RING-type domain-containing protein

Overview
NameRING-type domain-containing protein
Smed IDSMED30035739
Length (bp)486
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RING-type domain-containing protein (SMED30035739) t-SNE clustered cells

Violin plots show distribution of expression levels for RING-type domain-containing protein (SMED30035739) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RING-type domain-containing protein (SMED30035739) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RING-type domain-containing protein (SMED30035739) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035739

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30035739SMESG000019968.1 SMESG000019776.1 SMESG000019761.1 SMESG000010348.1 SMESG000010322.1 SMESG000043474.1 SMESG000019959.1 SMESG000010604.1 SMESG000010368.1 SMESG000010333.1 SMESG000010321.1 Contig2221GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Smed sexual biotypeSMED30035739SMESG000065721.1 SMESG000065719.1 Contig21413newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035739SMESG000065721.1 SMESG000065719.1 Contig21413uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30035739SMESG000065721.1 dd_Smed_v6_10104_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: MIB2 (mindbomb E3 ubiquitin protein ligase 2 [Source:HGNC Symbol;Acc:HGNC:30577])

HSP 1 Score: 48.521 bits (114), Expect = 1.555e-6
Identity = 18/47 (38.30%), Postives = 24/47 (51.06%), Query Frame = 3
Query:  246 ERAKCNVCKKNQMNIAFQCGHSTCNTCSNKLLECPFCYTEIVTRTEI 386
            ER  C +C  + + + FQCGH  C  C + L  CP C   I  R +I
Sbjct: 1022 ERITCPICIDSHIRLVFQCGHGACAPCGSALSACPICRQPIRDRIQI 1068          
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: MIB2 (mindbomb E3 ubiquitin protein ligase 2 [Source:HGNC Symbol;Acc:HGNC:30577])

HSP 1 Score: 48.521 bits (114), Expect = 1.583e-6
Identity = 18/47 (38.30%), Postives = 24/47 (51.06%), Query Frame = 3
Query:  246 ERAKCNVCKKNQMNIAFQCGHSTCNTCSNKLLECPFCYTEIVTRTEI 386
            ER  C +C  + + + FQCGH  C  C + L  CP C   I  R +I
Sbjct: 1008 ERITCPICIDSHIRLVFQCGHGACAPCGSALSACPICRQPIRDRIQI 1054          
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: MIB2 (mindbomb E3 ubiquitin protein ligase 2 [Source:HGNC Symbol;Acc:HGNC:30577])

HSP 1 Score: 48.521 bits (114), Expect = 1.584e-6
Identity = 18/47 (38.30%), Postives = 24/47 (51.06%), Query Frame = 3
Query:  246 ERAKCNVCKKNQMNIAFQCGHSTCNTCSNKLLECPFCYTEIVTRTEI 386
            ER  C +C  + + + FQCGH  C  C + L  CP C   I  R +I
Sbjct: 1018 ERITCPICIDSHIRLVFQCGHGACAPCGSALSACPICRQPIRDRIQI 1064          
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: MIB2 (mindbomb E3 ubiquitin protein ligase 2 [Source:HGNC Symbol;Acc:HGNC:30577])

HSP 1 Score: 48.521 bits (114), Expect = 1.584e-6
Identity = 18/47 (38.30%), Postives = 24/47 (51.06%), Query Frame = 3
Query:  246 ERAKCNVCKKNQMNIAFQCGHSTCNTCSNKLLECPFCYTEIVTRTEI 386
            ER  C +C  + + + FQCGH  C  C + L  CP C   I  R +I
Sbjct:  921 ERITCPICIDSHIRLVFQCGHGACAPCGSALSACPICRQPIRDRIQI 967          
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: MIB2 (mindbomb E3 ubiquitin protein ligase 2 [Source:HGNC Symbol;Acc:HGNC:30577])

HSP 1 Score: 48.1358 bits (113), Expect = 1.732e-6
Identity = 18/47 (38.30%), Postives = 24/47 (51.06%), Query Frame = 3
Query:  246 ERAKCNVCKKNQMNIAFQCGHSTCNTCSNKLLECPFCYTEIVTRTEI 386
            ER  C +C  + + + FQCGH  C  C + L  CP C   I  R +I
Sbjct:  871 ERITCPICIDSHIRLVFQCGHGACAPCGSALSACPICRQPIRDRIQI 917          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:ZFIN;Acc:ZDB-GENE-050628-1])

