FMRFamide-activated amiloride-sensitive sodium channel

Overview
NameFMRFamide-activated amiloride-sensitive sodium channel
Smed IDSMED30035751
Length (bp)1863
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of FMRFamide-activated amiloride-sensitive sodium channel (SMED30035751) t-SNE clustered cells

Violin plots show distribution of expression levels for FMRFamide-activated amiloride-sensitive sodium channel (SMED30035751) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of FMRFamide-activated amiloride-sensitive sodium channel (SMED30035751) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for FMRFamide-activated amiloride-sensitive sodium channel (SMED30035751) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035751

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30035751h1SMcG0018312 SmedASXL_008258SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30035751h1SMcG0018312 dd_Smed_v4_26855_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035751h1SMcG0018312 dd_Smed_v4_26855_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30035751h1SMcG0018312 dd_Smed_v4_26855_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30035751h1SMcG0018312 dd_Smed_v6_26855_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: SCNN1B (sodium channel epithelial 1 beta subunit [Source:HGNC Symbol;Acc:HGNC:10600])

HSP 1 Score: 72.4034 bits (176), Expect = 1.401e-12
Identity = 120/566 (21.20%), Postives = 213/566 (37.63%), Query Frame = 1
Query:  136 KEEFLRFCENTTIRGVPKIIKSKHKPLRYMWMTCFILLLSGFSVCFIFLLKQYFAYDVIHPPRILTNSQAPFPSFTVCNLRP--------LARNIDTIFK--LKNLKTPREFAKNVN---NYAI---------------------KYFYNKNNLT----------LYGHASSIMLMGGYLESVPNKSYVELGHKKQDLIIHCRVTYMIGSKPHSKDCDELGKWRRIIHAQYVNCYMFDLI---ESLSNATNTLEMFLYLDESINQATCIDCFSSDVKSQLSGALILIHRSNTFPNFNRDMINLQPGTLTEIKLKTIHNRHKLPPYGRCS-NKTPKWIKVFGELY--AYSEDLCKLITIQGDLNHFCNCNAIEYPFNYSSLKFCSALPSFSQRVSCNNR--LNDRKCETELKNTVKQISCKAKACLIYNNDIVPSCKLPCSFYSYETDRSTSTWPTKSWQLQWISTKAAKPLLDKQELDNYRYAVKLQEKGNYSEALKILNKENTMEQKILAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLFSIWIGMTLFSIVEIFEMFANCFW 1677
            KE  + +C+NT   G PK I  +    + MW    +L  +     +   ++ Y +++V     +   +   FP+ T+CN  P        L +++D + +  L+ +  P     N     N++I                      +  N N LT           +G   ++ L       VP +  VE+ +  + +I+ C    + G++P    C+    +  I +  Y NCY+F+     ++L +A    E  L L   I Q   +   +S      +G  +++H   ++P    + I    GT T I +     +    PY  C+ N +   ++ F   Y   YS   C     Q  +   CNC    YP           LP   +   CNNR   +   C ++L+ +V Q     + C       +  CK  C+   Y+   S + WP+++ +  WI    +      QE D     + L  KG                  I+ + I    +N   +EE    ++   LS  GG F  W+G ++  ++E  E+  +  W
Sbjct:   23 KELLVWYCDNTNTHG-PKRIICEGPKKKAMWFLLTLLFAALVCWQWGIFIRTYLSWEVSVSLSVGFKTMD-FPAVTICNASPFKYSKIKHLLKDLDELMEAVLERILAPELSHANATRNLNFSIWNHTPLVLIDERNPHHPMVLDLFGDNHNGLTSSSASEKICNAHGCKMAMRLATNIFAQVPQQELVEMSYPGEQMILAC----LFGAEP----CN-YRNFTSIFYPHYGNCYIFNWGMTEKALPSANPGTEFGLKLILDIGQEDYVPFLAST-----AGVRLMLHEQRSYPFIRDEGIYAMSGTETSIGVLVDKLQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNCGHYLYP-----------LPRGEKY--CNNRDFPDWAHCYSDLQMSVAQ----RETC-------IGMCKESCNDTQYKMTISMADWPSEASE-DWIFHVLS------QERDQ-STNITLSRKG------------------IVKLNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIIDFVW 522          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: SCNN1B (sodium channel epithelial 1 beta subunit [Source:HGNC Symbol;Acc:HGNC:10600])

HSP 1 Score: 66.2402 bits (160), Expect = 1.015e-10
Identity = 87/384 (22.66%), Postives = 150/384 (39.06%), Query Frame = 1
Query:  550 VPNKSYVELGHKKQDLIIHCRVTYMIGSKPHSKDCDELGKWRRIIHAQYVNCYMFDLI---ESLSNATNTLEMFLYLDESINQATCIDCFSSDVKSQLSGALILIHRSNTFPNFNRDMINLQPGTLTEIKLKTIHNRHKLPPYGRCS-NKTPKWIKVFGELY--AYSEDLCKLITIQGDLNHFCNCNAIEYPFNYSSLKFCSALPSFSQRVSCNNR--LNDRKCETELKNTVKQISCKAKACLIYNNDIVPSCKLPCSFYSYETDRSTSTWPTKSWQLQWISTKAAKPLLDKQELDNYRYAVKLQEKGNYSEALKILNKENTMEQKILAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLFSIWIGMTLFSIVEIFEMFANCFW 1677
            VP +  VE+ +  + +I+ C    + G++P    C+    +  I +  Y NCY+F+     ++L +A    E  L L   I Q   +   +S      +G  +++H   ++P    + I    GT T I +     +    PY  C+ N +   ++ F   Y   YS   C     Q  +   CNC    YP           LP   +   CNNR   +   C ++L+ +V Q     + C       +  CK  C+   Y+   S + WP+++ +  WI    +      QE D     + L  KG                  I+ + I    +N   +EE    ++   LS  GG F  W+G ++  ++E  E+  +  W
Sbjct:  275 VPQQELVEMSYPGEQMILAC----LFGAEP----CN-YRNFTSIFYPHYGNCYIFNWGMTEKALPSANPGTEFGLKLILDIGQEDYVPFLAST-----AGVRLMLHEQRSYPFIRDEGIYAMSGTETSIGVLVDKLQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNCGHYLYP-----------LPRGEKY--CNNRDFPDWAHCYSDLQMSVAQ----RETC-------IGMCKESCNDTQYKMTISMADWPSEASE-DWIFHVLS------QERDQ-STNITLSRKG------------------IVKLNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIIDFVW 594          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: SCNN1B (sodium channel epithelial 1 beta subunit [Source:HGNC Symbol;Acc:HGNC:10600])

HSP 1 Score: 66.2402 bits (160), Expect = 1.087e-10
Identity = 87/384 (22.66%), Postives = 150/384 (39.06%), Query Frame = 1
Query:  550 VPNKSYVELGHKKQDLIIHCRVTYMIGSKPHSKDCDELGKWRRIIHAQYVNCYMFDLI---ESLSNATNTLEMFLYLDESINQATCIDCFSSDVKSQLSGALILIHRSNTFPNFNRDMINLQPGTLTEIKLKTIHNRHKLPPYGRCS-NKTPKWIKVFGELY--AYSEDLCKLITIQGDLNHFCNCNAIEYPFNYSSLKFCSALPSFSQRVSCNNR--LNDRKCETELKNTVKQISCKAKACLIYNNDIVPSCKLPCSFYSYETDRSTSTWPTKSWQLQWISTKAAKPLLDKQELDNYRYAVKLQEKGNYSEALKILNKENTMEQKILAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLFSIWIGMTLFSIVEIFEMFANCFW 1677
            VP +  VE+ +  + +I+ C    + G++P    C+    +  I +  Y NCY+F+     ++L +A    E  L L   I Q   +   +S      +G  +++H   ++P    + I    GT T I +     +    PY  C+ N +   ++ F   Y   YS   C     Q  +   CNC    YP           LP   +   CNNR   +   C ++L+ +V Q     + C       +  CK  C+   Y+   S + WP+++ +  WI    +      QE D     + L  KG                  I+ + I    +N   +EE    ++   LS  GG F  W+G ++  ++E  E+  +  W
Sbjct:  230 VPQQELVEMSYPGEQMILAC----LFGAEP----CN-YRNFTSIFYPHYGNCYIFNWGMTEKALPSANPGTEFGLKLILDIGQEDYVPFLAST-----AGVRLMLHEQRSYPFIRDEGIYAMSGTETSIGVLVDKLQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNCGHYLYP-----------LPRGEKY--CNNRDFPDWAHCYSDLQMSVAQ----RETC-------IGMCKESCNDTQYKMTISMADWPSEASE-DWIFHVLS------QERDQ-STNITLSRKG------------------IVKLNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIIDFVW 549          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: SCNN1D (sodium channel epithelial 1 delta subunit [Source:HGNC Symbol;Acc:HGNC:10601])

HSP 1 Score: 54.6842 bits (130), Expect = 4.633e-7
Identity = 116/563 (20.60%), Postives = 202/563 (35.88%), Query Frame = 1
Query:  118 EIRQVIKEEFLRFCENTTIRGVPKIIKSKHKPLRYMWMTCFILLLSGFSVCFIFLLKQYFAYDVIHPPRILTNS----QAPFPSFTVCNLRP---------------LAR-NIDTIFKLKNLKTPREFAKNVNNYAIKYFYNKN-NLTLYGHASSIMLMG--------------GYLESVPNKS------YVEL----------GHKKQD--LIIHCRVTYMIGSKPHSKDCDELGKWRRIIHAQYVNCYMFDLIESLSNATNTLEMFLYLDESINQATCIDCFSSDVKSQLSGALILIHRSNTFPNFNRDMINLQPGTLTEIKLKTIHNRHKLPPYGRCSNKTPKWIKVFGELY---AYSEDLCKLITIQGDLNHFCNCNAIEYPFNYSSLKFCSAL--PSFSQRVSCNNRLNDRKCETELKNTVKQISCKAKACLIYNNDIVPSCKLPCSFYSYETDRSTSTWPTKSWQLQWISTKAAKPLLDKQELDNYRYAVKLQEKGNYSEALKILNKENTMEQKILAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLFSIWIGMTL 1632
            E+    +E    FC N TI G  +++ S+   L+    T + LL  G  V   + L   F     H P ++  S    +   P  T+C+  P                AR NID+++ +   K     +  V  +   +  ++   L    H+ S + +G              GY   V          YV++           H  QD   ++ C    +        DC +  ++R   H  Y +CY  D + +      T  + L L   + Q   +   S+     L+G  +++H  N  P       +++PGT   I ++         PYG C+    + ++V  EL    +Y+   C +   Q  +   C+C    +P   +  ++CS+   P++     C  RL  +  ET       ++ C ++            C  PC   +++    TS WP         S K+A   L             L E+G       + ++ +     +  + I     N   VEE  V S+   LS  G L S+W G ++
Sbjct:   51 ELPASFRELLTFFCTNATIHGAIRLVCSRGNRLK---TTSWGLLSLGALVALCWQLGLLFERH-WHRPVLMAVSVHSERKLLPLVTLCDGNPRRPSPVLRHLELLDEFARENIDSLYNVNLSKGRAALSATVPRHEPPFHLDREIRLQRLSHSGSRVRVGFRLCNSTGGDCFYRGYTSGVAAVQDWYHFHYVDILALLPAAWEDSHGSQDGHFVLSCSYDGL--------DC-QARQFRTFHHPTYGSCYTVDGVWTAQRPGITHGVGLVL--RVEQQPHLPLLST-----LAGIRVMVHGRNHTPFLGHHSFSVRPGTEATISIREDEVHRLGSPYGHCTAGG-EGVEV--ELLHNTSYTRQACLVSCFQQLMVETCSCGYYLHPLP-AGAEYCSSARHPAWGH---CFYRLY-QDLETH------RLPCTSR------------CPRPCRESAFKLSTGTSRWP---------SAKSAGWTL-----------ATLGEQG-------LPHQSHRQRSSLAKINIVYQELNYRSVEEAPVYSVPQLLSAMGSLCSLWFGASV 540          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: SCNN1D (sodium channel epithelial 1 delta subunit [Source:HGNC Symbol;Acc:HGNC:10601])

HSP 1 Score: 54.6842 bits (130), Expect = 4.633e-7
Identity = 116/563 (20.60%), Postives = 202/563 (35.88%), Query Frame = 1
Query:  118 EIRQVIKEEFLRFCENTTIRGVPKIIKSKHKPLRYMWMTCFILLLSGFSVCFIFLLKQYFAYDVIHPPRILTNS----QAPFPSFTVCNLRP---------------LAR-NIDTIFKLKNLKTPREFAKNVNNYAIKYFYNKN-NLTLYGHASSIMLMG--------------GYLESVPNKS------YVEL----------GHKKQD--LIIHCRVTYMIGSKPHSKDCDELGKWRRIIHAQYVNCYMFDLIESLSNATNTLEMFLYLDESINQATCIDCFSSDVKSQLSGALILIHRSNTFPNFNRDMINLQPGTLTEIKLKTIHNRHKLPPYGRCSNKTPKWIKVFGELY---AYSEDLCKLITIQGDLNHFCNCNAIEYPFNYSSLKFCSAL--PSFSQRVSCNNRLNDRKCETELKNTVKQISCKAKACLIYNNDIVPSCKLPCSFYSYETDRSTSTWPTKSWQLQWISTKAAKPLLDKQELDNYRYAVKLQEKGNYSEALKILNKENTMEQKILAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLFSIWIGMTL 1632
            E+    +E    FC N TI G  +++ S+   L+    T + LL  G  V   + L   F     H P ++  S    +   P  T+C+  P                AR NID+++ +   K     +  V  +   +  ++   L    H+ S + +G              GY   V          YV++           H  QD   ++ C    +        DC +  ++R   H  Y +CY  D + +      T  + L L   + Q   +   S+     L+G  +++H  N  P       +++PGT   I ++         PYG C+    + ++V  EL    +Y+   C +   Q  +   C+C    +P   +  ++CS+   P++     C  RL  +  ET       ++ C ++            C  PC   +++    TS WP         S K+A   L             L E+G       + ++ +     +  + I     N   VEE  V S+   LS  G L S+W G ++
Sbjct:   51 ELPASFRELLTFFCTNATIHGAIRLVCSRGNRLK---TTSWGLLSLGALVALCWQLGLLFERH-WHRPVLMAVSVHSERKLLPLVTLCDGNPRRPSPVLRHLELLDEFARENIDSLYNVNLSKGRAALSATVPRHEPPFHLDREIRLQRLSHSGSRVRVGFRLCNSTGGDCFYRGYTSGVAAVQDWYHFHYVDILALLPAAWEDSHGSQDGHFVLSCSYDGL--------DC-QARQFRTFHHPTYGSCYTVDGVWTAQRPGITHGVGLVL--RVEQQPHLPLLST-----LAGIRVMVHGRNHTPFLGHHSFSVRPGTEATISIREDEVHRLGSPYGHCTAGG-EGVEV--ELLHNTSYTRQACLVSCFQQLMVETCSCGYYLHPLP-AGAEYCSSARHPAWGH---CFYRLY-QDLETH------RLPCTSR------------CPRPCRESAFKLSTGTSRWP---------SAKSAGWTL-----------ATLGEQG-------LPHQSHRQRSSLAKINIVYQELNYRSVEEAPVYSVPQLLSAMGSLCSLWFGASV 540          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: asic-2 (Degenerin-like protein asic-2 [Source:UniProtKB/Swiss-Prot;Acc:Q22851])

