SMED30035770

Overview
NameSMED30035770
Smed IDSMED30035770
Length (bp)1687
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30035770 (SMED30035770) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30035770 (SMED30035770) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30035770 (SMED30035770) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30035770 (SMED30035770) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035770

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30035770SMESG000038834.1 Contig4464newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035770SMESG000038834.1 Contig4464uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035770SMESG000049854.1 Contig4464newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035770SMESG000049854.1 Contig4464uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30035770 vs. Planmine SMEST
Match: SMESG000046455.1 (SMESG000046455.1)

HSP 1 Score: 154.836 bits (390), Expect = 4.389e-78
Identity = 88/123 (71.54%), Postives = 103/123 (83.74%), Query Frame = -1
Query:  707 KKSIDKNSEKLINLINKLKIESTFPQEI*FMVGKVSKIDKVNDSELLKTESKSDIMFNXXXXXXXXXFQHDDLLISLLCQPKSSEKLVDIIFHSNYLNLKGNLNPLSNVTNKSYVQNYIVNCL 1075
            KKSID+N EKLINLINK KIE TFPQ+I F+ GK  KIDK+NDS+  + ES+SDIMFNLGLFSL GL ++D++L SLLCQPKS EKLVDIIFH NYLNLKGN +  +N T ++YVQNYIVNCL
Sbjct:  831 KKSIDENPEKLINLINKFKIEETFPQQISFVGGKFVKIDKLNDSQFPQVESESDIMFNLGLFSLFGLSEYDNILNSLLCQPKSPEKLVDIIFHLNYLNLKGNFDTSTNGTYENYVQNYIVNCL 953          

HSP 2 Score: 84.7297 bits (208), Expect = 4.389e-78
Identity = 44/78 (56.41%), Postives = 57/78 (73.08%), Query Frame = -2
Query: 1066 QINNTLNLLKKQR------VKSQIKYLDGDFFMLDLLSNYEVEGNVDEKVTELSSSQVTDLYNSFLEIHELFFIEKKA 1281
            QIN  + LLK +       VKSQI Y DGDF MLDLL+++E+EG + + +TELS SQ+ +L+NSF EI ELFFIEKK+
Sbjct:  756 QINKIITLLKIKNSLPDYLVKSQINYKDGDFLMLDLLNSFEIEGELGQNITELSRSQIKELFNSFPEIQELFFIEKKS 833          

HSP 3 Score: 46.595 bits (109), Expect = 4.389e-78
Identity = 25/54 (46.30%), Postives = 35/54 (64.81%), Query Frame = -1
Query:  386 GENDRLNNIISPETIRQINDFFNEIDSVYPQNAIQSKALLNLSNNINDIKPESD 547
            GE DR++NII PETI +IN+F   ID  Y   + Q K L +L   IN+I+ ++D
Sbjct: 1007 GEIDRIHNIICPETIIEINNFLGVIDQSYTTKSDQLKFLTSLGEKINNIEIDND 1060          

HSP 4 Score: 44.2838 bits (103), Expect = 4.389e-78
Identity = 27/50 (54.00%), Postives = 34/50 (68.00%), Query Frame = -3
Query: 1290 KASIID*NIVKYYNN*PSFNRASIAIKKFLFVLSSKFSDTTTISNSKIRR 1439
            K S+I+  IVK YN    F  AS++IKKFLFVLS K ++TT ISN  +R 
Sbjct:  706 KTSLINSKIVKNYNT-NKFIPASLSIKKFLFVLSDKLAETTNISNVTVRE 754          

HSP 5 Score: 43.5134 bits (101), Expect = 4.389e-78
Identity = 24/40 (60.00%), Postives = 32/40 (80.00%), Query Frame = -2
Query:  586 IMHSIMTVENYVSLNIDDIELWAPKVIDMIXXXXXXXXSC 705
            +MHSI+ +E    LN+D+IELWAPK+I++I SSS YS SC
Sbjct:  954 LMHSILDLETCAFLNLDNIELWAPKLIELIPSSSDYSSSC 993          
BLAST of SMED30035770 vs. Planmine SMEST
Match: SMESG000046455.1 (SMESG000046455.1)