HSP 1 Score: 49.6766 bits (117), Expect = 4.004e-7
Identity = 19/47 (40.43%), Postives = 27/47 (57.45%), Query Frame = 3
Query:  246 ERAKCNVCKKNQMNIAFQCGHSTCNTCSNKLLECPFCYTEIVTRTEI 386
            ER  C +C  N + + FQCGH++C  CS+ L  CP C   I  R ++
Sbjct:  841 ERITCPICIDNHIRLVFQCGHASCIDCSSALKTCPICRQTIRERIQL 887          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 45.8246 bits (107), Expect = 8.125e-6
Identity = 18/44 (40.91%), Postives = 23/44 (52.27%), Query Frame = 3
Query:  246 ERAKCNVCKKNQMNIAFQCGHSTCNTCSNKLLECPFCYTEIVTR 377
            E+  C VC     N+ F CGH TC  C +++ ECP C   I  R
Sbjct:  994 EQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERR 1037          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 45.4394 bits (106), Expect = 9.095e-6
Identity = 18/44 (40.91%), Postives = 23/44 (52.27%), Query Frame = 3
Query:  246 ERAKCNVCKKNQMNIAFQCGHSTCNTCSNKLLECPFCYTEIVTR 377
            E+  C VC     N+ F CGH TC  C +++ ECP C   I  R
Sbjct:  983 EQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERR 1026          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 45.4394 bits (106), Expect = 9.189e-6
Identity = 18/44 (40.91%), Postives = 23/44 (52.27%), Query Frame = 3
Query:  246 ERAKCNVCKKNQMNIAFQCGHSTCNTCSNKLLECPFCYTEIVTR 377
            E+  C VC     N+ F CGH TC  C +++ ECP C   I  R
Sbjct:  991 EQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERR 1034          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: coa7 (cytochrome c oxidase assembly factor 7 (putative) [Source:Xenbase;Acc:XB-GENE-6258829])

HSP 1 Score: 51.2174 bits (121), Expect = 1.444e-7
Identity = 20/47 (42.55%), Postives = 25/47 (53.19%), Query Frame = 3
Query:  246 ERAKCNVCKKNQMNIAFQCGHSTCNTCSNKLLECPFCYTEIVTRTEI 386
            ER  C +C  N + + FQCGH +C  CS  L  CP C   I  R +I
Sbjct:  904 ERITCPICIDNHIKLVFQCGHGSCTECSTSLTACPICRQLIRERIQI 950          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: coa7 (cytochrome c oxidase assembly factor 7 (putative) [Source:Xenbase;Acc:XB-GENE-6258829])

HSP 1 Score: 51.2174 bits (121), Expect = 1.553e-7
Identity = 20/47 (42.55%), Postives = 25/47 (53.19%), Query Frame = 3
Query:  246 ERAKCNVCKKNQMNIAFQCGHSTCNTCSNKLLECPFCYTEIVTRTEI 386
            ER  C +C  N + + FQCGH +C  CS  L  CP C   I  R +I
Sbjct:  875 ERITCPICIDNHIKLVFQCGHGSCTECSTSLTACPICRQLIRERIQI 921          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: coa7 (cytochrome c oxidase assembly factor 7 (putative) [Source:Xenbase;Acc:XB-GENE-6258829])

HSP 1 Score: 51.2174 bits (121), Expect = 1.558e-7
Identity = 20/47 (42.55%), Postives = 25/47 (53.19%), Query Frame = 3
Query:  246 ERAKCNVCKKNQMNIAFQCGHSTCNTCSNKLLECPFCYTEIVTRTEI 386
            ER  C +C  N + + FQCGH +C  CS  L  CP C   I  R +I
Sbjct:  900 ERITCPICIDNHIKLVFQCGHGSCTECSTSLTACPICRQLIRERIQI 946          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: coa7 (cytochrome c oxidase assembly factor 7 (putative) [Source:Xenbase;Acc:XB-GENE-6258829])

