFLHSRKLLQLYHVPFRHVGYRCVAVVNLITFAIFRGIALVTITYGMYVEEKLNDRFYFICLCISMTIMNLLNPILFWIILKNDFLRQFKKPKHIGNGKIVSNGVQN 816
            L  + G+ ++FL I +F  ++++I  +   P  I + G +EI KW NL++SW HALI+  WDLLC   YPEL +DL++F N F Y+L+ FSTGYFLYDF DM  N+K+L MWELTLHHLAVIS F YN  T+ C+GYN+VALL EVNSFFLHSRKLLQ++ V F    YR  A  N+ITF +FRG +L  I+YGMY E     R+YFI LC SM +MN++N + F +++K+DFLR  KK K  G  + +S+   N
Sbjct:    6 LEVRTGLVSIFLTILFFRKVHQLICAHLNPPKVISNCGSEEITKWHNLIVSWFHALIILFWDLLCLIIYPELNNDLIEFINPFSYFLVAFSTGYFLYDFIDMAINRKLLTMWELTLHHLAVISMFFYNTVTLRCIGYNIVALLAEVNSFFLHSRKLLQMHRVSFDSRIYRVNAWANIITFFLFRGYSLGRISYGMYTEPHRVSRWYFITLCCSMFVMNVMNIVFFGLLIKSDFLR--KKQKIPGLQRRISDDKLN 258          
BLAST of TLC domain-containing protein vs. Planmine SMEST
Match: SMESG000060101.1 (SMESG000060101.1)

HSP 1 Score: 128.642 bits (322), Expect = 2.532e-34
Identity = 78/245 (31.84%), Postives = 130/245 (53.06%), Query Frame = 1
Query:   73 IGAMFLVIGYFHVLNRVIGYFFIPIFIRSKGKDE---------IWKWCNLLMSWVHALIVGSWDLLCFYYYPELTDDLVDFKNSFCYYLIVFSTGYFLYDFADMIYNKKVLKMWELTLHHLAVISTFLYNLCTMTCVGYNVVALLCEVNSFFLHSRKLLQLYHVPFRHVGYRCVAVVNLITFAIFRGIALVTITYGMYVEEKLNDRFYFICLCISMTIMNLLNPILFWIILKNDFLRQFKKPKHI 780
            IG + L    F+V+N++I YF  P  +     +E          WK+ N+L S  H+++ G++ LLCFY   ++  DL++   + C  L+ FS GYF++D  DMI N    + +EL +HH  +   F  ++ +   +GY +VALL EVNS FLH R+LL           YR   ++N+ +F +FR + L  +T  + +        Y+    + M I+ L+N ILF+ I+ +DF++   + + I
Sbjct:    3 IGTICLSFLMFYVVNQIINYFGPPQMLIKANSNEKHKMSKSKRFWKYKNVLGSLFHSILSGTFALLCFYQNEDIRSDLINTYTTGCLILVSFSLGYFIHDAFDMIKNSSEQQSYELVIHHSIIFVCFGISVFSRLFIGYALVALLVEVNSIFLHMRQLLGFLGFNKSDCKYRINNILNIGSFLVFRMLTLAWMTRWLVMNRSNVSFGYYTIGSVGMAIITLMNIILFYRIIYSDFIKSVSRQRRI 247          
BLAST of TLC domain-containing protein vs. Planmine SMEST
Match: SMESG000060101.1 (SMESG000060101.1)

HSP 1 Score: 128.257 bits (321), Expect = 2.907e-34
Identity = 78/245 (31.84%), Postives = 130/245 (53.06%), Query Frame = 1
Query:   73 IGAMFLVIGYFHVLNRVIGYFFIPIFIRSKGKDE---------IWKWCNLLMSWVHALIVGSWDLLCFYYYPELTDDLVDFKNSFCYYLIVFSTGYFLYDFADMIYNKKVLKMWELTLHHLAVISTFLYNLCTMTCVGYNVVALLCEVNSFFLHSRKLLQLYHVPFRHVGYRCVAVVNLITFAIFRGIALVTITYGMYVEEKLNDRFYFICLCISMTIMNLLNPILFWIILKNDFLRQFKKPKHI 780
            IG + L    F+V+N++I YF  P  +     +E          WK+ N+L S  H+++ G++ LLCFY   ++  DL++   + C  L+ FS GYF++D  DMI N    + +EL +HH  +   F  ++ +   +GY +VALL EVNS FLH R+LL           YR   ++N+ +F +FR + L  +T  + +        Y+    + M I+ L+N ILF+ I+ +DF++   + + I
Sbjct:    7 IGTICLSFLMFYVVNQIINYFGPPQMLIKANSNEKHKMSKSKRFWKYKNVLGSLFHSILSGTFALLCFYQNEDIRSDLINTYTTGCLILVSFSLGYFIHDAFDMIKNSSEQQSYELVIHHSIIFVCFGISVFSRLFIGYALVALLVEVNSIFLHMRQLLGFLGFNKSDCKYRINNILNIGSFLVFRMLTLAWMTRWLVMNRSNVSFGYYTIGSVGMAIITLMNIILFYRIIYSDFIKSVSRQRRI 251          
The following BLAST results are available for this feature:
BLAST of TLC domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TLCD17.433e-2226.52TLC domain containing 1 [Source:HGNC Symbol;Acc:HG... [more]
TLCD26.847e-2126.89TLC domain containing 2 [Source:HGNC Symbol;Acc:HG... [more]
TLCD26.847e-2126.89TLC domain containing 2 [Source:HGNC Symbol;Acc:HG... [more]
TLCD12.722e-1224.55TLC domain containing 1 [Source:HGNC Symbol;Acc:HG... [more]