HSP 1 Score: 154.836 bits (390), Expect = 4.406e-77
Identity = 88/123 (71.54%), Postives = 103/123 (83.74%), Query Frame = -1
Query:  707 KKSIDKNSEKLINLINKLKIESTFPQEI*FMVGKVSKIDKVNDSELLKTESKSDIMFNXXXXXXXXXFQHDDLLISLLCQPKSSEKLVDIIFHSNYLNLKGNLNPLSNVTNKSYVQNYIVNCL 1075
            KKSID+N EKLINLINK KIE TFPQ+I F+ GK  KIDK+NDS+  + ES+SDIMFNLGLFSL GL ++D++L SLLCQPKS EKLVDIIFH NYLNLKGN +  +N T ++YVQNYIVNCL
Sbjct:  831 KKSIDENPEKLINLINKFKIEETFPQQISFVGGKFVKIDKLNDSQFPQVESESDIMFNLGLFSLFGLSEYDNILNSLLCQPKSPEKLVDIIFHLNYLNLKGNFDTSTNGTYENYVQNYIVNCL 953          

HSP 2 Score: 84.7297 bits (208), Expect = 4.406e-77
Identity = 44/78 (56.41%), Postives = 57/78 (73.08%), Query Frame = -2
Query: 1066 QINNTLNLLKKQR------VKSQIKYLDGDFFMLDLLSNYEVEGNVDEKVTELSSSQVTDLYNSFLEIHELFFIEKKA 1281
            QIN  + LLK +       VKSQI Y DGDF MLDLL+++E+EG + + +TELS SQ+ +L+NSF EI ELFFIEKK+
Sbjct:  756 QINKIITLLKIKNSLPDYLVKSQINYKDGDFLMLDLLNSFEIEGELGQNITELSRSQIKELFNSFPEIQELFFIEKKS 833          

HSP 3 Score: 44.2838 bits (103), Expect = 4.406e-77
Identity = 27/50 (54.00%), Postives = 34/50 (68.00%), Query Frame = -3
Query: 1290 KASIID*NIVKYYNN*PSFNRASIAIKKFLFVLSSKFSDTTTISNSKIRR 1439
            K S+I+  IVK YN    F  AS++IKKFLFVLS K ++TT ISN  +R 
Sbjct:  706 KTSLINSKIVKNYNT-NKFIPASLSIKKFLFVLSDKLAETTNISNVTVRE 754          

HSP 4 Score: 43.5134 bits (101), Expect = 4.406e-77
Identity = 24/40 (60.00%), Postives = 32/40 (80.00%), Query Frame = -2
Query:  586 IMHSIMTVENYVSLNIDDIELWAPKVIDMIXXXXXXXXSC 705
            +MHSI+ +E    LN+D+IELWAPK+I++I SSS YS SC
Sbjct:  954 LMHSILDLETCAFLNLDNIELWAPKLIELIPSSSDYSSSC 993          

HSP 5 Score: 43.1282 bits (100), Expect = 4.406e-77
Identity = 26/59 (44.07%), Postives = 33/59 (55.93%), Query Frame = -1
Query:  386 GENDRLNNIISPETIRQINDFFNEIDSVYPQNAIQSKALLNLSNN-----INDIKPESD 547
            GE DR++NII PETI +IN+F   ID  Y   + Q K L +L  +     IN   PE D
Sbjct: 1007 GEIDRIHNIICPETIIEINNFLGVIDQSYTTKSDQLKFLTSLETDADSTIINYFFPERD 1065          
BLAST of SMED30035770 vs. Planmine SMEST
Match: SMESG000021486.1 (SMESG000021486.1)