HSP 1 Score: 51.2174 bits (121), Expect = 1.588e-7
Identity = 20/47 (42.55%), Postives = 25/47 (53.19%), Query Frame = 3
Query:  246 ERAKCNVCKKNQMNIAFQCGHSTCNTCSNKLLECPFCYTEIVTRTEI 386
            ER  C +C  N + + FQCGH +C  CS  L  CP C   I  R +I
Sbjct:  903 ERITCPICIDNHIKLVFQCGHGSCTECSTSLTACPICRQLIRERIQI 949          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: coa7 (cytochrome c oxidase assembly factor 7 (putative) [Source:Xenbase;Acc:XB-GENE-6258829])

HSP 1 Score: 50.8322 bits (120), Expect = 1.783e-7
Identity = 20/47 (42.55%), Postives = 25/47 (53.19%), Query Frame = 3
Query:  246 ERAKCNVCKKNQMNIAFQCGHSTCNTCSNKLLECPFCYTEIVTRTEI 386
            ER  C +C  N + + FQCGH +C  CS  L  CP C   I  R +I
Sbjct:  913 ERITCPICIDNHIKLVFQCGHGSCTECSTSLTACPICRQLIRERIQI 959          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:MGI Symbol;Acc:MGI:2679684])

HSP 1 Score: 46.595 bits (109), Expect = 4.015e-6
Identity = 18/47 (38.30%), Postives = 23/47 (48.94%), Query Frame = 3
Query:  246 ERAKCNVCKKNQMNIAFQCGHSTCNTCSNKLLECPFCYTEIVTRTEI 386
            ER  C +C  + + + FQCGH  C  C   L  CP C   I  R +I
Sbjct:  873 ERITCPICIDSHIRLVFQCGHGACAPCGAALNACPICRQPIRDRIQI 919          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5ZIJ9|MIB2_CHICK (E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus OX=9031 GN=MIB2 PE=2 SV=1)

HSP 1 Score: 50.447 bits (119), Expect = 1.356e-6
Identity = 20/47 (42.55%), Postives = 26/47 (55.32%), Query Frame = 3
Query:  246 ERAKCNVCKKNQMNIAFQCGHSTCNTCSNKLLECPFCYTEIVTRTEI 386
            ER  C +C  +Q+ + FQCGH +C  CS  L  CP C   I  R +I
Sbjct:  906 ERITCPICIDDQIKLVFQCGHGSCPDCSTALTVCPICRQAIRERIQI 952          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q96AX9|MIB2_HUMAN (E3 ubiquitin-protein ligase MIB2 OS=Homo sapiens OX=9606 GN=MIB2 PE=1 SV=3)

HSP 1 Score: 48.521 bits (114), Expect = 7.357e-6
Identity = 18/47 (38.30%), Postives = 24/47 (51.06%), Query Frame = 3
Query:  246 ERAKCNVCKKNQMNIAFQCGHSTCNTCSNKLLECPFCYTEIVTRTEI 386
            ER  C +C  + + + FQCGH  C  C + L  CP C   I  R +I
Sbjct:  965 ERITCPICIDSHIRLVFQCGHGACAPCGSALSACPICRQPIRDRIQI 1011          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: A0A2I0VBU9 (E3 ubiquitin-protein ligase RGLG1 OS=Dendrobium catenatum OX=906689 GN=RGLG1 PE=4 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 2.165e-6
Identity = 24/47 (51.06%), Postives = 29/47 (61.70%), Query Frame = 3
Query:  246 ERAKCNVCKKNQMNIAFQCGHSTCNTCSNKLLECPFCYTEIVTRTEI 386
            E+A C +C  N  N+AF CGH TC  C   LL CP C +EIVTR  +
Sbjct:  404 EQASCPICLTNPKNLAFGCGHQTCYDCGQSLLTCPICRSEIVTRIRL 450          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: A0A4D9C6A4 (E3 ubiquitin-protein ligase RGLG OS=Salvia splendens OX=180675 GN=RGLG PE=4 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 6.142e-6
Identity = 21/44 (47.73%), Postives = 27/44 (61.36%), Query Frame = 3
Query:  255 KCNVCKKNQMNIAFQCGHSTCNTCSNKLLECPFCYTEIVTRTEI 386
            KC VC  +Q  +A  CGH TC  C  +L +CP C+TEI TR  +
Sbjct:  632 KCPVCYDSQRELALGCGHQTCRDCGEELSQCPLCWTEITTRIRL 675          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: A0A2K3E5F7 (RING-type domain-containing protein OS=Chlamydomonas reinhardtii OX=3055 GN=CHLRE_01g011600v5 PE=4 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 7.444e-6
Identity = 23/76 (30.26%), Postives = 38/76 (50.00%), Query Frame = 3
Query:  159 QRIIDACTDRDAKSEIERFHKNNAKPPDNERAKCNVCKKNQMNIAFQCGHSTCNTCSNKLLECPFCYTEIVTRTEI 386
            +R ++A +     + I+R      +  ++E+A C VC +    + F CGH +C  CS K+  CPFC   I  R  +
Sbjct:  901 ERKLEASSRSVRDALIQRKIDEAQRRSNSEQAACAVCMEGPKAVVFNCGHQSCEACSGKMSSCPFCRVAITARIRL 976          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: A0A401T4Z9 (Uncharacterized protein OS=Chiloscyllium punctatum OX=137246 GN=chiPu_0016215 PE=4 SV=1)