TLCD14.811e-1032.00TLC domain containing 1 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of TLC domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Y63D3A.81.037e-2329.57pep chromosome:WBcel235:I:14114194:14118650:1 gene... [more]
K12H6.66.132e-2028.63pep chromosome:WBcel235:II:2828594:2831233:-1 gene... [more]
F41H10.54.591e-1531.58pep chromosome:WBcel235:IV:5360891:5362161:1 gene:... [more]
M02B1.37.377e-932.43pep chromosome:WBcel235:IV:12836510:12840674:1 gen... [more]
M02B1.37.377e-932.43pep chromosome:WBcel235:IV:12836510:12840411:1 gen... [more]
back to top
BLAST of TLC domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TLC domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tlcd24.504e-4435.14TLC domain containing 2 [Source:NCBI gene;Acc:5594... [more]
tlcd15.455e-3335.29TLC domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of TLC domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
TLCD21.209e-4236.75TLC domain containing 2 [Source:NCBI gene;Acc:1004... [more]
back to top
BLAST of TLC domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tlcd11.080e-1928.57TLC domain containing 1 [Source:MGI Symbol;Acc:MGI... [more]
Tlcd11.208e-1929.34TLC domain containing 1 [Source:MGI Symbol;Acc:MGI... [more]
Tlcd29.146e-1629.51TLC domain containing 2 [Source:MGI Symbol;Acc:MGI... [more]
Tlcd22.103e-1532.14TLC domain containing 2 [Source:MGI Symbol;Acc:MGI... [more]
Tlcd12.265e-1532.69TLC domain containing 1 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of TLC domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A8WGS4|TLCD2_DANRE3.400e-4335.14TLC domain-containing protein 2 OS=Danio rerio OX=... [more]
sp|G5EF48|FLD1_CAEEL1.319e-2229.57TLC domain-containing protein fld-1 OS=Caenorhabdi... [more]
sp|F1NZP5|TLCD1_CHICK7.958e-2230.77TLC domain-containing protein 1 OS=Gallus gallus O... [more]
sp|Q96CP7|TLCD1_HUMAN3.570e-2126.52TLC domain-containing protein 1 OS=Homo sapiens OX... [more]
sp|A6NGC4|TLCD2_HUMAN3.288e-2026.89TLC domain-containing protein 2 OS=Homo sapiens OX... [more]
back to top
BLAST of TLC domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8JCR12.417e-8549.64TLC domain-containing protein OS=Macrostomum ligna... [more]
A0A267DGA22.782e-8549.64TLC domain-containing protein OS=Macrostomum ligna... [more]
A0A267GUP41.475e-8449.29TLC domain-containing protein OS=Macrostomum ligna... [more]
A0A2H1CD967.846e-8452.27Putative transmembrane protein 56 OS=Fasciola hepa... [more]
A0A074ZIG28.653e-8453.72TLC domain-containing protein OS=Opisthorchis vive... [more]
back to top
BLAST of TLC domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tlcd21.572e-4434.82TLC domain-containing protein 2 [Source:NCBI gene;... [more]
tlcd11.253e-2736.27TLC domain containing 1 [Source:NCBI gene;Acc:1030... [more]
TLCD14.473e-2631.30calfacilitin-like [Source:NCBI gene;Acc:103023685][more]
back to top
BLAST of TLC domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tlcd15.924e-2035.14TLC domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of TLC domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TLC domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO351961.370e-2334.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TLC domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tlcd23.309e-4033.19TLC domain containing 2 [Source:NCBI gene;Acc:1011... [more]