HSP 1 Score: 103.605 bits (257), Expect = 2.038e-74
Identity = 60/119 (50.42%), Postives = 78/119 (65.55%), Query Frame = -1
Query:  707 DKNSEKLINLINKLKIESTFPQEI*FMVGKVSKIDKVNDSELLKTESKSDIMFNXXXXXXXXXFQHDDLLISLLCQPKSSEKLVDIIFHSNYLNLKGNLNPLSNVTNKSYVQNYIVNCL 1063
            D N++K  NLIN LK E  FP++I F+ GK  K+++  DS+  + E +SDIMFN+GL +   +   D  L SL  QPKSSEK++DIIFH NYL LKG L   SN +   YV NY+ NCL
Sbjct: 4338 DCNTDKFKNLINNLKSEHGFPEQISFVGGKFIKLNETKDSDHSQAEGESDIMFNIGLLNFHEMCLKDTTLRSLFSQPKSSEKIIDIIFHLNYLQLKGELKHTSNGSYGDYVCNYVRNCL 4456          

HSP 2 Score: 97.0561 bits (240), Expect = 2.038e-74
Identity = 66/168 (39.29%), Postives = 93/168 (55.36%), Query Frame = -2
Query:  244 MHSIMTVENYVSLNIDDIELWAPKVIDMIXXXXXXXXSCKERLLTLQQWRLSGKM------IGSIT*FHLKQ*DKSTTFLTK*IVSTRKMLSKVKPF*T*ATTSMTSNLSQMARRLRKQRDS---------YFFVIRDKKKYLLVDKISYRVPLNCRKICTPTMAKHV 702
            ++SI  +E Y +L++DDIE WAP ++ MI   SY+S SCKERLL L+QW+LS ++      I   T  H+       +FL++        + KV P       ++  NLS     ++ + D           FFVIRDKKK+LL  K SYR+PL+CRKICT  M  H+
Sbjct: 4458 LYSISDIETYNTLSLDDIEKWAPSLVKMIPPLSYHSSSCKERLLRLRQWKLSSEIDRLHNIISPETIKHI------NSFLSE--------IDKVYPQKATQLKAL-QNLSNNINAIKSESDDETIAKAKRFLFFVIRDKKKFLLGSKYSYRIPLHCRKICTTNMTTHI 4610          

HSP 3 Score: 81.6481 bits (200), Expect = 2.038e-74
Identity = 46/78 (58.97%), Postives = 53/78 (67.95%), Query Frame = -2
Query: 1075 GRQINNTLNLLKKQRV------KSQIKYLDGDFFMLDLLSNYEVE-GNVDEKVTELSSSQVTDLYNSFLEIHELFFIE 1287
            G QINNTLNLLKKQR       KS IKY DGDF MLDLLS+ ++  GN     +ELS SQ+ DL+ SF E+ ELFF E
Sbjct: 4259 GEQINNTLNLLKKQRALPDYLMKSHIKYHDGDFVMLDLLSDSDLNVGNATLSSSELSRSQMRDLFKSFPELAELFFSE 4336          

HSP 4 Score: 59.3066 bits (142), Expect = 2.038e-74
Identity = 33/54 (61.11%), Postives = 40/54 (74.07%), Query Frame = -3
Query: 1293 KKSSPKASIID*NIVKYYNN*PSFNRASIAIKKFLFVLSSKFSDTTTISNSKIR 1454
            KK+  K SIID NI+  YNN   F  AS AIK+FLFVLS+K S+T TISN+K+R
Sbjct: 4205 KKTILKTSIIDSNIITSYNNRLKFTGASTAIKRFLFVLSNKLSETATISNAKVR 4258          

HSP 5 Score: 103.605 bits (257), Expect = 1.464e-67
Identity = 60/119 (50.42%), Postives = 78/119 (65.55%), Query Frame = -1
Query:  707 DKNSEKLINLINKLKIESTFPQEI*FMVGKVSKIDKVNDSELLKTESKSDIMFNXXXXXXXXXFQHDDLLISLLCQPKSSEKLVDIIFHSNYLNLKGNLNPLSNVTNKSYVQNYIVNCL 1063
            D N++K  NLIN LK E  FP++I F+ GK  K+++  DS+  + E +SDIMFN+GL +   +   D  L SL  QPKSSEK++DIIFH NYL LKG L   SN +   YV NY+ NCL
Sbjct: 1989 DCNTDKFKNLINNLKSEHGFPEQISFVGGKFIKLNETKDSDHSQAEGESDIMFNIGLLNFHEMCLKDTTLRSLFSQPKSSEKIIDIIFHLNYLQLKGELKHTSNGSYGDYVCNYVRNCL 2107          