HSP 1 Score: 55.0694 bits (131), Expect = 9.912e-6
Identity = 29/82 (35.37%), Postives = 38/82 (46.34%), Query Frame = 3
Query:  186 RDAKSEIERFHKNNAKPPDN---------------ERAKCNVCKKNQMNIAFQCGHSTCNTCSNKLLECPFCYTEIVTRTEI 386
            R   +E+E    +NA+PPD                ER  C +C  NQ+ + FQCGH +C  CS  L  CP C   I  R +I
Sbjct:  813 RHDNTEVES--SSNAEPPDQRKLLEQLQSRYRQMEERITCPICIDNQIKLVFQCGHGSCLECSVALKACPICRQNIRERIQI 892          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:103034310])

HSP 1 Score: 51.6026 bits (122), Expect = 7.229e-8
Identity = 20/47 (42.55%), Postives = 27/47 (57.45%), Query Frame = 3
Query:  246 ERAKCNVCKKNQMNIAFQCGHSTCNTCSNKLLECPFCYTEIVTRTEI 386
            ER  C +C  NQ+ + FQCGH++C  CS  L  CP C   I  R ++
Sbjct:  899 ERITCPICIDNQIKLVFQCGHASCIDCSAALKTCPICRQTIRERIQL 945          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:103034310])

HSP 1 Score: 51.6026 bits (122), Expect = 7.423e-8
Identity = 20/47 (42.55%), Postives = 27/47 (57.45%), Query Frame = 3
Query:  246 ERAKCNVCKKNQMNIAFQCGHSTCNTCSNKLLECPFCYTEIVTRTEI 386
            ER  C +C  NQ+ + FQCGH++C  CS  L  CP C   I  R ++
Sbjct:  969 ERITCPICIDNQIKLVFQCGHASCIDCSAALKTCPICRQTIRERIQL 1015          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:103034310])

HSP 1 Score: 51.2174 bits (121), Expect = 8.559e-8
Identity = 20/47 (42.55%), Postives = 27/47 (57.45%), Query Frame = 3
Query:  246 ERAKCNVCKKNQMNIAFQCGHSTCNTCSNKLLECPFCYTEIVTRTEI 386
            ER  C +C  NQ+ + FQCGH++C  CS  L  CP C   I  R ++
Sbjct:  963 ERITCPICIDNQIKLVFQCGHASCIDCSAALKTCPICRQTIRERIQL 1009          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 45.8246 bits (107), Expect = 7.009e-6
Identity = 18/44 (40.91%), Postives = 23/44 (52.27%), Query Frame = 3
Query:  246 ERAKCNVCKKNQMNIAFQCGHSTCNTCSNKLLECPFCYTEIVTR 377
            E+  C VC     N+ F CGH TC  C +++ ECP C   I  R
Sbjct:  980 EQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERR 1023          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 45.4394 bits (106), Expect = 7.764e-6
Identity = 18/44 (40.91%), Postives = 23/44 (52.27%), Query Frame = 3
Query:  246 ERAKCNVCKKNQMNIAFQCGHSTCNTCSNKLLECPFCYTEIVTR 377
            E+  C VC     N+ F CGH TC  C +++ ECP C   I  R
Sbjct:  959 EQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERR 1002          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:101175479])