HSP 1 Score: 75.8702 bits (185), Expect = 3.805e-14
Identity = 104/511 (20.35%), Postives = 190/511 (37.18%), Query Frame = 1
Query:  145 FLRFCENTTIRGVPKIIKSKHKPLRYMWMTCFILLLSGFSVCFIFLLKQYFAYDVIHPPRILTNSQAPFPSFTVCNLRPLARNI---DTIFKLKNLKTPREFAKNVNNYAIK----YFYNKNNLTLYGHASSIMLMGGYLESVPNKSYVELGHKKQDLIIHCRVTYMIGSKPHSKDCDELGKWRRIIHAQYVNCYMFDLIESL--SNATNTLEMFLYLDESINQATCIDCFSSDVKSQLSGALILIHRSNTFPNFNRDMINLQPGTLTEIKLKTIHNRHKLPPYGRCSNKTPKWIKVFGELYAYSEDLCKLITIQGDLNHFCNCNAIEYPFNYSSLKFCSALPSFSQRVSCNNRLNDRKCETELKNTVKQISCKAKACLIYNNDIVPSCKLPCSFYSYETDRSTSTWPTKSWQLQWISTKAAKPLLDKQELDNYRYAVKLQEKGNYSEALKILNKENTMEQKILAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLFSIWIGMTLFSIVEI 1650
            F  F   +T+  VP +  + +K  R  W+  F+ +L  F+     L+ ++F+Y       IL   Q  FP  TVCN+ P   ++   ++ F   N          V  ++      Y  N     L   A+  +++   L  + + + V   +   DLI  C    +         C E   + + I   Y  CY F+   SL  S +   ++  L L  ++ Q        S   ++L+GA I ++   + P  + + I+   G  + + +    N     PYG C ++ P     + + + Y+ + C     Q D    C C                     S   +C     D  C   LK    Q S      L+    +  +C  PC   +Y    S + +P+ S+ +   ST             N +++ K       S+  K  N    + Q  L  +      +  L  E    ++++ ++  GG   +W+G+++ S+VE+
Sbjct:   10 FKDFSNWSTVAVVPHVANANNKISRIFWIAIFLFVLGMFAYELYILIAKFFSYPATVNTEILFEKQI-FPVVTVCNMNPYKYSVVKSNSAFSSVNTLMTTYSDATVGTFSTDKWGLYADNDETYDLDSRAADALVLEANL--ISDTAKVPALYTYADLIQDCSFAGI--------PCSE-SDFTKFIDPVYGACYSFNEDASLNYSVSREGIQFGLKLMLTVTQTKTNGNTDSLPTTKLAGARIGVNSRGSSPGLDSNGIDAGVGYESAVSVSLTQNVRAKKPYGTCVDREPDSSDYYKD-FIYTLETCFNGCKQRDTIAKCQCANPRLALG-------------STDTACQPIKADLDCLQTLKG--NQTSSTPNIDLL----VECNCNPPCDESTYTPTVSLAQFPSTSYYVATSSTAGVGSCSST----NSKFSSK-------SDCQKWYNNNGMIIQVFLETL------SYELYTETAGYTVSNVINDLGGQAGLWLGLSVISVVEM 471          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: del-4 (DEgenerin Like [Source:UniProtKB/TrEMBL;Acc:P91835])

HSP 1 Score: 69.3218 bits (168), Expect = 4.246e-12
Identity = 117/530 (22.08%), Postives = 207/530 (39.06%), Query Frame = 1
Query:  133 IKEEFLRFCENTTIRGVPKIIKSKHKPLRYMWMTCFILLLSGFSVCFIFLLKQYFAYDVIHPPRILTNSQAPFPSFTVCNLRPLARNIDTIFKLKNLKT-PREFAKNVNNY----AIKYFYNKNNLTL--YGHASSIMLMGGYLESVPNKSY---VELGHKKQDLIIHCRVTYMIGSKPHSKDCDELGKWRRIIHAQYVNCYMFDLIESLSNATNTLEMFLYLDESINQATCIDCFSSDVKSQLSGALILIHRSNTFPNFNRDMINLQPGTLTEIKLKTIHNRHKLPPYGRCSNKTPKWIKVFGELYAYSEDLCKLITIQGDLNHFCNCNAIEYPFNYSSLKFCSALPSFSQRVSCNN---RLNDRKCETELKNTVKQISCKAKACLIYNNDIVPSCKLPCSFYSYETDRSTSTWPTKSWQLQWISTKAAKPLLDKQELDNYRYAVKLQEKGNYSEALKILNKENTMEQKILAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLFSIWIGMTLFSIVE----IFEMFANC 1671
            +K  F  F   T+  GVP I  +  + LR  W+   ++ ++ F   FI LL  Y ++ V +    L  ++  FP+ T+C+L P        +KL   K+   + +  ++ Y    +   F    +LT      AS   LM  Y E +  K Y    ++ +   D+++ C  TY      ++K C+ +  +    +  Y NC  F+     S++       L +    +Q T +        ++ SG +I IH  +  P  +       PGT + + +  +       PYG C+ KT      +     Y+ + C    +Q  +   C C    Y          S   + +Q VSC+N    L++  C  +L N+           ++ + D    C  PC   SY    ST+ WP+ S+     +        D                    E+     K NT+   ++ +   R N+ V  + E    +  +F+S  GG   +++GM++ S +E    IF +F  C
Sbjct:    8 LKYVFTDFSCWTSTHGVPHIGMANARWLRAFWILVVVVSIALFIWQFITLLTNYLSFSV-NTETTLQFAERTFPTVTICHLNP--------WKLSETKSVDPDMSALIDAYNSDSSSAQFGLPASLTADRQQQASKWTLM--YSERLNEKQYNDAADIAYSYDDMVVSC--TY------NAKTCN-ITDFNDFYNPSYGNCLQFNTDGMYSSSRAGPLYGLRMVMRTDQDTYLP------WTEASGVIIDIHMQDEIPYPDVFGYFAPPGTASSLGVSYVQTTRLSKPYGSCTTKTKLKTTHYTG--TYTVEACFRSCMQEKIIASCGCYYPAY----------SHASNTTQYVSCDNGVQTLSNLNC-VDLINSADSTEFD----VLTDCD----CPQPCEIDSYGVTVSTAQWPSDSYVPTECNPGGPSGPWDAS-----------------GESCLDWYKANTI---LIEIYYERMNFQV--LTESPAYTFVNFISDVGGQVGLFLGMSIISAIEYLVLIFLVFFYC 468          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: unc-8 (Degenerin unc-8 [Source:UniProtKB/Swiss-Prot;Acc:Q21974])

HSP 1 Score: 62.3882 bits (150), Expect = 7.305e-10
Identity = 77/377 (20.42%), Postives = 145/377 (38.46%), Query Frame = 1
Query:  541 LESVPNKSYVELGHKKQDLIIHCRVTYMIGSKPHSKDCDELGKWRRIIHAQYVNCYMFDLIES--LSNATNTLEMFLYLDESINQATCIDCFSSDVKSQLSGALILIHRSNTFPNFNRDMINLQPGTLTEIKLKTIHNRHKLPPYGRCSNKTPKWIKVFGELYAYSEDLCKLITIQGDLNHFCNCNAIEYPFNYSSLKFCSALPSFSQRVSCNNRLN-DRKCETELKNTVKQISCKAKACLIYNNDIVPSCKLPCSFYSYETDRSTSTWPTKSWQLQWISTKAAKPLLDKQELDNYRYAVKLQEKGNYSEALKILNKENTMEQKILAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLFSIWIGMTLFSIVEIFEMF 1662
            + ++P ++   L +   + ++ C          +SKDC     ++  +  +Y NCY F+  +S  L N+       L L  +++Q+  +        ++ +G  +++H  +  P  +    +   G ++   LKT        P+G CS+       ++ E   YS + C     Q  +   C C    +P           LPS   R  CN +   DR+C + L +         + C          C+ PC    +ET  S S WP+++++   I T                    + +  N +EA     ++NT   +I    +N        ++E    +L +  S  GG   +WIG ++ +  E  E+F
Sbjct:  361 VAALPRETRRNLSYTLNEFVLRCSF--------NSKDCSMERDFKLHVDPEYGNCYTFNFNDSVELKNSRAGPMYGLRLLLNVHQSDYMP------TTEAAGVRLVVHEQDQEPFPDTFGYSAPTGFISSFGLKTKELHRLSAPWGNCSDTFRPVPYIYNE--HYSPEGCHRNCFQLKVLEICGCGDPRFP-----------LPSEEHR-HCNAKSKIDRQCLSNLTSDSGGYHHLHEQC---------ECRQPCHEKVFETAYSASAWPSQNFK---IGTDCPA----------------VSDIFNDTEACTEYYRQNTAYIEIYYEQLN-----FESLKETAGYTLVNLFSDFGGNIGLWIGFSVITFAEFAELF 676          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: unc-8 (Degenerin unc-8 [Source:UniProtKB/Swiss-Prot;Acc:Q21974])

HSP 1 Score: 62.3882 bits (150), Expect = 7.757e-10
Identity = 77/377 (20.42%), Postives = 145/377 (38.46%), Query Frame = 1
Query:  541 LESVPNKSYVELGHKKQDLIIHCRVTYMIGSKPHSKDCDELGKWRRIIHAQYVNCYMFDLIES--LSNATNTLEMFLYLDESINQATCIDCFSSDVKSQLSGALILIHRSNTFPNFNRDMINLQPGTLTEIKLKTIHNRHKLPPYGRCSNKTPKWIKVFGELYAYSEDLCKLITIQGDLNHFCNCNAIEYPFNYSSLKFCSALPSFSQRVSCNNRLN-DRKCETELKNTVKQISCKAKACLIYNNDIVPSCKLPCSFYSYETDRSTSTWPTKSWQLQWISTKAAKPLLDKQELDNYRYAVKLQEKGNYSEALKILNKENTMEQKILAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLFSIWIGMTLFSIVEIFEMF 1662
            + ++P ++   L +   + ++ C          +SKDC     ++  +  +Y NCY F+  +S  L N+       L L  +++Q+  +        ++ +G  +++H  +  P  +    +   G ++   LKT        P+G CS+       ++ E   YS + C     Q  +   C C    +P           LPS   R  CN +   DR+C + L +         + C          C+ PC    +ET  S S WP+++++   I T                    + +  N +EA     ++NT   +I    +N        ++E    +L +  S  GG   +WIG ++ +  E  E+F
Sbjct:  402 VAALPRETRRNLSYTLNEFVLRCSF--------NSKDCSMERDFKLHVDPEYGNCYTFNFNDSVELKNSRAGPMYGLRLLLNVHQSDYMP------TTEAAGVRLVVHEQDQEPFPDTFGYSAPTGFISSFGLKTKELHRLSAPWGNCSDTFRPVPYIYNE--HYSPEGCHRNCFQLKVLEICGCGDPRFP-----------LPSEEHR-HCNAKSKIDRQCLSNLTSDSGGYHHLHEQC---------ECRQPCHEKVFETAYSASAWPSQNFK---IGTDCPA----------------VSDIFNDTEACTEYYRQNTAYIEIYYEQLN-----FESLKETAGYTLVNLFSDFGGNIGLWIGFSVITFAEFAELF 717          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: unc-8 (Degenerin unc-8 [Source:UniProtKB/Swiss-Prot;Acc:Q21974])

HSP 1 Score: 62.003 bits (149), Expect = 9.130e-10
Identity = 77/377 (20.42%), Postives = 145/377 (38.46%), Query Frame = 1
Query:  541 LESVPNKSYVELGHKKQDLIIHCRVTYMIGSKPHSKDCDELGKWRRIIHAQYVNCYMFDLIES--LSNATNTLEMFLYLDESINQATCIDCFSSDVKSQLSGALILIHRSNTFPNFNRDMINLQPGTLTEIKLKTIHNRHKLPPYGRCSNKTPKWIKVFGELYAYSEDLCKLITIQGDLNHFCNCNAIEYPFNYSSLKFCSALPSFSQRVSCNNRLN-DRKCETELKNTVKQISCKAKACLIYNNDIVPSCKLPCSFYSYETDRSTSTWPTKSWQLQWISTKAAKPLLDKQELDNYRYAVKLQEKGNYSEALKILNKENTMEQKILAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLFSIWIGMTLFSIVEIFEMF 1662
            + ++P ++   L +   + ++ C          +SKDC     ++  +  +Y NCY F+  +S  L N+       L L  +++Q+  +        ++ +G  +++H  +  P  +    +   G ++   LKT        P+G CS+       ++ E   YS + C     Q  +   C C    +P           LPS   R  CN +   DR+C + L +         + C          C+ PC    +ET  S S WP+++++   I T                    + +  N +EA     ++NT   +I    +N        ++E    +L +  S  GG   +WIG ++ +  E  E+F
Sbjct:  401 VAALPRETRRNLSYTLNEFVLRCSF--------NSKDCSMERDFKLHVDPEYGNCYTFNFNDSVELKNSRAGPMYGLRLLLNVHQSDYMP------TTEAAGVRLVVHEQDQEPFPDTFGYSAPTGFISSFGLKTKELHRLSAPWGNCSDTFRPVPYIYNE--HYSPEGCHRNCFQLKVLEICGCGDPRFP-----------LPSEEHR-HCNAKSKIDRQCLSNLTSDSGGYHHLHEQC---------ECRQPCHEKVFETAYSASAWPSQNFK---IGTDCPA----------------VSDIFNDTEACTEYYRQNTAYIEIYYEQLN-----FESLKETAGYTLVNLFSDFGGNIGLWIGFSVITFAEFAELF 716          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Zebrafish
Match: asic1c (acid-sensing (proton-gated) ion channel 1c [Source:NCBI gene;Acc:407670])

HSP 1 Score: 55.8398 bits (133), Expect = 1.196e-7
Identity = 110/530 (20.75%), Postives = 187/530 (35.28%), Query Frame = 1
Query:  109 SHDEIRQVIKEEFLRFCENTTIRGVPKIIKSKHKPLR-YMWMTCFILLLSGFSVCFIFLLKQYFAYDVIHPPRILTNSQAP---FPSFTVCNLRPLARNIDTIFKLKNLKTPREFAKNVNNYAIKYFYNKNNLTLYGHASSIMLMGGYLESVPNKS--YVELGHKKQDLIIHCRVTYMIGSKPHSKDCDELGKWRRIIHAQYVNCYMFD-------LIESLSNAT-NTLEMFLYLDESINQATCIDCFSSDVKSQLSGALILIHRSNTFPNFNRDMINLQPGTLTEIKLKTIHNRHKLPPYGRCSNKTPKWIKVFGELYAYSEDLCKLITIQGDLNHFCNCNAIEYPFNYSSLKFCSALPSFSQRVSCNNRLNDRKCETELKNTVKQISCKAKACLIYNNDIVPSCKLPCSFYSYETDRSTSTWPTKSWQLQWISTKAAKPLLDKQELDNYRYAVKLQEKGNYSEALKILNKENTMEQKILAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLFSIWIGMTLFSIVEIFE 1656
            S D I  +       F  N+T+ G+  I    H   R ++W   F+  L    + ++ + + Y+ ++  H  + L    AP   FP+ T CNL     +  T   L ++             A  +  +   LTL    +S     G+     N +  Y   GH   ++++ C            ++C  L      I+ +Y  CY F+       L+ +L   T N LE+ L + +        D   +D  S  +G  + IH  +  P  ++    + PG  T +  +     +  PP+G C +  P   + F     YS   C++      L   CNC  +  P         S + +  Q   C +   D   E +                   ND    C  PC+   Y  + S    P+K+         +AK L                       A K    E  +   IL + I     N   +E+K+   +   L   GG   ++IG ++ +I+EIF+
Sbjct:    8 SEDSIESMRPSNLQVFANNSTLHGMSHIFAYGHMTFRRFLWTLSFMGSLG--LLMYVCMDRVYYYFEFPHVTK-LDEVAAPNLTFPAVTFCNLNEFRFSKITKNDLYHVGELLALLNENYQIANPHLADPEVLTLLKEKASF---NGFKPKQFNMTDFYNRTGHDINEMLLQCSF--------RGEECFPLN--FTTIYTRYGKCYTFNSGLDGNPLLTTLKGGTGNGLEIMLDIQQDEYLPVWGD---TDETSYEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVSCQQQLLLYLPPPWGDCRS-APMDSEYFS---TYSITACRIDCETRYLLENCNCRMVHMPGT-------STVCTPEQYKDCADPALDFLVEKD-------------------NDYC-VCDTPCNMTRYGKELSMVKIPSKA---------SAKYL-----------------------AKKFNKTEQYITDNILVLDIFFEALNYEKIEQKKAYEVAGLLGDIGGQMGLFIGASVLTILEIFD 455          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: scnn1b (sodium channel, non voltage gated 1 beta subunit [Source:NCBI gene;Acc:779891])