HSP 6 Score: 97.0561 bits (240), Expect = 1.464e-67
Identity = 66/168 (39.29%), Postives = 93/168 (55.36%), Query Frame = -2
Query:  244 MHSIMTVENYVSLNIDDIELWAPKVIDMIXXXXXXXXSCKERLLTLQQWRLSGKM------IGSIT*FHLKQ*DKSTTFLTK*IVSTRKMLSKVKPF*T*ATTSMTSNLSQMARRLRKQRDS---------YFFVIRDKKKYLLVDKISYRVPLNCRKICTPTMAKHV 702
            ++SI  +E Y +L++DDIE WAP ++ MI   SY+S SCKERLL L+QW+LS ++      I   T  H+       +FL++        + KV P       ++  NLS     ++ + D           FFVIRDKKK+LL  K SYR+PL+CRKICT  M  H+
Sbjct: 2109 LYSISDIETYNTLSLDDIEKWAPSLVKMIPPLSYHSSSCKERLLRLRQWKLSSEIDRLHNIISPETIKHI------NSFLSE--------IDKVYPQKATQLKAL-QNLSNNINAIKSESDDETIAKAKRFLFFVIRDKKKFLLGSKYSYRIPLHCRKICTTNMTTHI 2261          

HSP 7 Score: 60.4622 bits (145), Expect = 1.464e-67
Identity = 32/57 (56.14%), Postives = 40/57 (70.18%), Query Frame = -2
Query: 1075 VKSQIKYLDGDFFMLDLLSNYEVE-GNVDEKVTELSSSQVTDLYNSFLEIHELFFIE 1242
            +KS IKY DGDF MLDLLS+ ++  GN     +ELS SQ+ DL+ SF E+ ELFF E
Sbjct: 1931 MKSHIKYHDGDFVMLDLLSDSDLNVGNATLSSSELSRSQMRDLFKSFPELAELFFSE 1987          

HSP 8 Score: 57.3806 bits (137), Expect = 1.464e-67
Identity = 34/58 (58.62%), Postives = 40/58 (68.97%), Query Frame = -3
Query: 1281 KKSSPKASIID*NIVKYYNN*PSFNRASIAIKKFLFVLSSKFSDTTTISNSKIRRGGD 1454
            KK+  K SIID NI+  YNN   F  AS AIK+FLFVLS+K S+T TISN+K R   D
Sbjct: 1871 KKTILKTSIIDSNIITSYNNRLKFTGASTAIKRFLFVLSNKLSETATISNAKQRALPD 1928          

HSP 9 Score: 93.9745 bits (232), Expect = 1.314e-19
Identity = 48/67 (71.64%), Postives = 51/67 (76.12%), Query Frame = -1
Query:  347 GENDRLNNIISPETIRQINDFFNEIDSVYPQNAIQSKALLNLSNNINDIKPESDGEKTEKAKRFLFF 547
             E DRL+NIISPETI+ IN F +EID VYPQ A Q KAL NLSNNIN IK ESD E   KAKRFLFF
Sbjct: 2161 SEIDRLHNIISPETIKHINSFLSEIDKVYPQKATQLKALQNLSNNINAIKSESDDETIAKAKRFLFF 2227          

HSP 10 Score: 93.9745 bits (232), Expect = 1.314e-19
Identity = 48/67 (71.64%), Postives = 51/67 (76.12%), Query Frame = -1
Query:  347 GENDRLNNIISPETIRQINDFFNEIDSVYPQNAIQSKALLNLSNNINDIKPESDGEKTEKAKRFLFF 547
             E DRL+NIISPETI+ IN F +EID VYPQ A Q KAL NLSNNIN IK ESD E   KAKRFLFF
Sbjct: 4510 SEIDRLHNIISPETIKHINSFLSEIDKVYPQKATQLKALQNLSNNINAIKSESDDETIAKAKRFLFF 4576          
BLAST of SMED30035770 vs. Planmine SMEST
Match: SMESG000021486.1 (SMESG000021486.1)