HSP 1 Score: 50.0618 bits (118), Expect = 2.286e-7
Identity = 19/47 (40.43%), Postives = 26/47 (55.32%), Query Frame = 3
Query:  246 ERAKCNVCKKNQMNIAFQCGHSTCNTCSNKLLECPFCYTEIVTRTEI 386
            ER  C +C  N + + FQCGH++C  CS  L  CP C   I  R ++
Sbjct: 1036 ERITCPICIDNHIKLVFQCGHASCIECSAALKTCPICRQTIRERIQL 1082          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:101175479])

HSP 1 Score: 49.6766 bits (117), Expect = 2.969e-7
Identity = 19/47 (40.43%), Postives = 26/47 (55.32%), Query Frame = 3
Query:  246 ERAKCNVCKKNQMNIAFQCGHSTCNTCSNKLLECPFCYTEIVTRTEI 386
            ER  C +C  N + + FQCGH++C  CS  L  CP C   I  R ++
Sbjct:  980 ERITCPICIDNHIKLVFQCGHASCIECSAALKTCPICRQTIRERIQL 1026          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:101158637])

HSP 1 Score: 45.4394 bits (106), Expect = 7.653e-6
Identity = 18/44 (40.91%), Postives = 23/44 (52.27%), Query Frame = 3
Query:  246 ERAKCNVCKKNQMNIAFQCGHSTCNTCSNKLLECPFCYTEIVTR 377
            E+  C VC     N+ F CGH TC  C +++ ECP C   I  R
Sbjct:  973 EQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERR 1016          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000065721.1 (SMESG000065721.1)

HSP 1 Score: 251.521 bits (641), Expect = 2.882e-78
Identity = 121/127 (95.28%), Postives = 123/127 (96.85%), Query Frame = 3
Query:    6 DSEDEGGTCALTQLFEKISISNNTNFKRKLISAINTIILLGGEICKVTSRGQRIIDACTDRDAKSEIERFHKNNAKPPDNERAKCNVCKKNQMNIAFQCGHSTCNTCSNKLLECPFCYTEIVTRTEI 386
            DSED+ G CA+TQL EKISISNNTNFKRKLISAINTIILLGGEICKVTSRGQRIIDACTDRDAKSEIERFHKNNAKPPDNERAKCNV KKNQMNIAFQCGHSTCNTCSNKLLECPFCYTEIVTRTEI
Sbjct:  941 DSEDKRGKCAMTQLLEKISISNNTNFKRKLISAINTIILLGGEICKVTSRGQRIIDACTDRDAKSEIERFHKNNAKPPDNERAKCNVFKKNQMNIAFQCGHSTCNTCSNKLLECPFCYTEIVTRTEI 1067          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000065721.1 (SMESG000065721.1)

HSP 1 Score: 251.521 bits (641), Expect = 2.882e-78
Identity = 121/127 (95.28%), Postives = 123/127 (96.85%), Query Frame = 3
Query:    6 DSEDEGGTCALTQLFEKISISNNTNFKRKLISAINTIILLGGEICKVTSRGQRIIDACTDRDAKSEIERFHKNNAKPPDNERAKCNVCKKNQMNIAFQCGHSTCNTCSNKLLECPFCYTEIVTRTEI 386
            DSED+ G CA+TQL EKISISNNTNFKRKLISAINTIILLGGEICKVTSRGQRIIDACTDRDAKSEIERFHKNNAKPPDNERAKCNV KKNQMNIAFQCGHSTCNTCSNKLLECPFCYTEIVTRTEI
Sbjct:  941 DSEDKRGKCAMTQLLEKISISNNTNFKRKLISAINTIILLGGEICKVTSRGQRIIDACTDRDAKSEIERFHKNNAKPPDNERAKCNVFKKNQMNIAFQCGHSTCNTCSNKLLECPFCYTEIVTRTEI 1067          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000019776.1 (SMESG000019776.1)