HSP 1 Score: 77.411 bits (189), Expect = 3.397e-14
Identity = 92/394 (23.35%), Postives = 155/394 (39.34%), Query Frame = 1
Query:  520 IMLMGGYLESVPNKSYVELGHKKQDLIIHCRVTYMIGSKPHSKDCDELGKWRRIIHAQYVNCYMFDLIES----LSNATNTLEMFLYLDESINQATCIDCFSSDVKSQLSGALILIHRSNTFPNFNRDM-INLQPGTLTEIKLKTIHNRHKLPPYGRCS-NKTPKWIK-VFGEL-YAYSEDLCKLITIQGDLNHFCNCNAIEYPFNYSSLKFCSALPSFSQRVSCNNRLNDRKCETELKNTVKQISCKAKACLIYNNDIVPSCKLPCSFYSYETDRSTSTWPTKSWQLQWISTKAAKPLLDKQELDNYRYAVKLQEKGNYSEALKILNKENTMEQKILAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLFSIWIGMTLFSIVEIFEMFANCFW 1677
            ++ +     +VP    + +G K +DLI+ C    + G +P S        + RI  A Y NCY+F+  +     +++A    +  L L   I Q   +    +   ++L     ++H+  +FP F +D+ I   PGT T I +      H   PY  C+ N +   ++ ++ E   +YS   C     Q  +   C C   +YP    S ++CS    +   V C   L D   + E        SC            +  C+ PC+   Y+   S + WP+   Q  WI                  + V   EK   S     +N+       I+ + I    +N   + E E  ++   LS  GG F  W+G ++  I+E  E+  +C W
Sbjct:  238 LLQLSSIFSNVPLADRIAMGFKAEDLILTC----LFGGQPCS-----YRNFTRIYDADYGNCYIFNWGQEGEDPMASANPGADFGLKLVLDIEQGEYLPYVQTTAAARL-----ILHQQRSFP-FVKDLGIYAMPGTETSIAVLVDQLEHMEAPYSSCTVNGSDIPVQNLYAEFNSSYSIQSCLRSCYQEQMVQTCGCADYQYPLPNGS-EYCSN-DKYPDWVPCYYGLRDSVADRE--------SC------------ISLCQQPCNDTQYKMVISMADWPSAGAQ-DWI------------------FHVLSYEKD--SSHNITVNRNG-----IVRLNIYFQEFNYRSITESEATNVVWLLSNLGGQFGFWMGGSVLCIIEFGEIIIDCVW 568          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: lhx1 (LIM homeobox 1 [Source:Xenbase;Acc:XB-GENE-482482])

HSP 1 Score: 62.3882 bits (150), Expect = 5.802e-10
Identity = 62/291 (21.31%), Postives = 128/291 (43.99%), Query Frame = 1
Query:  160 ENTTIRGVPKIIKSKHKPLRYMWMTCFILLLSGFSVCFIF-----LLKQYFAYDVIHPPRILTNSQAPFPSFTVCNLRPLARNIDTIFKLKNLKTPREFAKNVNNYAIKYFYNKN-----NLT--------LYGHASSIMLMGGYLESVPNKSYVELGHKKQDLIIHCRVTYMIGSKPHSKDCDELGKWRRIIHAQYVNCYMFDLIESLS-----------NATNTLEMF-LYLDESINQATCIDCFSSDVKSQLSGALILIHRSNTFPNFNRDMINLQPGTLTEIKLKTI 942
            ++T+  G+P I +SKH   R +W     L+   F++C        ++  Y+ Y       ++++++  FP+ T+CNL  +        +L +L      + ++ +  ++  + +N     N+T        LY  AS+          +P++  +E+GH+ +D++I C          H ++C+    +   I+ ++ NCY F+  +S+            N T    M+ L+L+  I Q      +  D+ +  +G  +L+H     P    + +N+ PG  TEI +  +
Sbjct:   36 QHTSAHGIPNIFRSKHWFRRMVW-----LVFVSFALCCALWQCTQMVLTYYTYPSHEKIMLISSAKLKFPAVTICNLNSV--------RLSSLGRSFSMSNSLQDSGLEMTHRRNRSHHMNVTSDSVDENVLY--ASAFNKFASEFNQLPDEQKIEMGHQLEDMLIFCNF--------HGQECNS-SFFSGFINYKFGNCYTFNSQKSVDIRGNQIRVDPLNITKAGFMYGLHLELFIQQIE----YVRDM-THAAGIRLLVHDQAQMPFPEDEGVNVPPGAETEIGMMKV 297          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: cdh12 (cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase;Acc:XB-GENE-982876])

HSP 1 Score: 63.5438 bits (153), Expect = 6.425e-10
Identity = 85/392 (21.68%), Postives = 154/392 (39.29%), Query Frame = 1
Query:  541 LESVPNKSYVELGHKKQDLIIHCRVTYMIGSKPHSKDCDELGKWRRIIHAQYVNCYMFD-------LIESLSNATNTLEMFLYLDESINQATCIDCFSSDVKSQLSGALILIHRSNTFPNFNRDMINLQPGTLTEIKLKTIHNRHKLPPYGRCSNKTPKWIKVFGELYA--YSEDLCKLITIQGDLNHFCNCNAIEYPFNYSSLKFCSALPSFSQRVSCNNRLNDRKCETELKNTVKQISCKAKACLIYNNDIVPSCKLPCSFYSYETDRSTSTWPT---KSWQLQWISTKAAKPLLDKQELDNYRYAVKLQEKGNYSEALKILNKENTMEQKILAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLFSIWIGMTLFSIVEIFEM-FANCFW 1677
            L  +  +  + +G+K  +LI+ C    +         CD    +    H  Y NCY F+       L+ S+  A   L++ LY+DE        D ++  + S  +GA IL+H  + +P        L+  T T I ++   +     PY  C+      + V   LY+  Y+  +C     Q ++   C C   + P   +  K+C+    +   + C  +L  +  + EL        C++            +C+  CSF  +   RS + WP+   + W L+ +S +                   L EK         LNK N  +  +  + I   + N   + E    ++ + LS  GG   +W+  ++  ++EI E+ F + FW
Sbjct:  249 LAKISMEDKIAMGYKADELIVTCFFDGL--------SCDA-RNFTLFHHPLYGNCYTFNSAERGNLLVSSMGGAEYGLKVVLYIDE--------DEYNPYL-STAAGAKILVHDQDEYPFIEDLGTELETATETSIGMQLTESTKLSDPYSDCTMDGSD-VSV-ENLYSKKYTLQICLNSCFQREMVRTCGCAHYDQPLP-NGAKYCN-YEEYPSWIYCYFKLYKQFVQEEL-------GCQS------------ACRESCSFKEWTLTRSLAKWPSLNSEQWMLRVLSWE-------------------LGEK---------LNK-NLTKNDLANLNIFYQDLNSRSISESPTYNIVTLLSNFGGQLGLWMSCSMICVLEIVEVFFIDSFW 570          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: foxe3 (forkhead box E3 [Source:Xenbase;Acc:XB-GENE-480592])

HSP 1 Score: 62.7734 bits (151), Expect = 1.006e-9
Identity = 70/321 (21.81%), Postives = 116/321 (36.14%), Query Frame = 1
Query:  826 SQLSGALILIHRSNTFPNFNRDMINLQPGTLTEIKLKTIHNRHKLPPYGRCSNKTPKWIKVFGELYAYSEDLCKLITIQGDLNHFCNCNAIEYPFNYSSLKFCSALPSFSQRVSCNNRLNDRKCETELKNTVKQISCKAKACLIYNNDIVPSCKLPCSFYSYETDRSTSTWPTKSWQLQWISTKAAKPLLD---KQELDNYRYAVKLQEKGNYSEALKILNKENTMEQKILAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLFSIWIGMTLFSIVEIFEMFANCFWRFRKMFVKNGFTNDKNQASSLNEKNIILINPNVN 1779
            SQ +GA I+IH  N  P       +++PGT T I +K    RH    YG C++             +Y+   C     Q  +   C C    YP           LP  ++  + N       C  +L   +          L + +     C + C+   Y+    T+ WP+ +      S   A  LL+   K  L N+R                           IL + +     +   VEE   + +T  LS  GG +S W G ++ S+VEI E+  +       M +   +   K +A  ++ +NI  +  ++ 
Sbjct:  303 SQAAGARIMIHNPNQPPRVEHQGFDIRPGTETSIGVKQDEVRHLGGKYGPCASDGNNLGLKLLYSTSYTLQACLNSCFQYKMTETCGCGYYFYP-----------LPPGTEYCNYNKHPGWGHCFYQLYEKM----------LDHRHHCFTQCPMQCTKTRYQLSAGTAQWPSPT------SKVCAFLLLELECKVTLFNFR-------------------------SDILKINVYYEELSYQSVEETPAMPVTLLLSNMGGQWSWWFGSSVLSVVEIAELVFDTV----AMAILMTYRWKKQRAPQIHPQNICTLGISIQ 567          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: cdh12 (cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase;Acc:XB-GENE-982876])

HSP 1 Score: 58.9214 bits (141), Expect = 1.909e-8
Identity = 80/389 (20.57%), Postives = 150/389 (38.56%), Query Frame = 1
Query:  541 LESVPNKSYVELGHKKQDLIIHCRVTYMIGSKPHSKDCDELGKWRRIIHAQYVNCYMFD-------LIESLSNATNTLEMFLYLDESINQATCIDCFSSDVKSQLSGALILIHRSNTFPNFNRDMINLQPGTLTEIKLKTIHNRHKLPPYGRCSNKTPKWIKVFGELYA--YSEDLCKLITIQGDLNHFCNCNAIEYPFNYSSLKFCSALPSFSQRVSCNNRLNDRKCETELKNTVKQISCKAKACLIYNNDIVPSCKLPCSFYSYETDRSTSTWPTKSWQLQWISTKAAKPLLDKQELDNYRYAVKLQEKGNYSEALKILNKENTMEQKILAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLFSIWIGMTLFSIVEIFEM-FANCFW 1677
            L  +  +  + +G+K  +LI+ C    +         CD    +    H  Y NCY F+       L+ S+  A   L++ LY+DE        D ++  + S  +GA IL+H  + +P        L+  T T I ++   +     PY  C+      + V   LY+  Y+  +C     Q ++   C C   + P   +  K+C+    +   + C  +L  +  + EL        C++            +C+  CSF  +   RS + WP+ + +++                    + ++L   G+    L  L   N   Q +          N   + E    ++ + LS  GG   +W+  ++  ++EI E+ F + FW
Sbjct:  241 LAKISMEDKIAMGYKADELIVTCFFDGL--------SCDA-RNFTLFHHPLYGNCYTFNSAERGNLLVSSMGGAEYGLKVVLYIDE--------DEYNPYL-STAAGAKILVHDQDEYPFIEDLGTELETATETSIGMQLTESTKLSDPYSDCTMDGSD-VSV-ENLYSKKYTLQICLNSCFQREMVRTCGCAHYDQPLP-NGAKYCN-YEEYPSWIYCYFKLYKQFVQEEL-------GCQS------------ACRESCSFKEWTLTRSLAKWPSLNSEVR------------------SAWVLQLFYVGHGFFNLNDLANLNIFYQDL----------NSRSISESPTYNIVTLLSNFGGQLGLWMSCSMICVLEIVEVFFIDSFW 560          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Match: Scnn1b (sodium channel, nonvoltage-gated 1 beta [Source:MGI Symbol;Acc:MGI:104696])

HSP 1 Score: 64.3142 bits (155), Expect = 3.298e-10
Identity = 90/377 (23.87%), Postives = 143/377 (37.93%), Query Frame = 1
Query:  559 KSYVELGHKKQDLIIHCRVTYMIGSKPHSKDCDELGKWRRIIHAQYVNCYMFDLI---ESLSNATNTLEMFLYLDESINQATCIDCFSSDVKSQLSGALILIHRSNTFPNFNRDMINLQPGTLTEIKLKTIHNRHKLPPYGRCS-NKTPKWIKVFGELY--AYSEDLCKLITIQGDLNHFCNCNAIEYPFNYSSLKFCSALPSFSQRVSCNNR--LNDRKCETELKNTVKQISCKAKACLIYNNDIVPSCKLPCSFYSYETDRSTSTWPTKS---WQLQWISTKAAKPLLDKQELDNYRYAVKLQEKGNYSEALKILNKENTMEQKILAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLFSIWIGMTLFSIVEIFE 1656
            +  V +G+    +I+ C    + G++P S        +  I +  Y NCY+F+     E+L +A    E  L L   I Q   +   +S      +GA +++H   T+P    + I    GT T I +     + K  PY  C+ N +   IK    +Y   YS   C     Q  +   C+C    YP           LP   +   CNNR   +   C   L+ +V Q     + CL         CK  C+   Y+   S + WP+++   W L  +S          QE D     + L  KG                  I+ + I    +N   +EE    ++   LS  GG F  W+G ++  ++E  E
Sbjct:  231 QDLVGMGYAPDRIILAC----LFGTEPCSHR-----NFTPIFYPDYGNCYIFNWGMTEETLPSANPGTEFGLKLILDIGQEDYVPFLAST-----AGARLMLHEQRTYPFIREEGIYAMAGTETSIGVLVDKLQRKGEPYSPCTMNGSDVAIKNLYSVYNTTYSIQACLHSCFQDHMIRNCSCGHYLYP-----------LPEGEKY--CNNRDFPDWAYCYLNLQMSVTQ----RETCLSM-------CKESCNDTQYKMTISMADWPSEASEDWILHVLS----------QERDQSS-NITLSRKG------------------IVKLNIYFQEFNYRTIEESPANNIVWLLSNLGGQFGFWMGGSVLCLIEFGE 540          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Match: Scnn1a (sodium channel, nonvoltage-gated 1 alpha [Source:MGI Symbol;Acc:MGI:101782])

HSP 1 Score: 55.0694 bits (131), Expect = 2.095e-7
Identity = 77/335 (22.99%), Postives = 131/335 (39.10%), Query Frame = 1
Query:  685 HAQYVNCYMFD-------LIESLSNATNTLEMFLYLDESINQATCIDCFSSDVKSQLSGALILIHRSNTFPNFNRDMINLQPGTLTEIKLKTIHNRHKLPPYGRCS-NKTPKWIKVFGELYA--YSEDLCKLITIQGDLNHFCNCNAIEYPFNYSSLKFCSALPSFSQRVSCNNRLNDRKCETELKNTVKQISCKAKACLIYNNDIVPSCKLPCSFYSYETDRSTSTWPTKSWQLQWISTKAAKPLLDKQELDNYRYAVKLQEKGNYSEALKILNKENTMEQKILAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLFSIWIGMTLFSIVEIFEM 1659
            H  Y NCY F+        + S+    N L + L  +    Q   I   S+     ++GA +++H  +     +    N++PG  T I ++          YG C+ N +   +K    LY   Y++ +C     Q ++   C C  I YP     ++FC  L   S    C  +L       +   ++  + C +K            C+ PCS  +Y+     S WP         S K+   + +   L N           NY+    I NK N + +  L +     NY  +   E   +++ S LS  G  +S+W G ++ S+VE+ E+
Sbjct:  220 HPMYGNCYTFNNKNNSNLWMSSMPGVNNGLSLTLRTE----QNDFIPLLST-----VTGARVMVHGQDEPAFMDDGGFNVRPGVETSISMRKEALDSLGGNYGDCTENGSDVPVK---NLYPSKYTQQVCIHSCFQENMIKKCGCAYIFYP-KPKGVEFCDYLKQSSWGY-CYYKL-------QAAFSLDSLGCFSK------------CRKPCSVTNYKLSAGYSRWP---------SVKSQDWIFEMLSLQN-----------NYT----INNKRNGVAK--LNIFFKELNYKTN--SESPSVTMVSLLSNLGSQWSLWFGSSVLSVVEMAEL 493          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Match: Scnn1a (sodium channel, nonvoltage-gated 1 alpha [Source:MGI Symbol;Acc:MGI:101782])