HSP 1 Score: 103.605 bits (257), Expect = 2.854e-74
Identity = 60/119 (50.42%), Postives = 78/119 (65.55%), Query Frame = -1
Query:  707 DKNSEKLINLINKLKIESTFPQEI*FMVGKVSKIDKVNDSELLKTESKSDIMFNXXXXXXXXXFQHDDLLISLLCQPKSSEKLVDIIFHSNYLNLKGNLNPLSNVTNKSYVQNYIVNCL 1063
            D N++K  NLIN LK E  FP++I F+ GK  K+++  DS+  + E +SDIMFN+GL +   +   D  L SL  QPKSSEK++DIIFH NYL LKG L   SN +   YV NY+ NCL
Sbjct: 4309 DCNTDKFKNLINNLKSEHGFPEQISFVGGKFIKLNETKDSDHSQAEGESDIMFNIGLLNFHEMCLKDTTLRSLFSQPKSSEKIIDIIFHLNYLQLKGELKHTSNGSYGDYVCNYVRNCL 4427          

HSP 2 Score: 96.6709 bits (239), Expect = 2.854e-74
Identity = 66/168 (39.29%), Postives = 93/168 (55.36%), Query Frame = -2
Query:  244 MHSIMTVENYVSLNIDDIELWAPKVIDMIXXXXXXXXSCKERLLTLQQWRLSGKM------IGSIT*FHLKQ*DKSTTFLTK*IVSTRKMLSKVKPF*T*ATTSMTSNLSQMARRLRKQRDS---------YFFVIRDKKKYLLVDKISYRVPLNCRKICTPTMAKHV 702
            ++SI  +E Y +L++DDIE WAP ++ MI   SY+S SCKERLL L+QW+LS ++      I   T  H+       +FL++        + KV P       ++  NLS     ++ + D           FFVIRDKKK+LL  K SYR+PL+CRKICT  M  H+
Sbjct: 4429 LYSISDIETYNTLSLDDIEKWAPSLVKMIPPLSYHSSSCKERLLRLRQWKLSSEIDRLHNIISPETIKHI------NSFLSE--------IDKVYPQKATQLKAL-QNLSNNINAIKSESDDETIAKAKRFLFFVIRDKKKFLLGSKYSYRIPLHCRKICTTNMTTHI 4581          

HSP 3 Score: 81.2629 bits (199), Expect = 2.854e-74
Identity = 46/78 (58.97%), Postives = 53/78 (67.95%), Query Frame = -2
Query: 1075 GRQINNTLNLLKKQRV------KSQIKYLDGDFFMLDLLSNYEVE-GNVDEKVTELSSSQVTDLYNSFLEIHELFFIE 1287
            G QINNTLNLLKKQR       KS IKY DGDF MLDLLS+ ++  GN     +ELS SQ+ DL+ SF E+ ELFF E
Sbjct: 4230 GEQINNTLNLLKKQRALPDYLMKSHIKYHDGDFVMLDLLSDSDLNVGNATLSSSELSRSQMRDLFKSFPELAELFFSE 4307          

HSP 4 Score: 59.3066 bits (142), Expect = 2.854e-74
Identity = 33/54 (61.11%), Postives = 40/54 (74.07%), Query Frame = -3
Query: 1293 KKSSPKASIID*NIVKYYNN*PSFNRASIAIKKFLFVLSSKFSDTTTISNSKIR 1454
            KK+  K SIID NI+  YNN   F  AS AIK+FLFVLS+K S+T TISN+K+R
Sbjct: 4176 KKTILKTSIIDSNIITSYNNRLKFTGASTAIKRFLFVLSNKLSETATISNAKVR 4229          

HSP 5 Score: 103.605 bits (257), Expect = 1.952e-67
Identity = 60/119 (50.42%), Postives = 78/119 (65.55%), Query Frame = -1
Query:  707 DKNSEKLINLINKLKIESTFPQEI*FMVGKVSKIDKVNDSELLKTESKSDIMFNXXXXXXXXXFQHDDLLISLLCQPKSSEKLVDIIFHSNYLNLKGNLNPLSNVTNKSYVQNYIVNCL 1063
            D N++K  NLIN LK E  FP++I F+ GK  K+++  DS+  + E +SDIMFN+GL +   +   D  L SL  QPKSSEK++DIIFH NYL LKG L   SN +   YV NY+ NCL
Sbjct: 1989 DCNTDKFKNLINNLKSEHGFPEQISFVGGKFIKLNETKDSDHSQAEGESDIMFNIGLLNFHEMCLKDTTLRSLFSQPKSSEKIIDIIFHLNYLQLKGELKHTSNGSYGDYVCNYVRNCL 2107          