HSP 1 Score: 187.963 bits (476), Expect = 9.593e-57
Identity = 92/135 (68.15%), Postives = 106/135 (78.52%), Query Frame = 3
Query:    3 CDSEDEGGTCALTQLFEKISISNNTNFKRKLISAINTIILLGGEICKVTSRGQ-RIIDACTDRDAKSEIERFHKNNAKP------PDNERAKCNVCKKNQMNIAFQCGHSTCNTCSNKLLECPFCYTEIVTRTEI 386
            CDSEDEGGTCALTQL  KISISNN NFKRKLI AI +II LGG+I K+TSRGQ RIIDACTD  AK EIER+H+NN KP      PDNE A C +C+  Q+NI FQCGH TC+ CS++L ECPFC  +IVTRT++
Sbjct:  494 CDSEDEGGTCALTQLLVKISISNNVNFKRKLILAIKSIISLGGDIYKMTSRGQHRIIDACTDSVAKEEIERYHRNNTKPSTEENKPDNEIAMCKICQNKQVNIGFQCGHLTCDLCSDQLFECPFCKADIVTRTKM 628          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000019776.1 (SMESG000019776.1)

HSP 1 Score: 187.578 bits (475), Expect = 1.136e-56
Identity = 92/135 (68.15%), Postives = 106/135 (78.52%), Query Frame = 3
Query:    3 CDSEDEGGTCALTQLFEKISISNNTNFKRKLISAINTIILLGGEICKVTSRGQ-RIIDACTDRDAKSEIERFHKNNAKP------PDNERAKCNVCKKNQMNIAFQCGHSTCNTCSNKLLECPFCYTEIVTRTEI 386
            CDSEDEGGTCALTQL  KISISNN NFKRKLI AI +II LGG+I K+TSRGQ RIIDACTD  AK EIER+H+NN KP      PDNE A C +C+  Q+NI FQCGH TC+ CS++L ECPFC  +IVTRT++
Sbjct:  492 CDSEDEGGTCALTQLLVKISISNNVNFKRKLILAIKSIISLGGDIYKMTSRGQHRIIDACTDSVAKEEIERYHRNNTKPSTEENKPDNEIAMCKICQNKQVNIGFQCGHLTCDLCSDQLFECPFCKADIVTRTKM 626          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000019761.1 (SMESG000019761.1)