tlcd11.051e-2734.06TLC domain containing 1 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of TLC domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026799.10.000e+098.95SMESG000026799.1[more]
SMESG000026799.10.000e+098.88SMESG000026799.1[more]
SMESG000046759.13.396e-8352.55SMESG000046759.1[more]
SMESG000060101.12.532e-3431.84SMESG000060101.1[more]
SMESG000060101.12.907e-3431.84SMESG000060101.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035772 ID=SMED30035772|Name=TLC domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1214bp
AATTTAAAAAACTTTGAAAATTTTTAAATGACTAATTTAAATGAGTCTTA
CTTTTTAAACACAAAATGCGGAATCGGAGCTATGTTCCTAGTGATAGGGT
ATTTCCACGTTTTGAATCGTGTTATCGGGTATTTTTTTATTCCGATTTTT
ATCAGATCTAAAGGAAAAGACGAGATTTGGAAATGGTGTAATTTGCTTAT
GTCTTGGGTACATGCTTTGATTGTTGGCAGTTGGGATCTATTATGCTTCT
ATTATTATCCCGAATTGACAGATGATTTGGTCGACTTTAAAAACTCATTC
TGCTACTATCTAATTGTGTTTTCTACCGGATATTTTCTCTACGACTTCGC
TGACATGATTTATAACAAGAAAGTTCTGAAAATGTGGGAGCTGACGTTGC
ATCATTTAGCGGTTATTTCGACATTTCTTTATAATCTATGCACGATGACC
TGTGTGGGATACAATGTTGTAGCTCTTCTTTGCGAAGTGAACAGTTTCTT
TCTTCATTCTCGCAAACTGCTGCAACTATACCATGTGCCTTTTAGACATG
TAGGGTATCGCTGTGTTGCGGTGGTCAATTTAATTACGTTCGCGATTTTC
CGGGGAATCGCCTTGGTAACCATTACCTATGGAATGTATGTTGAAGAAAA
GCTAAATGATAGATTCTATTTTATTTGCCTATGCATCAGCATGACCATTA
TGAACCTACTCAATCCGATCTTGTTTTGGATCATTCTAAAAAATGATTTC
CTCAGACAATTCAAGAAACCAAAACACATTGGAAATGGGAAAATCGTCAG
CAATGGCGTCCAAAATTCCCATTTGCCGACTCAGGAAAGCTCGGATCAAC
CGAATGATTTCGAGGATGGGGACGAGATGAAAATCGAGTGAAACCTTCTG
GAACCAAATCGTGCCTTTATTTACAATATTCTATATATTACTAGCATACG
TAGATTTGCTTTGGACTTTTGTCGATTGAGGAGTTTCTAGTTTCCATATT
TTGTGTATGCTCTGGAGAGATTTATTTTTCTGGATATTTTTTACATGAAC
TGTTTTCGATGTTAATATATACAGGCTTTTGTTTCGATAAAGATTTCCAC
TTTCTATATCTTGATTTATATCGTCAGTTGTGTGAGCAGTCGGCCATGCG
TCGGAGGCAGAATTCGGTTCTGTAAAGCAACTTTTTCACGTGAATAAATT
ATAATGTTGGTTTT
back to top

protein sequence of SMED30035772-orf-1

>SMED30035772-orf-1 ID=SMED30035772-orf-1|Name=SMED30035772-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=288bp
MTNLNESYFLNTKCGIGAMFLVIGYFHVLNRVIGYFFIPIFIRSKGKDEI
WKWCNLLMSWVHALIVGSWDLLCFYYYPELTDDLVDFKNSFCYYLIVFST
GYFLYDFADMIYNKKVLKMWELTLHHLAVISTFLYNLCTMTCVGYNVVAL
LCEVNSFFLHSRKLLQLYHVPFRHVGYRCVAVVNLITFAIFRGIALVTIT
YGMYVEEKLNDRFYFICLCISMTIMNLLNPILFWIILKNDFLRQFKKPKH
IGNGKIVSNGVQNSHLPTQESSDQPNDFEDGDEMKIE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR006634TLC-dom
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006634TRAM/LAG1/CLN8 homology domainSMARTSM00724lag1_27coord: 48..245
e-value: 2.7E-15
score: 66.8
IPR006634TRAM/LAG1/CLN8 homology domainPFAMPF03798TRAM_LAG1_CLN8coord: 52..238
e-value: 3.6E-17
score: 62.7
IPR006634TRAM/LAG1/CLN8 homology domainPROSITEPS50922TLCcoord: 48..242
score: 20.198
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 265..287
NoneNo IPR availablePANTHERPTHR13439:SF4F8K7.23coord: 22..246
NoneNo IPR availablePANTHERPTHR13439CT120 PROTEINcoord: 22..246
NoneNo IPR availableTMHMMTMhelixcoord: 214..236
NoneNo IPR availableTMHMMTMhelixcoord: 182..204
NoneNo IPR availableTMHMMTMhelixcoord: 90..112
NoneNo IPR availableTMHMMTMhelixcoord: 57..77
NoneNo IPR availableTMHMMTMhelixcoord: 20..42
NoneNo IPR availableTMHMMTMhelixcoord: 127..149