HSP 6 Score: 96.6709 bits (239), Expect = 1.952e-67
Identity = 66/168 (39.29%), Postives = 93/168 (55.36%), Query Frame = -2
Query:  244 MHSIMTVENYVSLNIDDIELWAPKVIDMIXXXXXXXXSCKERLLTLQQWRLSGKM------IGSIT*FHLKQ*DKSTTFLTK*IVSTRKMLSKVKPF*T*ATTSMTSNLSQMARRLRKQRDS---------YFFVIRDKKKYLLVDKISYRVPLNCRKICTPTMAKHV 702
            ++SI  +E Y +L++DDIE WAP ++ MI   SY+S SCKERLL L+QW+LS ++      I   T  H+       +FL++        + KV P       ++  NLS     ++ + D           FFVIRDKKK+LL  K SYR+PL+CRKICT  M  H+
Sbjct: 2109 LYSISDIETYNTLSLDDIEKWAPSLVKMIPPLSYHSSSCKERLLRLRQWKLSSEIDRLHNIISPETIKHI------NSFLSE--------IDKVYPQKATQLKAL-QNLSNNINAIKSESDDETIAKAKRFLFFVIRDKKKFLLGSKYSYRIPLHCRKICTTNMTTHI 2261          

HSP 7 Score: 60.077 bits (144), Expect = 1.952e-67
Identity = 32/57 (56.14%), Postives = 40/57 (70.18%), Query Frame = -2
Query: 1075 VKSQIKYLDGDFFMLDLLSNYEVE-GNVDEKVTELSSSQVTDLYNSFLEIHELFFIE 1242
            +KS IKY DGDF MLDLLS+ ++  GN     +ELS SQ+ DL+ SF E+ ELFF E
Sbjct: 1931 MKSHIKYHDGDFVMLDLLSDSDLNVGNATLSSSELSRSQMRDLFKSFPELAELFFSE 1987          

HSP 8 Score: 57.3806 bits (137), Expect = 1.952e-67
Identity = 34/58 (58.62%), Postives = 40/58 (68.97%), Query Frame = -3
Query: 1281 KKSSPKASIID*NIVKYYNN*PSFNRASIAIKKFLFVLSSKFSDTTTISNSKIRRGGD 1454
            KK+  K SIID NI+  YNN   F  AS AIK+FLFVLS+K S+T TISN+K R   D
Sbjct: 1871 KKTILKTSIIDSNIITSYNNRLKFTGASTAIKRFLFVLSNKLSETATISNAKQRALPD 1928          

HSP 9 Score: 93.9745 bits (232), Expect = 1.433e-19
Identity = 48/67 (71.64%), Postives = 51/67 (76.12%), Query Frame = -1
Query:  347 GENDRLNNIISPETIRQINDFFNEIDSVYPQNAIQSKALLNLSNNINDIKPESDGEKTEKAKRFLFF 547
             E DRL+NIISPETI+ IN F +EID VYPQ A Q KAL NLSNNIN IK ESD E   KAKRFLFF
Sbjct: 2161 SEIDRLHNIISPETIKHINSFLSEIDKVYPQKATQLKALQNLSNNINAIKSESDDETIAKAKRFLFF 2227          

HSP 10 Score: 93.9745 bits (232), Expect = 1.433e-19
Identity = 48/67 (71.64%), Postives = 51/67 (76.12%), Query Frame = -1
Query:  347 GENDRLNNIISPETIRQINDFFNEIDSVYPQNAIQSKALLNLSNNINDIKPESDGEKTEKAKRFLFF 547
             E DRL+NIISPETI+ IN F +EID VYPQ A Q KAL NLSNNIN IK ESD E   KAKRFLFF
Sbjct: 4481 SEIDRLHNIISPETIKHINSFLSEIDKVYPQKATQLKALQNLSNNINAIKSESDDETIAKAKRFLFF 4547          
BLAST of SMED30035770 vs. Planmine SMEST
Match: SMESG000044750.1 (SMESG000044750.1)