HSP 1 Score: 187.193 bits (474), Expect = 1.369e-55
Identity = 92/135 (68.15%), Postives = 106/135 (78.52%), Query Frame = 3
Query:    3 CDSEDEGGTCALTQLFEKISISNNTNFKRKLISAINTIILLGGEICKVTSRGQ-RIIDACTDRDAKSEIERFHKNNAKP------PDNERAKCNVCKKNQMNIAFQCGHSTCNTCSNKLLECPFCYTEIVTRTEI 386
            CDSEDEGGTCALTQL EKIS SNN NFKRKLI++I +IIL GG+I K+TSRGQ RIIDACTD  AK EIER+H+NN KP      PDNE A CN+CK  Q+NI FQCGH TC+ CS++L ECPFC   I TRT++
Sbjct:  709 CDSEDEGGTCALTQLLEKISTSNNVNFKRKLIASIKSIILSGGDIYKMTSRGQHRIIDACTDSVAKEEIERYHRNNTKPSTEENKPDNEIAMCNICKDKQVNIGFQCGHLTCDLCSDQLFECPFCKAGIFTRTKM 843          
The following BLAST results are available for this feature:
BLAST of RING-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MIB21.555e-638.30mindbomb E3 ubiquitin protein ligase 2 [Source:HGN... [more]
MIB21.583e-638.30mindbomb E3 ubiquitin protein ligase 2 [Source:HGN... [more]
MIB21.584e-638.30mindbomb E3 ubiquitin protein ligase 2 [Source:HGN... [more]
MIB21.584e-638.30mindbomb E3 ubiquitin protein ligase 2 [Source:HGN... [more]
MIB21.732e-638.30mindbomb E3 ubiquitin protein ligase 2 [Source:HGN... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
mib24.004e-740.43mindbomb E3 ubiquitin protein ligase 2 [Source:ZFI... [more]
mib18.125e-640.91mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib19.095e-640.91mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib19.189e-640.91mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
coa71.444e-742.55cytochrome c oxidase assembly factor 7 (putative) ... [more]
coa71.553e-742.55cytochrome c oxidase assembly factor 7 (putative) ... [more]
coa71.558e-742.55cytochrome c oxidase assembly factor 7 (putative) ... [more]
coa71.588e-742.55cytochrome c oxidase assembly factor 7 (putative) ... [more]
coa71.783e-742.55cytochrome c oxidase assembly factor 7 (putative) ... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Mib24.015e-638.30mindbomb E3 ubiquitin protein ligase 2 [Source:MGI... [more]
back to top
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q5ZIJ9|MIB2_CHICK1.356e-642.55E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus ... [more]
sp|Q96AX9|MIB2_HUMAN7.357e-638.30E3 ubiquitin-protein ligase MIB2 OS=Homo sapiens O... [more]
back to top
BLAST of RING-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 4
Match NameE-valueIdentityDescription
A0A2I0VBU92.165e-651.06E3 ubiquitin-protein ligase RGLG1 OS=Dendrobium ca... [more]
A0A4D9C6A46.142e-647.73E3 ubiquitin-protein ligase RGLG OS=Salvia splende... [more]
A0A2K3E5F77.444e-630.26RING-type domain-containing protein OS=Chlamydomon... [more]
A0A401T4Z99.912e-635.37Uncharacterized protein OS=Chiloscyllium punctatum... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mib27.229e-842.55mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
mib27.423e-842.55mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
mib28.559e-842.55mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
mib17.009e-640.91mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib17.764e-640.91mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
mib22.286e-740.43mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
mib22.969e-740.43mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
mib17.653e-640.91mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
back to top
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000065721.12.882e-7895.28SMESG000065721.1[more]
SMESG000065721.12.882e-7895.28SMESG000065721.1[more]
SMESG000019776.19.593e-5768.15SMESG000019776.1[more]
SMESG000019776.11.136e-5668.15SMESG000019776.1[more]
SMESG000019761.11.369e-5568.15SMESG000019761.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035739 ID=SMED30035739|Name=RING-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=486bp
ATTGTGATAGTGAGGATGAAGGCGGTACATGTGCACTGACGCAATTATTT
GAGAAAATATCGATTTCCAATAATACAAATTTTAAAAGGAAATTAATTTC
AGCTATTAATACAATAATCTTATTGGGTGGTGAAATTTGTAAGGTGACGT
CACGTGGCCAGCGAATTATTGATGCGTGCACTGACAGAGATGCTAAGTCA
GAAATCGAGAGATTTCACAAAAATAATGCCAAACCACCTGATAATGAAAG
AGCAAAATGCAATGTATGTAAGAAAAATCAGATGAATATTGCATTCCAAT
GTGGCCATTCGACATGCAATACCTGTTCCAATAAGTTATTAGAATGTCCT
TTCTGTTACACTGAAATTGTCACTAGGACAGAAATTTTTTTCAGTTAATT
TTTGGAATTTTAAACTCATTTTCATCGACTTTTTCAATAATTATTAACTT
TATTGACATTTTGTGCACAATAAATTATTGATAAAA
back to top

protein sequence of SMED30035739-orf-1

>SMED30035739-orf-1 ID=SMED30035739-orf-1|Name=SMED30035739-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=132bp
CDSEDEGGTCALTQLFEKISISNNTNFKRKLISAINTIILLGGEICKVTS
RGQRIIDACTDRDAKSEIERFHKNNAKPPDNERAKCNVCKKNQMNIAFQC
GHSTCNTCSNKLLECPFCYTEIVTRTEIFFS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR013083Znf_RING/FYVE/PHD
IPR001841Znf_RING
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0004842ubiquitin-protein transferase activity
GO:0016740transferase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0009611response to wounding
GO:0009867jasmonic acid mediated signaling pathway
GO:0016567protein ubiquitination
GO:0042742defense response to bacterium
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 56..129
e-value: 1.1E-8
score: 36.4