HSP 1 Score: 55.0694 bits (131), Expect = 2.203e-7
Identity = 77/335 (22.99%), Postives = 131/335 (39.10%), Query Frame = 1
Query:  685 HAQYVNCYMFD-------LIESLSNATNTLEMFLYLDESINQATCIDCFSSDVKSQLSGALILIHRSNTFPNFNRDMINLQPGTLTEIKLKTIHNRHKLPPYGRCS-NKTPKWIKVFGELYA--YSEDLCKLITIQGDLNHFCNCNAIEYPFNYSSLKFCSALPSFSQRVSCNNRLNDRKCETELKNTVKQISCKAKACLIYNNDIVPSCKLPCSFYSYETDRSTSTWPTKSWQLQWISTKAAKPLLDKQELDNYRYAVKLQEKGNYSEALKILNKENTMEQKILAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLFSIWIGMTLFSIVEIFEM 1659
            H  Y NCY F+        + S+    N L + L  +    Q   I   S+     ++GA +++H  +     +    N++PG  T I ++          YG C+ N +   +K    LY   Y++ +C     Q ++   C C  I YP     ++FC  L   S    C  +L       +   ++  + C +K            C+ PCS  +Y+     S WP         S K+   + +   L N           NY+    I NK N + +  L +     NY  +   E   +++ S LS  G  +S+W G ++ S+VE+ E+
Sbjct:  220 HPMYGNCYTFNNKNNSNLWMSSMPGVNNGLSLTLRTE----QNDFIPLLST-----VTGARVMVHGQDEPAFMDDGGFNVRPGVETSISMRKEALDSLGGNYGDCTENGSDVPVK---NLYPSKYTQQVCIHSCFQENMIKKCGCAYIFYP-KPKGVEFCDYLKQSSWGY-CYYKL-------QAAFSLDSLGCFSK------------CRKPCSVTNYKLSAGYSRWP---------SVKSQDWIFEMLSLQN-----------NYT----INNKRNGVAK--LNIFFKELNYKTN--SESPSVTMVSLLSNLGSQWSLWFGSSVLSVVEMAEL 493          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Match: Scnn1a (sodium channel, nonvoltage-gated 1 alpha [Source:MGI Symbol;Acc:MGI:101782])

HSP 1 Score: 54.6842 bits (130), Expect = 2.700e-7
Identity = 77/335 (22.99%), Postives = 131/335 (39.10%), Query Frame = 1
Query:  685 HAQYVNCYMFD-------LIESLSNATNTLEMFLYLDESINQATCIDCFSSDVKSQLSGALILIHRSNTFPNFNRDMINLQPGTLTEIKLKTIHNRHKLPPYGRCS-NKTPKWIKVFGELYA--YSEDLCKLITIQGDLNHFCNCNAIEYPFNYSSLKFCSALPSFSQRVSCNNRLNDRKCETELKNTVKQISCKAKACLIYNNDIVPSCKLPCSFYSYETDRSTSTWPTKSWQLQWISTKAAKPLLDKQELDNYRYAVKLQEKGNYSEALKILNKENTMEQKILAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLFSIWIGMTLFSIVEIFEM 1659
            H  Y NCY F+        + S+    N L + L  +    Q   I   S+     ++GA +++H  +     +    N++PG  T I ++          YG C+ N +   +K    LY   Y++ +C     Q ++   C C  I YP     ++FC  L   S    C  +L       +   ++  + C +K            C+ PCS  +Y+     S WP         S K+   + +   L N           NY+    I NK N + +  L +     NY  +   E   +++ S LS  G  +S+W G ++ S+VE+ E+
Sbjct:  301 HPMYGNCYTFNNKNNSNLWMSSMPGVNNGLSLTLRTE----QNDFIPLLST-----VTGARVMVHGQDEPAFMDDGGFNVRPGVETSISMRKEALDSLGGNYGDCTENGSDVPVK---NLYPSKYTQQVCIHSCFQENMIKKCGCAYIFYP-KPKGVEFCDYLKQSSWGY-CYYKL-------QAAFSLDSLGCFSK------------CRKPCSVTNYKLSAGYSRWP---------SVKSQDWIFEMLSLQN-----------NYT----INNKRNGVAK--LNIFFKELNYKTN--SESPSVTMVSLLSNLGSQWSLWFGSSVLSVVEMAEL 574          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Match: Scnn1a (sodium channel, nonvoltage-gated 1 alpha [Source:MGI Symbol;Acc:MGI:101782])

HSP 1 Score: 54.6842 bits (130), Expect = 2.700e-7
Identity = 77/335 (22.99%), Postives = 131/335 (39.10%), Query Frame = 1
Query:  685 HAQYVNCYMFD-------LIESLSNATNTLEMFLYLDESINQATCIDCFSSDVKSQLSGALILIHRSNTFPNFNRDMINLQPGTLTEIKLKTIHNRHKLPPYGRCS-NKTPKWIKVFGELYA--YSEDLCKLITIQGDLNHFCNCNAIEYPFNYSSLKFCSALPSFSQRVSCNNRLNDRKCETELKNTVKQISCKAKACLIYNNDIVPSCKLPCSFYSYETDRSTSTWPTKSWQLQWISTKAAKPLLDKQELDNYRYAVKLQEKGNYSEALKILNKENTMEQKILAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLFSIWIGMTLFSIVEIFEM 1659
            H  Y NCY F+        + S+    N L + L  +    Q   I   S+     ++GA +++H  +     +    N++PG  T I ++          YG C+ N +   +K    LY   Y++ +C     Q ++   C C  I YP     ++FC  L   S    C  +L       +   ++  + C +K            C+ PCS  +Y+     S WP         S K+   + +   L N           NY+    I NK N + +  L +     NY  +   E   +++ S LS  G  +S+W G ++ S+VE+ E+
Sbjct:  301 HPMYGNCYTFNNKNNSNLWMSSMPGVNNGLSLTLRTE----QNDFIPLLST-----VTGARVMVHGQDEPAFMDDGGFNVRPGVETSISMRKEALDSLGGNYGDCTENGSDVPVK---NLYPSKYTQQVCIHSCFQENMIKKCGCAYIFYP-KPKGVEFCDYLKQSSWGY-CYYKL-------QAAFSLDSLGCFSK------------CRKPCSVTNYKLSAGYSRWP---------SVKSQDWIFEMLSLQN-----------NYT----INNKRNGVAK--LNIFFKELNYKTN--SESPSVTMVSLLSNLGSQWSLWFGSSVLSVVEMAEL 574          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|Q25011|FANA_CORAP (FMRFamide-activated amiloride-sensitive sodium channel OS=Cornu aspersum OX=6535 PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 9.920e-19
Identity = 118/545 (21.65%), Postives = 231/545 (42.39%), Query Frame = 1
Query:  166 TTIRGVPKIIKSKHKPLRYMWMTCFILLLSGFSVCFI---FLLKQYFAYDVIHPPRILTNSQAPFPSFTVCNLRPLA-RNIDTIF---KLKNLKTPREFAKNVNNYAIKYFYNKNNLTLYGHASSIMLMGGYLESVPNKSYVELGHKKQDLIIHCRVTYMIGSKPHSKDCDELGKWRRIIHAQYVNCYMFDLIESLSNATNTLEMFLYL------DESINQATCIDCFSSDVKSQLSGALILIHRSNTFPNFNRDMINLQPGTLTEIKLKTI-HNRHKLP-PYGRCSNKTPKWIKVFGELYAYSEDLCKLITIQGDLNHFCNCNAIEYPFNYS-SLKFCSALPSFSQRVSCNNRLNDRKCETELKNTVKQ--ISCKAKACLIYNND----IVPSCKLPCSFYSYETDRSTSTWPTKSWQLQWISTKAAKPLLDKQELDN------YRYAVKLQEKG------NYSEALKILNKENTMEQKILA------VMINRPNYNVHL-----VEEKEV--LSLTSFLSQAGGLFSIWIGMTLFSIVEIFEM 1659
            +   G+ KI+ S+    + +W    +L+++GF+   +    L+++Y  + V+    I  +    +PS ++CN+ P++ R I  ++   + +NL T   F +       K+ + ++        S +  +  + E++  +   +L H  +D+++HCR          +++   +  +       Y NC+ F+  + L       E  L L      D+ +     +  F +++    +G  +++H   + P+     I++ PG  + + LK I H R  LP PYG C+N     IK +   +     LCK    Q  +   C C +   P   S +  FC  +  + Q ++ N+   D     E +  +    ++C+ +     NND    +   C  PCS  SY    S S WP + +QL  +     +   ++Q   N      Y Y  KL          N S    IL+K  ++ +K +A      +  N    N++L     VE +++    L    +  GG   +W+G+++ +I+E+ E+
Sbjct:   50 SNAHGLAKIVTSRDTKRKVIWA---LLVIAGFTAATLQLSLLVRKYLQFQVVELSEIKDSMPVQYPSVSICNIEPISLRTIRRMYFNNESQNLITWLRFIQ-------KFRFEQD--------SFMNSIRAFYENL-GQDAKKLSHNLEDMLMHCRF---------NRELCHVSNFSTFFDGNYFNCFTFNSGQRLQMHATGPENGLSLIFSVEKDDPLPGTYGVYNFDNNILHS-AGVRVVVHAPGSMPSPVDHGIDIPPGYSSSVGLKAILHTR--LPYPYGNCTNDMLNGIKQYKYTFFACLQLCK----QRLIIQRCGCKSSALPEVPSYNATFCGVIKDW-QEINRNHSNEDHNQSEEDRAFIPTPYLACEEREQKNLNNDRTYELSCGCFQPCSETSYLKSVSLSYWPLEFYQLSAVERFFKQ---ERQAGQNHFMKTAYEYLEKLAHPSQKHLARNDSHMDDILSKSYSLSEKEMAKEASDLIRQNMLRLNIYLEDLSVVEYRQLPAYGLADLFADIGGTLGLWMGISVLTIMELIEL 555          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|Q22851|ASIC2_CAEEL (Degenerin-like protein asic-2 OS=Caenorhabditis elegans OX=6239 GN=asic-2 PE=3 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 4.841e-13
Identity = 104/511 (20.35%), Postives = 190/511 (37.18%), Query Frame = 1
Query:  145 FLRFCENTTIRGVPKIIKSKHKPLRYMWMTCFILLLSGFSVCFIFLLKQYFAYDVIHPPRILTNSQAPFPSFTVCNLRPLARNI---DTIFKLKNLKTPREFAKNVNNYAIK----YFYNKNNLTLYGHASSIMLMGGYLESVPNKSYVELGHKKQDLIIHCRVTYMIGSKPHSKDCDELGKWRRIIHAQYVNCYMFDLIESL--SNATNTLEMFLYLDESINQATCIDCFSSDVKSQLSGALILIHRSNTFPNFNRDMINLQPGTLTEIKLKTIHNRHKLPPYGRCSNKTPKWIKVFGELYAYSEDLCKLITIQGDLNHFCNCNAIEYPFNYSSLKFCSALPSFSQRVSCNNRLNDRKCETELKNTVKQISCKAKACLIYNNDIVPSCKLPCSFYSYETDRSTSTWPTKSWQLQWISTKAAKPLLDKQELDNYRYAVKLQEKGNYSEALKILNKENTMEQKILAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLFSIWIGMTLFSIVEI 1650
            F  F   +T+  VP +  + +K  R  W+  F+ +L  F+     L+ ++F+Y       IL   Q  FP  TVCN+ P   ++   ++ F   N          V  ++      Y  N     L   A+  +++   L  + + + V   +   DLI  C    +         C E   + + I   Y  CY F+   SL  S +   ++  L L  ++ Q        S   ++L+GA I ++   + P  + + I+   G  + + +    N     PYG C ++ P     + + + Y+ + C     Q D    C C                     S   +C     D  C   LK    Q S      L+    +  +C  PC   +Y    S + +P+ S+ +   ST             N +++ K       S+  K  N    + Q  L  +      +  L  E    ++++ ++  GG   +W+G+++ S+VE+
Sbjct:   10 FKDFSNWSTVAVVPHVANANNKISRIFWIAIFLFVLGMFAYELYILIAKFFSYPATVNTEILFEKQI-FPVVTVCNMNPYKYSVVKSNSAFSSVNTLMTTYSDATVGTFSTDKWGLYADNDETYDLDSRAADALVLEANL--ISDTAKVPALYTYADLIQDCSFAGI--------PCSE-SDFTKFIDPVYGACYSFNEDASLNYSVSREGIQFGLKLMLTVTQTKTNGNTDSLPTTKLAGARIGVNSRGSSPGLDSNGIDAGVGYESAVSVSLTQNVRAKKPYGTCVDREPDSSDYYKD-FIYTLETCFNGCKQRDTIAKCQCANPRLALG-------------STDTACQPIKADLDCLQTLKG--NQTSSTPNIDLL----VECNCNPPCDESTYTPTVSLAQFPSTSYYVATSSTAGVGSCSST----NSKFSSK-------SDCQKWYNNNGMIIQVFLETL------SYELYTETAGYTVSNVINDLGGQAGLWLGLSVISVVEM 471          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|O13262|SCNNC_XENLA (Amiloride-sensitive sodium channel subunit beta-2 OS=Xenopus laevis OX=8355 GN=scnn1b-b PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 6.628e-13
Identity = 86/387 (22.22%), Postives = 154/387 (39.79%), Query Frame = 1
Query:  541 LESVPNKSYVELGHKKQDLIIHCRVTYMIGSKPHSKDCDELGKWRRIIHAQYVNCYMFDL----IESLSNATNTLEMFLYLDESINQATCIDCFSSDVKSQLSGALILIHRSNTFPNFNRDM-INLQPGTLTEIKLKTIHNRHKLPPYGRCS-NKTPKWIKVFGELY--AYSEDLCKLITIQGDLNHFCNCNAIEYPFNYSSLKFCSALPSFSQRVSCNNRLNDRKCETELKNTVKQISCKAKACLIYNNDIVPSCKLPCSFYSYETDRSTSTWPTKSWQLQWISTKAAKPLLDKQELDNYRYAVKLQEKGNYSEALKILNKENTMEQKILAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLFSIWIGMTLFSIVEIFEMFANCFW 1677
              +VP    V++G K +DLI+ C    + G +P S        +  I  A Y NCY+F+      +++S+A    +  L L   I Q   +    +   ++L     ++H+  +FP F +D+ I  +PGT T I +     +    PY  C+ N +   ++   E +  +YS   C     Q ++   C C   +YP           LP+ S+  + N   +   C   L+++V               + +  C+ PC+   Y+   S + WP+   +  WI       +L  ++  +Y   V                        I+ + I    +N   + E E  ++   LS  GG F  W+G ++  I+E  E+  +C W
Sbjct:  245 FSNVPLSDRVDMGFKAEDLILTC----LFGGQPCS-----YRNFTHIYDADYGNCYIFNWGQEGDDTMSSANPGADFGLKLVLDIEQDEYLPFLQTTAAARL-----ILHQQRSFP-FVKDLGIYAKPGTETSIAVLVDQLQQMEAPYSSCTVNGSDIPVQNLYEEFNSSYSIQSCLRSCYQEEMVKTCKCAHYQYP-----------LPNGSEYCTNNKHPDWVPCYYGLRDSVA-----------IRENCISLCQQPCNDTHYKMVISMADWPSAGAE-DWIFH-----VLSYEKDSSYDITVN--------------------RNGIIRLNIYFQEFNYRSISESEATNVVWLLSNLGGQFGFWMGGSVLCIIEFGEIIIDCMW 568          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|P51169|SCNNB_XENLA (Amiloride-sensitive sodium channel subunit beta OS=Xenopus laevis OX=8355 GN=scnn1b-a PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 2.904e-12
Identity = 87/394 (22.08%), Postives = 157/394 (39.85%), Query Frame = 1
Query:  520 IMLMGGYLESVPNKSYVELGHKKQDLIIHCRVTYMIGSKPHSKDCDELGKWRRIIHAQYVNCYMFDLIE----SLSNATNTLEMFLYLDESINQATCIDCFSSDVKSQLSGALILIHRSNTFPNFNRDM-INLQPGTLTEIKLKTIHNRHKLPPYGRCS-NKTPKWIK-VFGEL-YAYSEDLCKLITIQGDLNHFCNCNAIEYPFNYSSLKFCSALPSFSQRVSCNNRLNDRKCETELKNTVKQISCKAKACLIYNNDIVPSCKLPCSFYSYETDRSTSTWPTKSWQLQWISTKAAKPLLDKQELDNYRYAVKLQEKGNYSEALKILNKENTMEQKILAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLFSIWIGMTLFSIVEIFEMFANCFW 1677
            ++ +     +VP    +++G K +DLI+ C    + G +P S        +  I  A Y NCY+F+  +    ++S+A    +  L L   I Q   +    +   ++L     ++H+  +FP F +D+ I   PGT T I +      H   PY  C+ N +   ++ ++ E   +YS   C     Q ++   C C   +YP           LP+ S+  +     +   C   L+++V               + +  C+ PC+   Y+   S + WP+   +  WI                  + V   EK   S     +N+       I+ + I    +N   + E E  ++   LS  GG F  W+G ++  I+E  E+  +C W
Sbjct:  239 LLQLSSIFSNVPLSGRIDMGFKAEDLILTC----LFGGQPCS-----YRNFTHIYDADYGNCYIFNWGQEGENTMSSANPGADFGLKLVLDIEQGEYLPFLQTTAAARL-----ILHQQRSFP-FVKDLGIYAMPGTETSISVLVDQLEHMEAPYSSCTVNGSDIPVQNLYAEFNSSYSIQSCLRSCYQEEMVKTCKCAHYQYP-----------LPNGSEYCTNMKHPDWVPCYYSLRDSVA-----------IRENCISLCQQPCNDTHYKMVISMADWPSAGAE-DWI------------------FHVLSYEKD--SSHNITVNRNG-----IVRLNIYFQEFNYRSISESEATNVVWLLSNLGGQFGFWMGGSVLCIIEFGEIIIDCMW 569          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|A5D7U4|SCNNB_BOVIN (Amiloride-sensitive sodium channel subunit beta OS=Bos taurus OX=9913 GN=SCNN1B PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.845e-11
Identity = 88/385 (22.86%), Postives = 152/385 (39.48%), Query Frame = 1
Query:  550 VPNKSYVELGHKKQDLIIHCRVTYMIGSKPHSKDCDELGKWRRIIHAQYVNCYMFDLI---ESLSNATNTLEMFLYLDESINQATCIDCFSSDVKSQLSGALILIHRSNTFPNFNRDMINLQPGTLTEIKLKTIHNRHKLPPYGRCS-NKTPKWIKVFGELY--AYSEDLCKLITIQGDLNHFCNCNAIEYPFNYSSLKFCSALPSFSQRVSCNNR--LNDRKCETELKNTVKQISCKAKACLIYNNDIVPSCKLPCSFYSYETDRSTSTWPTKSWQLQWISTKAAKPLLDKQELDNYRYAVKLQEKGNYSEALKILNKENTMEQK-ILAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLFSIWIGMTLFSIVEIFEMFANCFW 1677
            VPN+  V +G+  + LI+ C    + G++P    C+    +  I H  Y NCY+F+     ++L +A    E  L L   + Q   +   +S      +GA +++H   ++P    + I    G  T I +     + K  PY +C+ N +   I+     Y   YS   C     Q  +   C C    YP  +             +R  CNN+   +   C + L+     IS   +   IY      +CK  C+   Y+   S + WP+++ +  WI                  + V  QE+   S          T+ +K I+ + I    +N   +EE    ++   LS  GG F  W+G ++  ++E  E+  +  W
Sbjct:  231 VPNQELVAMGYPAERLILAC----LFGAEP----CN-YRNFTPIFHPDYGNCYIFNWGMTEKALPSANPGTEFGLKLILDMGQEDYVPFLTST-----AGARLMLHEQRSYPFIKEEGIYAMAGMETSIGVLVDKLQRKGEPYSQCTKNGSDVPIQNLYSNYNTTYSIQACIRSCFQEHMIRECGCGHYLYPLPH-------------KRKYCNNQEFPDWAHCYSALR-----ISLAQRETCIY------ACKESCNDTQYKMTISMAVWPSEASE-DWI------------------FHVLSQERDQSSNI--------TLSRKGIVKLNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIIDFVW 550          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A4V3SD10 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009422 PE=3 SV=1)

HSP 1 Score: 541.962 bits (1395), Expect = 0.000e+0
Identity = 252/536 (47.01%), Postives = 359/536 (66.98%), Query Frame = 1
Query:  121 IRQVIKEEFLRFCENTTIRGVPKIIKSKHKPLRYMWMTCFILLLSGFSVCFIFLLKQYFAYDVIHPPRILTNSQAPFPSFTVCNLRPLARNIDTIFKLKNLKTPREFAKNVNNYAIKYFYNKNNLTLYGHASSIMLMGGYLESVPNKSYVELGHKKQDLIIHCRVTYMIGSKPHSKDCDELGKWRRIIHAQYVNCYMFDLIESLSNATNTLEMFLYLDESINQATCIDCFSSDVKSQLSGALILIHRSNTFPNFNRDMINLQPGTLTEIKLKTIHNRHKLPPYGRCSNKTPKWIKVFGEL-YAYSEDLCKLITIQGDLNHFCNCNAIEYPFNYSSLKFCSALPSFSQRVSCN--------------NRLNDRK--CETELKNTVKQISCKAKACLIYNNDIVPSCKLPCSFYSYETDRSTSTWPTKSWQLQWISTKAAKPLLDKQELDNYRYAVKLQEKGNYS-EALKILNKENTMEQKILAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLFSIWIGMTLFSIVEIFEMFANCF 1674
            IR  IK+E + FC+ TTIRGV +++ ++ K  + +W +  + L  G   C  FL +QY  Y VIHPP++L ++ +PFPS T+CNLRPLA     + +   +KTPR+FA +VNN+A + FY+K ++  Y   +S + MGGYLES+P +  ++LGH     IIHC V Y  GSK    DC ++G+WRR +HAQY+NCY +DL+E   +   T+E+F+YLD   N+ +C+DCFS+++KSQLSGA++++H ++T+P+ N++ IN+QPG+LTEIK+KTI +  K PPYGRCS  TPK I+++G   Y YSE  C++ TIQ  +N  C CNAIE+P+  SSL FC A+ SF    SC+               ++   K  C  EL+     ++CK+     +  D+VPSC LPC F+SYETDRSTSTWPTKSWQL W+ T+A + +L++ EL  YR A  L  + N    A  +L++ N +E+ +LA+MI RPN+N+H VEEKEVLSLTS LSQ GGL SIWIGM + S++E+FE+  + F
Sbjct:   33 IRTKIKKELILFCQTTTIRGVTRVVNARSKSFQIVWASSVLFLFIGLFTCMFFLTRQYLEYHVIHPPQVLRDTPSPFPSITLCNLRPLASEATKVLEESRIKTPRKFAMDVNNFAAEAFYHKGDVHSYQLITSAISMGGYLESLPPEIRLQLGHHMNQTIIHCMVLYSEGSKRVLNDCHQVGRWRRFVHAQYLNCYSYDLLEKYRDHVRTIELFVYLDVPPNKTSCVDCFSAEIKSQLSGAVVVVHNADTYPDINQEGINIQPGSLTEIKVKTIKHIQKTPPYGRCSPDTPKTIELYGAAPYRYSEHACRMSTIQTQINDRCGCNAIEFPYRSSSLPFCLAMGSFVHEGSCDVQSLQGSGSKVANSTKIGSLKSECLAELEVVKNHVTCKSDVTRHFEGDVVPSCTLPCQFFSYETDRSTSTWPTKSWQLGWLGTRAGRMILNRPELAPYREARDLMRQPNGDVRAQTLLSQTNVLEKNLLAIMIIRPNFNLHNVEEKEVLSLTSLLSQTGGLLSIWIGMNIMSVIELFELLVHLF 568          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A4E0S173 (FMRFamide-activated amiloride-sensitive sodium channel OS=Fasciola hepatica OX=6192 GN=D915_002784 PE=3 SV=1)

HSP 1 Score: 518.079 bits (1333), Expect = 1.036e-173
Identity = 251/546 (45.97%), Postives = 361/546 (66.12%), Query Frame = 1
Query:  121 IRQVIKEEFLRFCENTTIRGVPKIIKSKHKPLRYMWMTCFILLLSGFSVCFIFLLKQYFAYDVIHPPRILTNSQAPFPSFTVCNLRPLARNIDTIFKLKNLKTPREFAKNVNNYAIKYFYNKNNLTLYGHASSIMLMGGYLESVP-NKSYVELGHKKQDLIIHCRVTYMIGSKPHSKDCDELGKWRRIIHAQYVNCYMFDLIESLSNATNTLEMFLYLDESINQATCIDCFSSDVKSQLSGALILIHRSNTFPNFNRDMINLQPGTLTEIKLKTIHNRHKLPPYGRCSNKTPKWIKVFG-ELYAYSEDLCKLITIQGDLNHFCNCNAIEYPFNYSSLKFCSALPSFSQRVSCNNRLNDRK---------------------------CETELKNTVKQISCKAKACLIYNNDIVPSCKLPCSFYSYETDRSTSTWPTKSWQLQWISTKAAKPLLDKQELDNYRYAVKLQE-KGNYSEALKILNKENTMEQKILAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLFSIWIGMTLFSIVEIFEMFAN 1668
            +++ +K+E L FC+ TTIRGV +I+ +++K  +  W+   I L  G   C  FL +QY  Y+VIHPP++L ++ +PFPS T+CNLRPL  N   I +  NLK PR+FA +VN +A K +Y  N+   Y   +S + MGGYLES+P N S++ LGH + D IIHC V +  GSK    DC+++G+WR+ +HAQY+NCY +DL E+  +   T+E+F+YLD  +N+  C+DCFSS++KSQLSGA++++H S+T+P+ N++ IN+QPG+LTEIK+KTI +  K PPYGRCS  TP  I+++G E YAYSE  C++ TIQ  +N  C CNAIE+P+   SL FC A+ SF  R  C +  N  +                           C  EL+   + ++CK++    +  D+VPSC LPC+F+SYETDRS S WPTKSWQL W+ TK  + L+++ ++++YR A KL    G  +EA  IL   + +EQ +LA+M+ RPN N+H VEEKEVLSLTS LSQ+GGL SIWIG+ + S++E+ E+  +
Sbjct:   25 VKKGLKDELLIFCQTTTIRGVTRIVTARNKTFQTAWVCSVIALFIGLFTCMFFLTRQYLEYNVIHPPQVLRDTPSPFPSMTLCNLRPLTSNATKILESLNLKNPRQFASDVNKFAAKTYYYNNDFLSYQLVTSAISMGGYLESLPLNVSHI-LGHNRSDTIIHCMVLHTEGSKRVLNDCEQVGRWRQFVHAQYLNCYTYDLYEAYRDHVRTIELFVYLDGPMNKTACLDCFSSEIKSQLSGAVVVVHNSDTYPDVNQEGINIQPGSLTEIKVKTIKHTQKTPPYGRCSPNTPVSIQLYGSESYAYSEHACRMSTIQSKINTRCGCNAIEFPYLNGSLPFCLAMSSFVYRGGCEDHTNISRSQSDTTVSPEPNRSPKNSSIHRNPTEICYQELETVKRHVACKSEVTKHFQGDVVPSCTLPCTFFSYETDRSASVWPTKSWQLSWLGTKVGRTLVNRPDMESYRRARKLLTIPGGEAEAKTILASSSVLEQNLLAIMLIRPNLNLHNVEEKEVLSLTSLLSQSGGLLSIWIGLNMMSVIEVLELLVH 569          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A158QSX4 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS1629 PE=3 SV=1)

HSP 1 Score: 514.227 bits (1323), Expect = 5.092e-173
Identity = 252/537 (46.93%), Postives = 353/537 (65.74%), Query Frame = 1
Query:  139 EEFLRFCENTTIRGVPKIIKSKHKPLRYMWMTCFILLLSGFSVCFIFLLKQYFAYDVIHPPRILTNSQAPFPSFTVCNLRPLARNIDTIFKLKNLK--TPREFAKNVNNYAIKYFYNKNNLTLYGHASSIMLMGGYLESVPNKSYVELGHKKQDLIIHCRVTYMIGSKPHSKDCDELGKWRRIIHAQYVNCYMFDLIESLSNATNTLEMFLYLDESINQATCIDCFSSDVKSQLSGALILIHRSNTFPNFNRDMINLQPGTLTEIKLKTIHNRHKLPPYGRCSNKTPKWIKVFGEL-YAYSEDLCKLITIQGDLNHFCNCNAIEYPFNYSSLKFCSALPSFSQRVSC--------NNRLNDRK-------CETELKNTVKQISCKAKACLIYNNDIVPSCKLPCSFYSYETDRSTSTWPTKSWQLQWISTKAAKPLLDKQELDNYRYAVKLQEK---GNYSEALKILNKENTMEQKILAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLFSIWIGMTLFSIVEIFEMFANCFWRFR 1686
            +EFLRFC+ TTIRGV +I+K+ +K +R +W+T  I L  G   C I L++QY  YDVIHPPR+L ++ +PFPS T+CNLRP++     + K++NLK   PREFA N+N++A   ++ +N    Y   SS + MGGYLES+P  S   LGH + + +I C V Y+ GS   ++ C+++GKWR   HA Y+NC+ FDL  S+S    T+E+F YL+E  +   C DCF+S++KSQLSGA++++H + T+P+ N++ IN+QPGTLTEIK+K I N  K PPYGRCS  TP  I  +  + YAYSE  C+++TIQ ++N  CNCNAIE+P    +L FC ++  F +   C           LN          CE +L     +I CKA+    + +D+VP+C LPC+FYSYETDRSTSTWPTKSWQL W+ T   + +L   E+  YR A +L ++    N  E L+IL + N +E+ +LA+M+ RPN+N+H V EKEV SLTSFLSQAGGL SIWIG+T+  +VE+ E+  NC   F+
Sbjct:   15 QEFLRFCQTTTIRGVSRIVKAPNKGIRSLWLTFVIALFIGLFACMILLVRQYVDYDVIHPPRVLRDTPSPFPSLTLCNLRPISP--PGMKKIRNLKFRDPREFANNLNSFAAGLYFYRNKSHDYELVSSAISMGGYLESLPKGSSYSLGHMRNETVIQCLVLYLEGSSRITEQCEKVGKWRHFFHALYLNCHSFDLDPSISQQVLTVELFSYLNERHDDVECHDCFASEIKSQLSGAVVVVHTAKTYPDVNQEGINVQPGTLTEIKIKAIENIQKEPPYGRCSLDTPTEIPSYDNISYAYSEYGCRMLTIQNEINKNCNCNAIEFPRMDDTLPFCMSMVDFVKENRCVYEDMVKQAQALNATGPSEEFLLCEKQLNMARDRILCKAQVMHRFQSDVVPTCTLPCAFYSYETDRSTSTWPTKSWQLTWLKTPIGRTILQMPEMSEYRRAEELLDQPGDKNRDEVLRILAENNAVERNLLAIMVVRPNFNLHKVAEKEVFSLTSFLSQAGGLLSIWIGLTMICLVEVIELIINCINVFK 549          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A564Y5L5 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS2931 PE=3 SV=1)

HSP 1 Score: 514.998 bits (1325), Expect = 5.774e-173
Identity = 251/562 (44.66%), Postives = 350/562 (62.28%), Query Frame = 1
Query:  136 KEEFLRFCENTTIRGVPKIIKSKHKPLRYMWMTCFILLLSGFSVCFIFLLKQYFAYDVIHPPRILTNSQAPFPSFTVCNLRPLARNIDTIFKLKNLKTPREFAKNVNNYAIKYFYNKNNLTLYGHASSIMLMGGYLESVPNKSYVELGHKKQDLIIHCRVTYMIGSKPHSKDCDELGKWRRIIHAQYVNCYMFDLIESLSNATNTLEMFLYLDESINQATCIDCFSSDVKSQLSGALILIHRSNTFPNFNRDMINLQPGTLTEIKLKTIHNRHKLPPYGRCSNKTPKWIKVF-GELYAYSEDLCKLITIQGDLNHFCNCNAIEYPFNYSSLKFCSALPSFSQRVSCNNRLNDRK---------------CETELKNTVKQISCKAKACLIYNNDIVPSCKLPCSFYSYETDRSTSTWPTKSWQLQWISTKAAKPLLDKQELDNYRYAVKL------QEKGNYSEALKILNKENTMEQKILAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLFSIWIGMTLFSIVEIFEMFANCFWRFRKMFVKNGFTNDKNQASSLNEKNI 1755
            K+E LRFC+ TTIRGVP+I+ +KHK +R +W+   I+L  G   C I L +QYF YDVIHPPR+L ++ +PFPS T+CNLRP++       K    + PR FA+NVNN+A   +Y +N    Y   S+ + MGGYLES+P      LGH K + +I C + +  GS   +  C+ +G+WRRI+HA Y+NC+  D+  ++S+   +LE+F YL+E  ++  C DCF++D+KSQLSGA+I++H + T+P  N++ IN+QPGTLTEIK K I N  K PPYGRC   T   I    G  YAYSE  C++ TIQ ++N  CNCNAIE+P     L FC ++  F +   CN+    +                CE +L    +++ CK++    Y  D+VP+C LPCSFYSYETDRSTSTWPTKSWQL W++T   + +L   E+  YR A++L        K    E L+IL + N +E+ +LA+ + RPN+N+H V EKEVLSLTSFLSQ GGL SIWIG+T+  +VEI E+  NC + F        F   +NQ   ++ K +
Sbjct:   14 KQELLRFCQTTTIRGVPRIVNAKHKGIRSVWLAFVIILFMGLFTCMILLARQYFDYDVIHPPRVLRDTPSPFPSITLCNLRPISTAGIKRIKELRFRDPRAFARNVNNFAAGLYYYRNRSHDYEIISNAISMGGYLESLPKDYSYSLGHMKNESVIQCMIQFQEGSSIIADYCERVGRWRRILHALYLNCHTLDVDPNISHRAVSLELFSYLNERHDEVICHDCFAADIKSQLSGAVIVVHSAQTYPEINKEGINVQPGTLTEIKFKAIENIQKEPPYGRCDRDTKTEIPSHDGASYAYSEYGCRMYTIQDEINKKCNCNAIEFPIVNGDLPFCMSMVDFVKEDMCNHEQMVKSVQMPNSTEPSNEFLVCEQQLNTAREKLICKSQVTGEYQGDVVPACTLPCSFYSYETDRSTSTWPTKSWQLAWLNTSIGRTVLQMSEMSEYRRALELLNQSSDVNKTTTREILRILEQNNALERNLLAITVVRPNWNLHKVAEKEVLSLTSFLSQTGGLLSIWIGLTMICVVEILELIINCCYVFM-------FKRRENQEHRISSKEL 568          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A068W7J0 (FMRFamide activated amiloride sensitive sodium OS=Echinococcus granulosus OX=6210 GN=EgrG_000763100 PE=3 SV=1)

HSP 1 Score: 510.76 bits (1314), Expect = 2.025e-171
Identity = 249/539 (46.20%), Postives = 348/539 (64.56%), Query Frame = 1
Query:  136 KEEFLRFCENTTIRGVPKIIKSKHKPLRYMWMTCFILLLSGFSVCFIFLLKQYFAYDVIHPPRILTNSQAPFPSFTVCNLRPLARNIDTIFKLKNLKTPREFAKNVNNYAIKYFYNKNNLTLYGHASSIMLMGGYLESVPNKSYVELGHKKQDLIIHCRVTYMIGSKPHSKDCDELGKWRRIIHAQYVNCYMFDLIESLSNATNTLEMFLYLDESINQATCIDCFSSDVKSQLSGALILIHRSNTFPNFNRDMINLQPGTLTEIKLKTIHNRHKLPPYGRCSNKTPKWIKVFGEL-YAYSEDLCKLITIQGDLNHFCNCNAIEYPFNYSSLKFCSALPSFSQRVSC-----------NNRLNDRK----CETELKNTVKQISCKAKACLIYNNDIVPSCKLPCSFYSYETDRSTSTWPTKSWQLQWISTKAAKPLLDKQELDNYRYAVKL--QEKG----NYSEALKILNKENTMEQKILAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLFSIWIGMTLFSIVEIFEMFANCFWRFR 1686
            K+EFLRFC+ TTIRGV +I+ S++K +R +W+T  I L  G   C I L  QYF YDVIHPPR+L ++ +PFPS T+CNLRPL+       +    + PR+FAKN+N +A   ++ +N    Y   SS + MGGYLES+P  S   LGH + + +I C V Y+ GS    + C+++G+WR   HA Y+NC+ FD+  S+S    T+E+F YL+E  ++  C DCF+S++KSQLSGA++++H ++T+P+ N++ INLQPGTLTEIK+K I N  K PPYGRC+  TP  I     + YAYSE  C++ TIQ ++N  CNCNAIE+P   +SL FC ++  F +   C            N     +    CE +L     +I CKA     +  D+VP+C LPC+FYSYETDRSTSTWPTKSWQL W+ST   + +L+  E+  YR AV+L  Q  G    N  E L+IL + N +E+ +LA+++ R N+N+H V EKEV SLTSFLSQ GGL SIWIG+T+  +VE+ E+  NC + ++
Sbjct:   14 KQEFLRFCQTTTIRGVSRIVNSRNKGIRSLWLTFVICLYIGLFTCMILLASQYFDYDVIHPPRVLRDTPSPFPSLTLCNLRPLSPPGMKRIRQLQFRDPRDFAKNLNEFAAGLYFYRNRSHDYELVSSAISMGGYLESLPKGSSYSLGHLQNETVIQCMVLYLEGSSRIIEPCEKVGRWRHFFHALYLNCHSFDIDPSISRRVLTIELFSYLNERHDEVECHDCFASEIKSQLSGAVVVVHTASTYPDVNQEGINLQPGTLTEIKIKAIENIQKEPPYGRCTRDTPTEIPGHDNMSYAYSEYGCRMYTIQAEINENCNCNAIEFPIINNSLPFCMSMVDFVKENRCVYEKMVKQAEMRNATGPSEEFLTCEAQLNMARDRILCKALVMQEFQGDVVPTCTLPCAFYSYETDRSTSTWPTKSWQLTWLSTDVGRTILEMPEMVEYRRAVELLSQPDGDTGANKREVLRILEQNNAVERNLLAIIVVRSNFNLHKVAEKEVFSLTSFLSQTGGLLSIWIGLTMICVVEVLELIINCVFVYK 552          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Sea Lamprey
Match: SCNN1B (sodium channel epithelial 1 beta subunit [Source:HGNC Symbol;Acc:HGNC:10600])

HSP 1 Score: 67.3958 bits (163), Expect = 4.753e-12
Identity = 77/335 (22.99%), Postives = 136/335 (40.60%), Query Frame = 1
Query:  685 HAQYVNCYMFDLIES---LSNATNTLEMFLYLDESINQATCIDCFSSDVKSQLSGALILIHRSNTFPNFNRDMINLQPGTLTEIKLKTIHNRHKLPPYGRCS-NKTPKWIKVFGELYAYSEDLCKLITIQGDLNHFCNCNAIEYPFNYSSLKFCSALPSFSQRVSCNNRLNDRKCETELKNTVKQISCKAKACLIYNNDIVPSCKLPCSFYSYETDRSTSTWPTKSWQLQWISTKAAKPLLDKQELDNYRYAVKLQEKGNYSEALKILNKENTMEQKILAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLFSIWIGMTLFSIVEIFEMFANCFW 1677
            H  Y NC++F+  E+   +  +   +E  L L  SI+Q   I   ++     ++GA+I++H  NT+P  +   + ++ G  T + ++    + +  PY  C+ + T   I       AYS   C     Q  +   C C    YP      K+C    +F+    C  +L ++  E ++                   D    CK PC    Y+   S S WP++S +  WI    +K                 + K N S   +I N++    Q I+ + +    +N   + E    ++ + LS  GG F  W+G ++  I+E  E+  +C W
Sbjct:  270 HPMYGNCFIFNWGENETVMQVSNPGVEYGLKLVLSIDQDEYIPFLTT-----IAGAVIMVHDQNTYPFLSDLGVFVKTGVETSVGIEVGQLQRQGAPYSDCTMDGTDLPITNLYNGTAYSVQACLRSCFQTKMIEMCGCGYYLYPLP-PGEKYCQN-QNFTGWRYCYYKLYEQFVEEDM-------------------DCYTICKQPCIESEYKMSISMSDWPSQSSE-DWIFHILSK-----------------ERKHNVS---RIFNRK----QDIIKLNLFFQEFNSMTISESPAQTIVTLLSNLGGQFGFWMGGSVLCIIEFIEIIIDCVW 553          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Sea Lamprey
Match: SCNN1A (sodium channel epithelial 1 alpha subunit [Source:HGNC Symbol;Acc:HGNC:10599])

HSP 1 Score: 51.9878 bits (123), Expect = 2.678e-7
Identity = 79/368 (21.47%), Postives = 125/368 (33.97%), Query Frame = 1
Query:  589 QDLIIHCRVTYMIGSKPHSKDCDELGKWRRIIHAQYVNCYMFDLIES-----LSNATNTLEMFLYLDESINQATCIDCFSSDVKSQLSGALILIHRSNTFPNFNRDMINLQPGTLTEIKLKTIHNRHKLPPYGRCSNKTPKWIKVFGELY--AYSEDLCKLITIQGDLNHFCNCNAIEYPFNYSSLKFCSALPSFSQRVSCNNRLNDRKCETELKNTVKQISCKAKACLIYNNDIVPSCKLPCSFYSYETDRSTSTWPTKSWQLQWISTKAAKPLLDKQELDNYRYAVKLQEKGNYSEALKILNKENTMEQKILAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLFSIWIGMTLFSIVEIFEMFANC 1671
            +D I  C    M    P S       ++ R  H  Y NCY F+   S      S       + L L    N             S ++GA I++H   + P       +++PG  T + ++ +       PYG C+      + V   LY  AY+  + +    Q  L   C C    YP           LP  +   S NN      C  +L    +Q       C       V  C  PC+   +      + WP  S + +WI       LL  Q               NYS          T+   +  + +     N+  + E    ++   LS  G  +S+W G ++ S +E+ E+  +C
Sbjct:  212 EDFIFSC----MFSGMPCSDS-----EYSRFHHPTYGNCYTFNSANSSKLWQASKPGRDYGLSLILRTEQNDYI-------PFLSTVAGARIMVHDQESPPFMEEGGFDMRPGFETSLGIRMLEATRMPDPYGNCTEDGSN-VPVL-NLYSSAYTVQVPECSCFQLALVEACGCGYYFYP-----------LPPNASYCSYNNTAWAGHCYYKL---YRQFISDELGC-------VDKCAQPCTTKRFAVTPGYAAWPDSSSE-KWIFN-----LLSLQN--------------NYS--------VTTVRNDVAKLNVYFRELNMKTISESAATNVIWLLSNIGSQWSLWFGSSVLSWLEVGELGIDC 512          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Sea Lamprey
Match: SCNN1G (sodium channel epithelial 1 gamma subunit [Source:HGNC Symbol;Acc:HGNC:10602])

HSP 1 Score: 50.447 bits (119), Expect = 1.070e-6
Identity = 71/294 (24.15%), Postives = 117/294 (39.80%), Query Frame = 1
Query:  550 VPNKSYVELGHKKQDLIIHCRVTYMIGSKPHSKDCDELGKWRRIIHAQYVNCYMFD---LIESLSNATNTLEMFLYLDESINQATCIDCFSSDVKSQLSGALILIHRSNTFPNFNRDMINLQPGTLTEIKLKTIHNRHKL-PPYGRCSNKTPKWIKVFGELY--AYSEDLCKLITIQGDLNHFCNCNAIEYPFNYSSLKFCSAL--PSFSQRVSCNNRLNDRKCETELKNTVKQISCKAKACLIYNNDIVPSCKLPCSFYSYETDRSTSTWPTKS---WQLQWISTKAAKPLLD 1398
            VP K   +LG+   + II C  +  +        CD    ++++ H    NC+ F+     +SL  A+  ++  L++  +  Q   +   +       +GA I IH  NT P      I++ P   + + L+ +++  KL  PY  C+      I V   LY   YS   C+    Q ++   C C   E P    S +FC+    P +     C  RL D   + ELK                    +  C+  CS   +E   S + WP+K+   W L+ +S +   P  D
Sbjct:  234 VPEKDKDKLGYSADEFIIDCLFSGTV--------CDPSTSFKKLQHPILGNCFTFNDGSDGKSLDIASAGIDYGLHMVLNTRQDNSLPYLAMG-----AGAKIGIHLQNTTPFIEAVGIDIPPAMESSLGLR-VNDVQKLGDPYSDCTMDGSD-IDV-KSLYDSPYSVQTCQNSCFQWEMIKSCGCANYEQPLPEGS-RFCNYDNNPGWEY---CYYRLYDMYIKEELK-------------------CIQVCRQICSETEHEVTLSLADWPSKASKGWLLRALSKEQGLPAND 488          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Nematostella
Match: EDO42137 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2F2])

HSP 1 Score: 76.6406 bits (187), Expect = 8.780e-15
Identity = 118/566 (20.85%), Postives = 211/566 (37.28%), Query Frame = 1
Query:  124 RQVIKEEFLRFCENTTIRGVPKIIKSKHKPLRYMWMTCFILLLSGFSVCFIFLLKQYFAYDVIHPPRILTNSQAPFPSFTVCNLR---------PLARNIDTIFKLKNLKTPREFAKNVNNYAIKYFYNKNNLTLYGHASSIMLMGGYLESVPNKSYVELGHKKQDLIIHCRVTYMIGSKPHSKDCDELGKWRRIIHAQYVNCYMFDLIE------------SLSNATN--TLEMFLYLDESINQATCIDCFSSDVKSQLSGALILIHRSNTFPNFNRDMINLQPGTLTEIKLKTIHNRHKLPPYGR---CSNKTPKWIKVFGELYAYSEDLCKLITIQGDLNHFCNCNAIEYPFNYSSLKFCSALPSFSQR-VSCNNRLNDR--KCETELKNTVKQISCKAKACLIYNNDIVPSCKLPCSFYSYETDRSTSTWPTKSWQLQWISTKAAKPLLDKQELDNYRYAVKLQEKGNYSEALKILNKENTMEQKILAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLFSIWIGMTLFSIVEIFEM----FANCFWRFRKMFVKNGFTNDK 1722
            ++   E+  +F + TT  G  ++  +     R  W+   +     F    + L+ QY +  +    ++    +  FP  T+CN+           L    D I    N  +PR  + + N      F +  +L+ +       ++         +  V   H+ +D+++ C    +  +  +SKD      W +  +  + NCYMF+ ++            S+   +N  TL++ L  +E +   T           +++G  + I      P   +  I + PG  T I++  +  R   P   R    SN+       FG    YS   CK   +       C C       NY++       P   +R +   NRLN     C  +  +T +  SC  +            C   CS  S++   S++ WP +S+++    TK A           Y   V++  K   S +   +N EN     I  V +     +  LV+E    +  S LS  GG   +WIG++  +  E+ E+     AN   R +K+   N F  +K
Sbjct:    8 KETALEQINQFLQETTAHGFGRLGATAGSKWRLYWVMFCLAAYCVFVWQLVGLVNQYNSKPIKTRTQLKHAQKLDFPVVTICNMNVLRASRLPPKLRTKFDQIINNTNKTSPRNSSNSRN-----AFVDPQDLS-FEETKKFEILHAVTAHDDYRELVSAAHQLEDILLSCNFNGV--NCRNSKDPTIPTYWTQTWNDNFGNCYMFNSVKTHNGEKVDLYSSSVPGESNGLTLQLNLEQNEYLEGIT-----------EVAGMKVTISDQGVLPFPGQQGIRIMPGQSTGIQMTKLQTRRIDPFKNRSCESSNEMSDKNLFFGYNMTYSIMACKYSCLNARKIERCGCT------NYNT-------PEMQKRNIPLCNRLNSTIIDCLNKAYDTFEDGSCDRE------------CPPSCSEVSFDLTVSSARWPARSFEV----TKYA-----------YFLRVRVLNKIASSSSKYFVNSEN-----IAQVHVYYGELDYLLVQETLAYTFMSLLSDIGGQMGMWIGISALTCAELIELVCVILANMSNRSKKIVHINSFRPEK 509          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Medaka
Match: asic1a (acid-sensing ion channel 1 [Source:NCBI gene;Acc:101159102])

HSP 1 Score: 54.6842 bits (130), Expect = 2.204e-7
Identity = 103/530 (19.43%), Postives = 183/530 (34.53%), Query Frame = 1
Query:  154 FCENTTIRGVPKIIKSKHKPL-RYMWMTCFILLLSGFSVCFIFLLKQYFAYDVIHPPRILTNSQAPFPSFTVCNLRPLARNIDTIFKLKNLKTPREFAKNVNNYAIKYFYNKNNLTLYGHASSI----MLMGGYLESVPNKS---------------YVELGHKKQDLIIHCRVTYMIGSKPHSKDCDELGKWRRIIHAQYVNCYMFD--------LIESLSNATNTLEMFLYLDESINQATCIDCFS-SDVKSQLSGALILIHRSNTFPNFNRDMINLQPGTLTEIKLKTIHNRHKLPPYGRCSNKTPKWIKVFGELYAYSEDLCKLITIQGDLNHFCNCNAIEYPFNYSSLKFCSALPSFSQRVSCNNRLNDRKCETELKNTVKQISCKAKACLIYNNDIVPSCKLPCSFYSYETDRSTSTWPTKSWQLQWISTKAAKPLLDKQELDNYRYAVKLQEKGNYSEALKILNKENTMEQKILAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLFSIWIGMTLFSIVEIFE 1656
            F  ++T+ G+  I   +   + R +W+  F+  L+      +  +  Y  Y  +     +      FP+ T CNL                     F++   N     ++    L L  H   I    ++    LES+  K+               Y   GH  +D+++ C          H  +C   G ++ ++  +Y  CY F+        LI +     N LE+ L     I Q   +  +  +D  S  +G  + IH  +  P+ ++    + PG  T +  +     +  PP+G C   TP     F    +YS   C++      L   CNC  +  P       +CS                            K+ +  A   L+  ++    C+ PC+   Y  + S    P+K+         +AK L                       A K    E  ++  IL + I     N   +E+K+   +   L   GG   ++IG ++ +I+EIF+
Sbjct:   21 FAHSSTLHGIAHIFTYERLCIKRCLWLLVFLCSLTLLLYVCVDRIHYYLEYPHVTRLDEVATPIMTFPAITFCNLNAF-----------------RFSRVTRN---DLYHAGELLALLNHRYEIRDVHLVEESVLESLKVKADFHNFKPRPFNMREFYDRTGHDIKDMLLSCHF--------HGTEC-RPGDFK-VVFTRYGKCYTFNAGGDGRPPLITTKGGMGNGLELML----DIQQDEYLPVWGDTDETSFEAGVKVQIHSQDEPPSIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDC-KVTPMDSDFFD---SYSITACRVDCETRYLVDNCNCRMVYMP---GDAPYCSP------------------------ELYKECADPALDFLVQRDNDFCVCETPCNMTRYNKELSFVKIPSKA---------SAKYL-----------------------AKKYNKSEQYIKDNILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTILEIFD 453          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000028687.1 (SMESG000028687.1)

HSP 1 Score: 1195.65 bits (3092), Expect = 0.000e+0
Identity = 576/576 (100.00%), Postives = 576/576 (100.00%), Query Frame = 1
Query:  103 DHSHDEIRQVIKEEFLRFCENTTIRGVPKIIKSKHKPLRYMWMTCFILLLSGFSVCFIFLLKQYFAYDVIHPPRILTNSQAPFPSFTVCNLRPLARNIDTIFKLKNLKTPREFAKNVNNYAIKYFYNKNNLTLYGHASSIMLMGGYLESVPNKSYVELGHKKQDLIIHCRVTYMIGSKPHSKDCDELGKWRRIIHAQYVNCYMFDLIESLSNATNTLEMFLYLDESINQATCIDCFSSDVKSQLSGALILIHRSNTFPNFNRDMINLQPGTLTEIKLKTIHNRHKLPPYGRCSNKTPKWIKVFGELYAYSEDLCKLITIQGDLNHFCNCNAIEYPFNYSSLKFCSALPSFSQRVSCNNRLNDRKCETELKNTVKQISCKAKACLIYNNDIVPSCKLPCSFYSYETDRSTSTWPTKSWQLQWISTKAAKPLLDKQELDNYRYAVKLQEKGNYSEALKILNKENTMEQKILAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLFSIWIGMTLFSIVEIFEMFANCFWRFRKMFVKNGFTNDKNQASSLNEKNIILINPNVNLSHLYSNYNRPLIEHVV 1830
            DHSHDEIRQVIKEEFLRFCENTTIRGVPKIIKSKHKPLRYMWMTCFILLLSGFSVCFIFLLKQYFAYDVIHPPRILTNSQAPFPSFTVCNLRPLARNIDTIFKLKNLKTPREFAKNVNNYAIKYFYNKNNLTLYGHASSIMLMGGYLESVPNKSYVELGHKKQDLIIHCRVTYMIGSKPHSKDCDELGKWRRIIHAQYVNCYMFDLIESLSNATNTLEMFLYLDESINQATCIDCFSSDVKSQLSGALILIHRSNTFPNFNRDMINLQPGTLTEIKLKTIHNRHKLPPYGRCSNKTPKWIKVFGELYAYSEDLCKLITIQGDLNHFCNCNAIEYPFNYSSLKFCSALPSFSQRVSCNNRLNDRKCETELKNTVKQISCKAKACLIYNNDIVPSCKLPCSFYSYETDRSTSTWPTKSWQLQWISTKAAKPLLDKQELDNYRYAVKLQEKGNYSEALKILNKENTMEQKILAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLFSIWIGMTLFSIVEIFEMFANCFWRFRKMFVKNGFTNDKNQASSLNEKNIILINPNVNLSHLYSNYNRPLIEHVV
Sbjct:   32 DHSHDEIRQVIKEEFLRFCENTTIRGVPKIIKSKHKPLRYMWMTCFILLLSGFSVCFIFLLKQYFAYDVIHPPRILTNSQAPFPSFTVCNLRPLARNIDTIFKLKNLKTPREFAKNVNNYAIKYFYNKNNLTLYGHASSIMLMGGYLESVPNKSYVELGHKKQDLIIHCRVTYMIGSKPHSKDCDELGKWRRIIHAQYVNCYMFDLIESLSNATNTLEMFLYLDESINQATCIDCFSSDVKSQLSGALILIHRSNTFPNFNRDMINLQPGTLTEIKLKTIHNRHKLPPYGRCSNKTPKWIKVFGELYAYSEDLCKLITIQGDLNHFCNCNAIEYPFNYSSLKFCSALPSFSQRVSCNNRLNDRKCETELKNTVKQISCKAKACLIYNNDIVPSCKLPCSFYSYETDRSTSTWPTKSWQLQWISTKAAKPLLDKQELDNYRYAVKLQEKGNYSEALKILNKENTMEQKILAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLFSIWIGMTLFSIVEIFEMFANCFWRFRKMFVKNGFTNDKNQASSLNEKNIILINPNVNLSHLYSNYNRPLIEHVV 607          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000044381.1 (SMESG000044381.1)

HSP 1 Score: 656.366 bits (1692), Expect = 0.000e+0
Identity = 321/543 (59.12%), Postives = 408/543 (75.14%), Query Frame = 1
Query:  124 RQVIKEEFLRFCENTTIRGVPKIIKSKHKPLRYMWMTCFILLLSGFSVCFIFLLKQYFAYDVIHPPRILTNSQAPFPSFTVCNLRPLARNIDTIFKLKNLKTPREFAKNVNNYAIKYFYNKNNLTLYGHASSIMLMGGYLESVPNKSYVELGHKKQDLIIHCRVTYMIGSKPHSKDCDELGKWRRIIHAQYVNCYMFDLIESLSNATNTLEMFLYLDESINQATCIDCFSSDVKSQLSGALILIHRSNTFPNFNRDMINLQPGTLTEIKLKTIHNRHKLPPYGRCSNKTPKWIKVFGELYAYSEDLCKLITIQGDLNHFCNCNAIEYPFNYSSLKFCSALPSFSQRVSCNNRLNDRKCETELKNTVKQISCKAKACLIYNNDIVPSCKLPCSFYSYETDRSTSTWPTKSWQLQWISTKAAKPLLDKQELDNYRYAVKLQEKGNYSEALKILNKENTMEQKILAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLFSIWIGMTLFSIVEIFEMFANCFWRFRKMFVKNGFTNDKNQASSLNEKN 1752
            + + KEEFLRFCENTT+RGVP+I+KS+   +R++W+T FILL  GF VC IFL  QY  Y+VIHPPRIL++++APFPS TVCN RP+ RNI  I K +N+K PREFA ++N YAIKY+Y KN    Y  ASSIM MG YLESVPN+++ ELGH +QDLII+C+VTYM GS PH K C ++GKWR IIHAQY+NCY ++L E+ S  TNT+E++ YLD+ I  + C+DCFSSDVKSQLSGAL+LIHR  TFPNFN D+INLQPGTLTEIKLK  +N HK PPYGRCS K+PK +K++ +LY+YSE  CKL+TIQ D+N  C CNAIEYP +  +L FCS LP F +   C++  +D KC+ +L   VK+I CK+     Y  DIV SC LPC  YSYE+DRSTS+WPTK+WQ+ WI + AA+ L  K EL  Y  A +    G+ +++ +ILN++N +EQ +LAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGL SIWIG+T+ SIVE+ EM  NCF + +    +  F+  + Q  ++N+ N
Sbjct:   15 KTISKEEFLRFCENTTLRGVPRIVKSRKSHIRHLWLTFFILLFIGFMVCIIFLCYQYLEYNVIHPPRILSDNKAPFPSLTVCNYRPMKRNILEIMKKRNIKDPREFAHSINKYAIKYYYKKNLGKNYQRASSIMNMGAYLESVPNRTFNELGHDEQDLIIYCQVTYMNGSSPHYKVCSDIGKWRVIIHAQYINCYSYNLYENYSRNTNTMELYFYLDQGIPDSMCLDCFSSDVKSQLSGALVLIHRRLTFPNFNHDIINLQPGTLTEIKLKIFNNVHKEPPYGRCSYKSPKTMKIYNDLYSYSEHACKLLTIQHDINKQCGCNAIEYPIDNFNLSFCSNLPRFIEGKLCHDDQSDMKCKHQLDAVVKKIICKSNVSSQYQKDIVKSCSLPCDIYSYESDRSTSSWPTKTWQMPWIKSNAARRLRKKPELKGYIDAYREYLNGSVNKSFRILNQQNILEQNLLAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLCSIWIGLTMISIVEVIEMLLNCFSQLKTARKRKHFSARELQIQNINQNN 557          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000069611.1 (SMESG000069611.1)

HSP 1 Score: 546.199 bits (1406), Expect = 0.000e+0
Identity = 254/516 (49.22%), Postives = 364/516 (70.54%), Query Frame = 1
Query:  124 RQVIKEEFLRFCENTTIRGVPKIIKSKHKPLRYMWMTCFILLLSGFSVCFIFLLKQYFAYDVIHPPRILTNSQAPFPSFTVCNLRPLARNIDTIFKLKNLKTPREFAKNVNNYAIKYFYNKNNLTLYGHASSIMLMGGYLESVPNKSYVELGHKKQDLIIHCRVTYMIGSKPHSKDCDELGKWRRIIHAQYVNCYMFDLIESLSNATNTLEMFLYLDESINQATCIDCFSSDVKSQLSGALILIHRSNTFPNFNRDMINLQPGTLTEIKLKTIHNRHKLPPYGRCSNKTPKWIKVFGELYAYSEDLCKLITIQGDLNHFCNCNAIEYPFNYSSLKFCSALPSFSQRVSCNNRLNDR---KCETELKNTVKQISCKAKACLIYNNDIVPSCKLPCSFYSYETDRSTSTWPTKSWQLQWISTKAAKPLLDKQELDNYRYAVKLQEKGNYSEALKILNKENTMEQKILAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLFSIWIGMTLFSIVEIFEMF 1662
            ++++K E L FC+NTTIRGVP+I+ + +K  + +W++ FI L +G ++C  FL++Q+  Y VIHPPR+L NS +PFPSFTVCN RPL+ NI + F  +N++ PREFA   N  + KY +++ +   Y   +S   + GYLES+P + +  LGH   D +I C +T+  GSK H   C  +G+W+   HAQ++NC+ +++         T+E++LYL+E  N + CIDCF S+VKSQLSGAL++IH+SN+FPN N++ INLQPGTLTE++LKT  N  K  PYGRC   TP  +++  E Y+Y+E LCK  TIQ ++N+ C+CNAIEYP    +L FCSALP+F +  SC    +D+   KC  E+K ++K++ CK+   ++Y+NDI+ +C LPC +YSYE+DRS STWPTKSWQL W+++     +  K+EL  Y+ A +  ++G   +A++ILNK++ +E K++AV+INRPN N+H VEEKEVLSLTSFLSQ GGLFSIWIG+TL SIVEI E+ 
Sbjct:   48 KKLLKNELLHFCKNTTIRGVPRIVNTTNKSSKILWISFFIFLCAGLTICLTFLIRQFIEYSVIHPPRVLQNSPSPFPSFTVCNHRPLSYNISSFFNQRNMRNPREFAIAANYVSKKYLFDRGDKGHYSLITSSFSLSGYLESIPLEYHNMLGHDYYDFVIDCLITFRNGSKHHVDLCQNIGQWKVTPHAQFINCFSYNIKAEFIEEVTTIELYLYLNEETNVSRCIDCFISNVKSQLSGALLVIHKSNSFPNINQEAINLQPGTLTEVRLKTFFNVMKTAPYGRCKPNTPSNLEMGNETYSYTEHLCKEKTIQLEINNKCHCNAIEYPVVNRNLSFCSALPTFIKFGSCETNSHDKEQEKCFEEIKTSLKRLECKSSVTVLYHNDIIDTCFLPCEYYSYESDRSISTWPTKSWQLTWLNSSRGSNVRSKKELKPYKIAAEYFKEGKEDKAIEILNKQDILESKLIAVVINRPNKNLHRVEEKEVLSLTSFLSQLGGLFSIWIGLTLISIVEIIELL 563          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000037525.1 (SMESG000037525.1)

HSP 1 Score: 511.916 bits (1317), Expect = 6.935e-176
Identity = 249/504 (49.40%), Postives = 350/504 (69.44%), Query Frame = 1
Query:  127 QVIKEEFLRFCENTTIRGVPKIIKSKHKPLRYMWMTCFILLLSGFSVCFIFLLKQYFAYDVIHPPRILTNSQAPFPSFTVCNLRPLARNIDTIFKLKNLKTPREFAKNVNNYAIKYFYNKNNLTLYGHASSIMLMGGYLESVPNKSYV-ELGHKKQDLIIHCRVTYMIGSKPHSKDCDELGKWRRIIHAQYVNCYMFDLIESLSNATNTLEMFLYLDESINQATCIDCFSSDVKSQLSGALILIHRSNTFPNFNRDMINLQPGTLTEIKLKTIHNRHKLPPYGRCSNKTPKWIKVFGELYAYSEDLCKLITIQGDLNHFCNCNAIEYPFN-YSSLKFCSALPSFSQRVSC-------NNRLNDRKCETELKNTVKQISCKAKACLIYNNDIVPSCKLPCSFYSYETDRSTSTWPTKSWQLQWISTKAAKPLLDKQELDNYRYAVKLQEKGNYSEALKILNKENTMEQKILAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLFS 1611
            + +K+EFL FC+NTTIRGV +I+KS  K + ++W+  FI+L  G  VC I LL QY  Y+VIHPPR+L+N ++PFPSFT+CNLRPL+ ++ +    + L+ PREFA  +N YA+  +  KN+   Y  +++I  MGGYLES+PN SY  ELGH   +++I C+V Y+ G++P   +C  +G+WR I+H QY+NCY + L E  S  TNT+E+F+YL E +N   CIDCF S+VK+QLSGA ++IH   +FP+ N+  +NLQPGTLTE+KLKTI N  K PPYGRCS  T + + ++ E Y Y+E  CK +T Q  +N  C C AI++PFN  SS+ FC++LP F  + SC        N   D+ C ++++  +++I CK      Y+ D V  C LPC+FYSYETDRS S+WPTKS+ L+WI + AAK + +K EL  YR A+K+   GN + A  IL  +N +E+K++ ++IN+P+YN+H+VEEKEVLSLTSFLSQ+GGLFS
Sbjct:   68 ECMKKEFLLFCQNTTIRGVSRIVKSTDKKIFFLWLGFFIILCIGLLVCMILLLLQYLDYNVIHPPRVLSNKESPFPSFTICNLRPLSPDVRSFLANEKLRNPREFASRLNQYAVSRYLKKNDSFHYAASTAISSMGGYLESMPNTSYFKELGHGLDEMVIFCKVNYVDGNQPILDECPSVGRWRTILHPQYINCYSYVLYERFSLKTNTVELFVYLGEEVNTTECIDCFFSNVKTQLSGAALVIHNRASFPDINQYSVNLQPGTLTEVKLKTIKNIMKTPPYGRCSKYTQEHLYMYKEDYTYTEGACKFVTFQQKINEECKCIAIDFPFNESSSMPFCTSLPHFIHKKSCPSIKSKLTNVSLDKDCVSDIEKALERIICKNNVTRRYHGDRVEGCYLPCTFYSYETDRSISSWPTKSYHLKWIQSSAAKAIKNKPELKKYREAIKILNDGNEANAYDILASQNILEKKLVGIVINKPDYNLHVVEEKEVLSLTSFLSQSGGLFS 571          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000064187.1 (SMESG000064187.1)

HSP 1 Score: 508.064 bits (1307), Expect = 2.851e-174
Identity = 240/519 (46.24%), Postives = 351/519 (67.63%), Query Frame = 1
Query:  136 KEEFLRFCENTTIRGVPKIIKSKHKPLRYMWMTCFILLLSGFSVCFIFLLKQYFAYDVIHPPRILTNSQAPFPSFTVCNLRPLARNIDTIFKLKNLKTPREFAKNVNNYAIKYFYNKNNLTLYGHASSIMLMGGYLESVP-NKSYVELGHKKQDLIIHCRVTYMIGSKPHSKDCDE---LGKWRRIIHAQYVNCYMFDLIESLSNATNTLEMFLYLDESINQATCIDCFSSDVKSQLSGALILIHRSNTFPNFNRDMINLQPGTLTEIKLKTIHNRHKLPPYGRCSNKTPKWIKVFGELYAYSEDLCKLITIQGDLNHFCNCNAIEYPFNYSSLKFCSALPSFSQRVSCNNRLN-DRKCETELKNTVKQISCKAKACLIYNNDIVPSCKLPCSFYSYETDRSTSTWPTKSWQLQWISTKAAKP--LLDKQELDNYRYAVKLQEKGNYSEALKILNKENTMEQKILAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLFSIWIGMTLFSIVEIFEMFANC 1671
            +EE + FC++T+IRG+P I ++++K +R MW+     L+ G+ +C IFLL+QY  ++VIHPP+++ ++ +PFPS TVCNLRP++   + + +  + KTPR +A++ NNY I+Y   KN    Y   +  +    YLES+P N     LG+   + +I+C+++++ GS+  +  C      G WR+ IHAQY+NC+ FD+   L N   TLEMFLYLDE++N  TCIDCF +++KSQLSGA+I +H   TFPN N   IN+ PG+LTEI L+ I N  K PPYGRCS KTPK + ++G   +YSE  C+ ITIQ ++   C C AIEYPF  + + FCS++P F  + +C      +  C  ++   + +I CK      YN D+V SC LPCSF+SYETDRS STWPTK WQL+W++++ AK   +L++ E   YR  ++LQ+ G   EA+ +L + N +E+ +LA++I+RPN+N+H VEEKEVLSLTSFLSQ+GGLFSIW+G+T+ S+VE+ E+  NC
Sbjct:   42 REETILFCQSTSIRGIPHIFRARNKTVRVMWLFFVSALIIGWCICMIFLLRQYLEFNVIHPPQVIRDANSPFPSVTVCNLRPISPKGERVLQENSFKTPRNYAQDSNNYGIQYLLKKNKRKDYTTYTGTLNFPAYLESLPSNFERKSLGYNLSNFVINCQMSFLKGSQRSAVQCQAGTPYGTWRQFIHAQYLNCHTFDISPILQNNVTTLEMFLYLDENMNSNTCIDCFHAEIKSQLSGAVIAVHTPGTFPNINGRSINVTPGSLTEITLQNILNIQKAPPYGRCSPKTPKTVYMYGYNVSYSEFACRQITIQNEIIKKCGCRAIEYPFVSTDIPFCSSMPIFVPKRNCETPTAINSSCIKQMTIALNRIKCKISVINQYNKDVVESCSLPCSFHSYETDRSVSTWPTKLWQLEWLNSRVAKSFGMLNRTEFQPYRRIIELQKVGKEKEAMDLLYQTNVLERNLLALLIDRPNFNLHKVEEKEVLSLTSFLSQSGGLFSIWLGLTMISLVEVIELLVNC 560          
The following BLAST results are available for this feature:
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SCNN1B1.401e-1221.20sodium channel epithelial 1 beta subunit [Source:H... [more]
SCNN1B1.015e-1022.66sodium channel epithelial 1 beta subunit [Source:H... [more]
SCNN1B1.087e-1022.66sodium channel epithelial 1 beta subunit [Source:H... [more]
SCNN1D4.633e-720.60sodium channel epithelial 1 delta subunit [Source:... [more]
SCNN1D4.633e-720.60sodium channel epithelial 1 delta subunit [Source:... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
asic-23.805e-1420.35Degenerin-like protein asic-2 [Source:UniProtKB/S... [more]
del-44.246e-1222.08DEgenerin Like [Source:UniProtKB/TrEMBL;Acc:P9183... [more]
unc-87.305e-1020.42Degenerin unc-8 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
unc-87.757e-1020.42Degenerin unc-8 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
unc-89.130e-1020.42Degenerin unc-8 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
asic1c1.196e-720.75acid-sensing (proton-gated) ion channel 1c [Source... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scnn1b3.397e-1423.35sodium channel, non voltage gated 1 beta subunit [... [more]
lhx15.802e-1021.31LIM homeobox 1 [Source:Xenbase;Acc:XB-GENE-482482][more]
cdh126.425e-1021.68cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase... [more]
foxe31.006e-921.81forkhead box E3 [Source:Xenbase;Acc:XB-GENE-480592... [more]
cdh121.909e-820.57cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Scnn1b3.298e-1023.87sodium channel, nonvoltage-gated 1 beta [Source:MG... [more]
Scnn1a2.095e-722.99sodium channel, nonvoltage-gated 1 alpha [Source:M... [more]
Scnn1a2.203e-722.99sodium channel, nonvoltage-gated 1 alpha [Source:M... [more]
Scnn1a2.700e-722.99sodium channel, nonvoltage-gated 1 alpha [Source:M... [more]
Scnn1a2.700e-722.99sodium channel, nonvoltage-gated 1 alpha [Source:M... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q25011|FANA_CORAP9.920e-1921.65FMRFamide-activated amiloride-sensitive sodium cha... [more]
sp|Q22851|ASIC2_CAEEL4.841e-1320.35Degenerin-like protein asic-2 OS=Caenorhabditis el... [more]
sp|O13262|SCNNC_XENLA6.628e-1322.22Amiloride-sensitive sodium channel subunit beta-2 ... [more]
sp|P51169|SCNNB_XENLA2.904e-1222.08Amiloride-sensitive sodium channel subunit beta OS... [more]
sp|A5D7U4|SCNNB_BOVIN1.845e-1122.86Amiloride-sensitive sodium channel subunit beta OS... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4V3SD100.000e+047.01Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4E0S1731.036e-17345.97FMRFamide-activated amiloride-sensitive sodium cha... [more]
A0A158QSX45.092e-17346.93Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A564Y5L55.774e-17344.66Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A068W7J02.025e-17146.20FMRFamide activated amiloride sensitive sodium OS=... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
SCNN1B4.753e-1222.99sodium channel epithelial 1 beta subunit [Source:H... [more]
SCNN1A2.678e-721.47sodium channel epithelial 1 alpha subunit [Source:... [more]
SCNN1G1.070e-624.15sodium channel epithelial 1 gamma subunit [Source:... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO421378.780e-1520.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
asic1a2.204e-719.43acid-sensing ion channel 1 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000028687.10.000e+0100.00SMESG000028687.1[more]
SMESG000044381.10.000e+059.12SMESG000044381.1[more]
SMESG000069611.10.000e+049.22SMESG000069611.1[more]
SMESG000037525.16.935e-17649.40SMESG000037525.1[more]
SMESG000064187.12.851e-17446.24SMESG000064187.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035751 ID=SMED30035751|Name=FMRFamide-activated amiloride-sensitive sodium channel|organism=Schmidtea mediterranea sexual|type=transcript|length=1863bp
CCGATCTAAAATGAACAATTCACATGGATGTATAGAAGACTACAACAATA
CTCCGTGGTTAAGTAAAAAAATGAAGAAAATATTTCAAACAAAAGTAATA
ACGATCATTCACATGATGAAATACGACAAGTTATAAAAGAAGAGTTTCTG
AGATTTTGTGAAAATACCACAATCAGAGGCGTTCCGAAAATAATCAAATC
AAAACATAAGCCTTTGCGCTATATGTGGATGACATGTTTCATATTGTTGT
TATCCGGATTTTCAGTGTGTTTTATTTTCTTACTAAAACAATATTTTGCA
TATGATGTAATTCATCCTCCTAGAATTCTTACAAATAGCCAAGCTCCATT
TCCATCTTTTACTGTCTGTAACTTGCGTCCTTTAGCGAGAAATATTGACA
CTATATTCAAATTGAAAAATCTTAAAACCCCGAGAGAGTTTGCAAAAAAT
GTTAATAATTACGCAATAAAGTATTTTTATAACAAAAATAATTTAACGCT
TTATGGACATGCTTCAAGTATCATGTTAATGGGAGGGTATTTGGAAAGTG
TACCAAATAAATCCTATGTGGAACTTGGGCATAAGAAGCAAGATTTAATT
ATTCATTGTCGGGTAACGTATATGATTGGAAGTAAACCTCATTCTAAAGA
CTGTGATGAACTTGGAAAATGGCGTCGAATAATTCATGCGCAATATGTTA
ACTGTTATATGTTTGATTTAATCGAGTCTTTGAGCAATGCAACGAATACT
TTGGAAATGTTTCTCTATCTCGATGAGAGCATAAATCAGGCAACTTGTAT
AGATTGTTTTAGTAGTGATGTCAAATCCCAACTTTCCGGTGCTTTGATTT
TAATTCACCGAAGCAATACTTTTCCAAATTTCAATCGAGATATGATTAAT
CTGCAACCAGGCACTCTAACAGAGATTAAATTAAAGACCATACATAACCG
CCATAAATTACCACCGTATGGCCGATGCAGTAATAAAACCCCAAAATGGA
TAAAGGTCTTTGGTGAACTATATGCCTATAGTGAAGACTTATGTAAGCTA
ATTACAATTCAAGGAGACCTTAATCACTTTTGTAATTGTAATGCCATTGA
ATATCCATTTAACTATAGTTCACTAAAGTTTTGCAGTGCTCTACCTAGTT
TTAGTCAAAGAGTATCTTGTAATAACCGTTTAAATGATAGAAAATGTGAA
ACTGAATTAAAAAATACTGTAAAACAGATTTCTTGCAAAGCCAAGGCATG
TTTAATTTATAACAATGATATTGTACCGAGTTGCAAGTTACCATGTTCTT
TTTATTCCTATGAAACTGATAGATCTACATCAACTTGGCCAACCAAATCC
TGGCAACTTCAATGGATATCTACAAAAGCAGCTAAGCCATTGTTGGATAA
ACAAGAACTTGATAATTATAGATATGCTGTAAAATTACAAGAAAAAGGAA
ACTATTCTGAAGCGCTGAAGATTTTGAATAAAGAAAACACAATGGAACAA
AAAATCTTAGCAGTTATGATAAATAGACCAAATTACAATGTGCATCTTGT
AGAAGAAAAGGAAGTCTTATCACTAACCAGTTTTCTCAGTCAGGCAGGTG
GGTTGTTTAGTATTTGGATCGGCATGACTTTATTCAGCATCGTTGAAATT
TTCGAAATGTTCGCAAATTGCTTTTGGAGATTCAGGAAGATGTTCGTTAA
AAACGGCTTTACCAATGATAAAAATCAAGCATCAAGTCTAAATGAGAAAA
ACATAATACTTATTAATCCTAATGTAAATTTATCCCATTTGTATTCCAAT
TACAATCGTCCATTAATTGAACATGTGGTTTAGCACATTTCATTGTTAAT
TCATCAGATCGGA
back to top

protein sequence of SMED30035751-orf-1

>SMED30035751-orf-1 ID=SMED30035751-orf-1|Name=SMED30035751-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=537bp
MWMTCFILLLSGFSVCFIFLLKQYFAYDVIHPPRILTNSQAPFPSFTVCN
LRPLARNIDTIFKLKNLKTPREFAKNVNNYAIKYFYNKNNLTLYGHASSI
MLMGGYLESVPNKSYVELGHKKQDLIIHCRVTYMIGSKPHSKDCDELGKW
RRIIHAQYVNCYMFDLIESLSNATNTLEMFLYLDESINQATCIDCFSSDV
KSQLSGALILIHRSNTFPNFNRDMINLQPGTLTEIKLKTIHNRHKLPPYG
RCSNKTPKWIKVFGELYAYSEDLCKLITIQGDLNHFCNCNAIEYPFNYSS
LKFCSALPSFSQRVSCNNRLNDRKCETELKNTVKQISCKAKACLIYNNDI
VPSCKLPCSFYSYETDRSTSTWPTKSWQLQWISTKAAKPLLDKQELDNYR
YAVKLQEKGNYSEALKILNKENTMEQKILAVMINRPNYNVHLVEEKEVLS
LTSFLSQAGGLFSIWIGMTLFSIVEIFEMFANCFWRFRKMFVKNGFTNDK
NQASSLNEKNIILINPNVNLSHLYSNYNRPLIEHVV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001873ENaC
Vocabulary: molecular function
TermDefinition
GO:0005272sodium channel activity
Vocabulary: biological process
TermDefinition
GO:0006814sodium ion transport
GO:0006810transport
GO:0006811ion transport
GO:0035725sodium ion transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..25
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..43
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 26..43