HSP 1 Score: 154.451 bits (389), Expect = 2.736e-64
Identity = 88/123 (71.54%), Postives = 103/123 (83.74%), Query Frame = -1
Query:  707 KKSIDKNSEKLINLINKLKIESTFPQEI*FMVGKVSKIDKVNDSELLKTESKSDIMFNXXXXXXXXXFQHDDLLISLLCQPKSSEKLVDIIFHSNYLNLKGNLNPLSNVTNKSYVQNYIVNCL 1075
            KKSID+N EKLINLINK KIE TFPQ+I F+ GK  KIDK+NDS+  + ES+SDIMFNLGLFSL GL ++D++L SLLCQPKS EKLVDIIFH NYLNLKGN +  +N T ++YVQNYIVNCL
Sbjct:  247 KKSIDENPEKLINLINKFKIEETFPQQISFVGGKFVKIDKLNDSQFPQVESESDIMFNLGLFSLFGLSEYDNILNSLLCQPKSPEKLVDIIFHLNYLNLKGNFDTSTNGTYENYVQNYIVNCL 369          

HSP 2 Score: 73.9442 bits (180), Expect = 2.736e-64
Identity = 33/51 (64.71%), Postives = 44/51 (86.27%), Query Frame = -2
Query: 1066 DGDFFMLDLLSNYEVEGNVDEKVTELSSSQVTDLYNSFLEIHELFFIEKKA 1218
            DGDF MLDLL+++E+EG + +K+TELS SQ+ +L+NSF EI ELFFIEKK+
Sbjct:  199 DGDFLMLDLLNSFEIEGELGQKITELSRSQIKELFNSFPEIQELFFIEKKS 249          

HSP 3 Score: 58.5362 bits (140), Expect = 2.736e-64
Identity = 62/162 (38.27%), Postives = 94/162 (58.02%), Query Frame = -2
Query:  253 IMHSIMTVENYVSLNIDDIELWAPKVIDMIXXXXXXXXSCKERLLTLQQWRLSGKM-----------IGSIT*FHLKQ*DKSTTFLTK*IVSTRKMLSKVKPF*T*ATTSMTSNLSQMARRLRKQRDSYFFVIRDKKKYLLVDKISYRVPLNCRKICTPTMA 705
            +MHSI+ +E    LN+D+IELWAPK+I++I SSS+YS SCKE+LL L+QW+LSG++           I  I  F L   D+S T  +  +     +  K+          + +++  + +    +R  YF +IRDKK++L  D  +Y +P NCRKICT  M+
Sbjct:  370 LMHSILDLETCAFLNLDNIELWAPKLIELIPSSSHYSSSCKEKLLKLKQWKLSGEIDRIHNIICPETIIEINNF-LGVIDQSYTTKSDQLKFLTCLGEKIN------NIEIDNDVDDLVK---AKRMLYF-IIRDKKRFLNKDNFNYHIPFNCRKICTLKMS 520          

HSP 4 Score: 55.4546 bits (132), Expect = 1.026e-7
Identity = 31/67 (46.27%), Postives = 42/67 (62.69%), Query Frame = -1
Query:  347 GENDRLNNIISPETIRQINDFFNEIDSVYPQNAIQSKALLNLSNNINDIKPESDGEKTEKAKRFLFF 547
            GE DR++NII PETI +IN+F   ID  Y   + Q K L  L   IN+I+ ++D +   KAKR L+F
Sbjct:  423 GEIDRIHNIICPETIIEINNFLGVIDQSYTTKSDQLKFLTCLGEKINNIEIDNDVDDLVKAKRMLYF 489          
The following BLAST results are available for this feature:
BLAST of SMED30035770 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035770 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035770 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035770 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035770 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035770 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035770 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035770 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035770 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035770 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035770 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035770 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035770 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035770 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046455.14.389e-7871.54SMESG000046455.1[more]
SMESG000046455.14.406e-7771.54SMESG000046455.1[more]
SMESG000021486.12.038e-7450.42SMESG000021486.1[more]
SMESG000021486.12.854e-7450.42SMESG000021486.1[more]
SMESG000044750.12.736e-6471.54SMESG000044750.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035770 ID=SMED30035770|Name=SMED30035770|organism=Schmidtea mediterranea sexual|type=transcript|length=1687bp
TATATATGAATGTTTTATATAACTGTTTGAAATGGTTCAATAATTGTTTT
AACGCAATTTTTGATAATTAAAAAAACTCCCACTTACGCGTTTTAATAAG
CGGTTTCTAGATTCGCCTCTACCTTGTAGCTTTTACTCTAATTTGTATTT
TTAATTATATTTTAATAGTTATGATCTGCCTGCTATCTATCTGTTCACTG
TTATACACAGTTATAGTTGGAGAAGAGAGTTTATTATGGATGAGACGTGC
TTAGCCATAGTAGGAGTACAAATCTTTCTACAATTCAGTGGAACACGATA
GGAAATTTTATCAACCAACAAATATTTCTTTTTATCCCTAATGACAAAAA
AATAGGAATCTCTTTGCTTTCTCAGTCTTCTCGCCATCTGACTCAGGTTT
GATGTCATTGATGTTGTTGCTCAAGTTCAGAAGGGCTTTACTTTGGATAG
CATTTTGCGGGTAGACACTATCTATTTCGTTAAAAAAGTCGTTGATTTGT
CTTATTGTTTCAGGTGAAATTATGTTATTGAGCCTATCATTTTCCCCGAC
AATCTCCACTGCTGGAGCGTCAAAAGCCTTTCCTTACAGCTCAAACTATA
GTAGGAAGATGAAGAAATCATGTCAATCACTTTAGGAGCCCACAATTCGA
TGTCATCAATATTCAAAGAAACATAGTTCTCAACAGTCATAATTGAATGC
ATAATGCAAACAATTAACAATGTAGTTTTGAACATAGCTTTTGTTAGTTA
CGTTTGATAAAGGATTTAAATTGCCTTTCAAATTTAGGTAATTCGAATGA
AAAATAATATCAACCAGTTTTTCAGAGGACTTTGGTTGACATAAAAGGGA
AATCAGGAGGTCATCGTGTTGGAATAAACCAAGGAGACTAAACAAACCAA
GATTAAACATGATATCAGACTTAGATTCTGTCTTCAGAAGCTCAGAGTCA
TTTACCTTATCAATCTTAGAAACTTTACCCACCATAAATTAGATCTCTTG
AGGGAATGTACTTTCAATTTTCAATTTATTAATTAAATTAATTAATTTTT
CAGAGTTTTTATCTATGCTTTTTTTTCAATGAAAAATAGTTCGTGAATTT
CGAGAAATGAATTATACAAGTCTGTAACTTGTGAGCTGGACAGTTCAGTA
ACTTTTTCATCTACGTTACCTTCAACTTCATAATTACTTAGTAAATCTAG
CATGAAAAAATCACCATCGAGATATTTGATTTGTGATTTCACCCTTTGCT
TTTTTAATAAATTTAGAGTATTATTAATTTGTCTCCCCCCCTCCGAATTT
TACTATTTGATATTGTCGTAGTATCGGAGAACTTGCTTGAGAGGACAAAC
AAAAACTTTTTTATTGCTATCGAAGCACGATTGAAGCTTGGTCAATTATT
GTAATATTTTACAATGTTCTAGTCAATTATAGAGGCTTTAGGACTGGATT
TTTTGTTGAATGAAGATCCAATGTTTGCTGCAAAGTAATAATTATATTAT
TGAAAAAAGTTTCGATTGTTTAAAGAGGATTCATTTATCTGATAATGGTT
ATAATATATTGAAAATGGTGAAATTTATCAATATTGATTTAAAAGTGCGA
TTTTTGTTGTTTTATCGAATGTTTAAGATTTTTGAATAATTGATTTGACA
AAAGTAAAGATTGCCAAGCAATTTAATTTTGTTTCAA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte