14-3-3 protein epsilon

Overview
Name14-3-3 protein epsilon
Smed IDSMED30035734
Length (bp)1076
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 14-3-3 protein epsilon (SMED30035734) t-SNE clustered cells

Violin plots show distribution of expression levels for 14-3-3 protein epsilon (SMED30035734) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 14-3-3 protein epsilon (SMED30035734) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 14-3-3 protein epsilon (SMED30035734) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035734

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30035734h1SMcG0014768 SmedASXL_009586SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30035734h1SMcG0014768 Contig49704newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035734h1SMcG0014768 Contig49704uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30035734h1SMcG0014768 dd_Smed_v4_1702_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30035734h1SMcG0014768 dd_Smed_v4_1702_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30035734h1SMcG0014768 dd_Smed_v4_1702_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035734h1SMcG0014768 dd_Smed_v4_1702_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035734h1SMcG0014768 dd_Smed_v4_1702_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30035734h1SMcG0014768 dd_Smed_v4_1702_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cilated neuronSMED30035734h1SMcG0014768 dd_Smed_v4_1702_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30035734h1SMcG0014768 dd_Smed_v6_1702_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30035734h1SMcG0014768 OX_Smed_1.0.02909ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30035734h1SMcG0014768 dd_Smed_v4_1702_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 14-3-3 protein epsilon vs. Ensembl Human
Match: YWHAE (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein epsilon [Source:HGNC Symbol;Acc:HGNC:12851])

HSP 1 Score: 310.457 bits (794), Expect = 3.804e-105
Identity = 172/235 (73.19%), Postives = 201/235 (85.53%), Query Frame = 3
Query:   99 MGDREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPE-KLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDM 800
            M DRE+ VY+AKLAEQAERY+EMV++M++VA M+ +LTVEERNLLSVAYKNVIG+RRASWRIISSIEQK E K  E KL +I+++R+ +E EL  +C DI+ VLD +L+ +A   E++VF+ KMKGDY+RYLAEF    +RK+AAENSL AYK AS IA +EL PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAIAELD LSEESYKDSTLIMQLLRDNLTLWTSDM
Sbjct:    1 MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDM 235          
BLAST of 14-3-3 protein epsilon vs. Ensembl Human
Match: YWHAE (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein epsilon [Source:HGNC Symbol;Acc:HGNC:12851])

HSP 1 Score: 310.457 bits (794), Expect = 3.804e-105
Identity = 172/235 (73.19%), Postives = 201/235 (85.53%), Query Frame = 3
Query:   99 MGDREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPE-KLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDM 800
            M DRE+ VY+AKLAEQAERY+EMV++M++VA M+ +LTVEERNLLSVAYKNVIG+RRASWRIISSIEQK E K  E KL +I+++R+ +E EL  +C DI+ VLD +L+ +A   E++VF+ KMKGDY+RYLAEF    +RK+AAENSL AYK AS IA +EL PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAIAELD LSEESYKDSTLIMQLLRDNLTLWTSDM
Sbjct:    1 MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDM 235          
BLAST of 14-3-3 protein epsilon vs. Ensembl Human
Match: YWHAE (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein epsilon [Source:HGNC Symbol;Acc:HGNC:12851])

HSP 1 Score: 279.256 bits (713), Expect = 3.386e-93
Identity = 155/213 (72.77%), Postives = 181/213 (84.98%), Query Frame = 3
Query:  165 MVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPE-KLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDM 800
            MV++M++VA M+ +LTVEERNLLSVAYKNVIG+RRASWRIISSIEQK E K  E KL +I+++R+ +E EL  +C DI+ VLD +L+ +A   E++VF+ KMKGDY+RYLAEF    +RK+AAENSL AYK AS IA +EL PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAIAELD LSEESYKDSTLIMQLLRDNLTLWTSDM
Sbjct:    1 MVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDM 213          
BLAST of 14-3-3 protein epsilon vs. Ensembl Human
Match: YWHAE (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein epsilon [Source:HGNC Symbol;Acc:HGNC:12851])

HSP 1 Score: 279.256 bits (713), Expect = 3.386e-93
Identity = 155/213 (72.77%), Postives = 181/213 (84.98%), Query Frame = 3
Query:  165 MVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPE-KLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDM 800
            MV++M++VA M+ +LTVEERNLLSVAYKNVIG+RRASWRIISSIEQK E K  E KL +I+++R+ +E EL  +C DI+ VLD +L+ +A   E++VF+ KMKGDY+RYLAEF    +RK+AAENSL AYK AS IA +EL PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAIAELD LSEESYKDSTLIMQLLRDNLTLWTSDM
Sbjct:    1 MVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDM 213          
BLAST of 14-3-3 protein epsilon vs. Ensembl Human
Match: YWHAQ (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta [Source:HGNC Symbol;Acc:HGNC:12854])

HSP 1 Score: 268.855 bits (686), Expect = 6.265e-89
Identity = 144/233 (61.80%), Postives = 184/233 (78.97%), Query Frame = 3
Query:  105 DREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPEKLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDMA 803
            ++ E + KAKLAEQAERY++M   M+ V    ++L+ EERNLLSVAYKNV+G RR++WR+ISSIEQK +  D +KL +IK +RE++E EL  +C  ++ +LD  L+ +ATN E++VF+LKMKGDY+RYLAE     +RK   +NS  AY++A  I+  E+QPTHPIRLGLALNFSVFYYEILN+ + AC LAK AFD+AIAELD L+E+SYKDSTLIMQLLRDNLTLWTSD A
Sbjct:    2 EKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSD-KKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSA 233          
BLAST of 14-3-3 protein epsilon vs. Ensembl Celegans
Match: ftt-2 (14-3-3-like protein 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20655])

HSP 1 Score: 272.707 bits (696), Expect = 8.050e-91
Identity = 146/233 (62.66%), Postives = 190/233 (81.55%), Query Frame = 3
Query:  108 REEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPEKLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDMAT 806
            +EE V +AKLAEQAERY++M  +M++V  + ++L+ EERNLLSVAYKNV+G+RR+SWR+ISSIEQK E  + +K  + K++RE++E+EL D+C+D++ +LD  L+  A   E++VF+LKMKGDYYRYLAE     +R    E S  +Y++A  IA  ++QPTHPIRLGLALNFSVF+YEILN+ D+ACQLAK+AFDDAIAELD L+E+SYKDSTLIMQLLRDNLTLWTSD AT
Sbjct:    5 KEELVNRAKLAEQAERYDDMAASMKKVTELGAELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSE-KKQQMAKEYREKVEKELRDICQDVLNLLDKFLIPKAGAAESKVFYLKMKGDYYRYLAEVASGDDRNSVVEKSQQSYQEAFDIAKDKMQPTHPIRLGLALNFSVFFYEILNAPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDAAT 236          
BLAST of 14-3-3 protein epsilon vs. Ensembl Celegans
Match: ftt-2 (14-3-3-like protein 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20655])

HSP 1 Score: 272.707 bits (696), Expect = 8.050e-91
Identity = 146/233 (62.66%), Postives = 190/233 (81.55%), Query Frame = 3
Query:  108 REEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPEKLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDMAT 806
            +EE V +AKLAEQAERY++M  +M++V  + ++L+ EERNLLSVAYKNV+G+RR+SWR+ISSIEQK E  + +K  + K++RE++E+EL D+C+D++ +LD  L+  A   E++VF+LKMKGDYYRYLAE     +R    E S  +Y++A  IA  ++QPTHPIRLGLALNFSVF+YEILN+ D+ACQLAK+AFDDAIAELD L+E+SYKDSTLIMQLLRDNLTLWTSD AT
Sbjct:    5 KEELVNRAKLAEQAERYDDMAASMKKVTELGAELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSE-KKQQMAKEYREKVEKELRDICQDVLNLLDKFLIPKAGAAESKVFYLKMKGDYYRYLAEVASGDDRNSVVEKSQQSYQEAFDIAKDKMQPTHPIRLGLALNFSVFFYEILNAPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDAAT 236          
BLAST of 14-3-3 protein epsilon vs. Ensembl Celegans
Match: ftt-2 (14-3-3-like protein 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20655])

HSP 1 Score: 272.707 bits (696), Expect = 8.050e-91
Identity = 146/233 (62.66%), Postives = 190/233 (81.55%), Query Frame = 3
Query:  108 REEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPEKLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDMAT 806
            +EE V +AKLAEQAERY++M  +M++V  + ++L+ EERNLLSVAYKNV+G+RR+SWR+ISSIEQK E  + +K  + K++RE++E+EL D+C+D++ +LD  L+  A   E++VF+LKMKGDYYRYLAE     +R    E S  +Y++A  IA  ++QPTHPIRLGLALNFSVF+YEILN+ D+ACQLAK+AFDDAIAELD L+E+SYKDSTLIMQLLRDNLTLWTSD AT
Sbjct:    5 KEELVNRAKLAEQAERYDDMAASMKKVTELGAELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSE-KKQQMAKEYREKVEKELRDICQDVLNLLDKFLIPKAGAAESKVFYLKMKGDYYRYLAEVASGDDRNSVVEKSQQSYQEAFDIAKDKMQPTHPIRLGLALNFSVFFYEILNAPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDAAT 236          
BLAST of 14-3-3 protein epsilon vs. Ensembl Celegans
Match: par-5 (14-3-3-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:P41932])

HSP 1 Score: 266.159 bits (679), Expect = 3.186e-88
Identity = 146/231 (63.20%), Postives = 186/231 (80.52%), Query Frame = 3
Query:  111 EEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPEKLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDMA 803
            EE V +AKLAEQAERY++M  AM++V     +L+ EERNLLSVAYKNV+G+RR+SWR+ISSIEQK E  + +K  + K++R ++EQEL D+C+D++++LD  L+  A   E++VF+LKMKGDYYRYLAE   + +R    E S  AY++A  IA  ++QPTHPIRLGLALNFSVFYYEILN+ + ACQLAK+AFDDAIAELD L+E+SYKDSTLIMQLLRDNLTLWTSD+ 
Sbjct:    6 EELVQRAKLAEQAERYDDMAAAMKKVTEQGQELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSE-KKQQLAKEYRVKVEQELNDICQDVLKLLDEFLIVKAGAAESKVFYLKMKGDYYRYLAEVASE-DRAAVVEKSQKAYQEALDIAKDKMQPTHPIRLGLALNFSVFYYEILNTPEHACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDVG 234          
BLAST of 14-3-3 protein epsilon vs. Ensembl Celegans
Match: par-5 (14-3-3-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:P41932])

HSP 1 Score: 266.159 bits (679), Expect = 3.186e-88
Identity = 146/231 (63.20%), Postives = 186/231 (80.52%), Query Frame = 3
Query:  111 EEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPEKLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDMA 803
            EE V +AKLAEQAERY++M  AM++V     +L+ EERNLLSVAYKNV+G+RR+SWR+ISSIEQK E  + +K  + K++R ++EQEL D+C+D++++LD  L+  A   E++VF+LKMKGDYYRYLAE   + +R    E S  AY++A  IA  ++QPTHPIRLGLALNFSVFYYEILN+ + ACQLAK+AFDDAIAELD L+E+SYKDSTLIMQLLRDNLTLWTSD+ 
Sbjct:    6 EELVQRAKLAEQAERYDDMAAAMKKVTEQGQELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSE-KKQQLAKEYRVKVEQELNDICQDVLKLLDEFLIVKAGAAESKVFYLKMKGDYYRYLAEVASE-DRAAVVEKSQKAYQEALDIAKDKMQPTHPIRLGLALNFSVFYYEILNTPEHACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDVG 234          
BLAST of 14-3-3 protein epsilon vs. Ensembl Fly
Match: 14-3-3epsilon (gene:FBgn0020238 transcript:FBtr0083567)

HSP 1 Score: 320.087 bits (819), Expect = 3.311e-109
Identity = 175/235 (74.47%), Postives = 202/235 (85.96%), Query Frame = 3
Query:   99 MGDREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPE-KLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDM 800
            M +RE  VYKAKLAEQAERY+EMV+AM++VA M+ +LTVEERNLLSVAYKNVIG+RRASWRII+SIEQK E K  E KL +IK +R Q+E+EL D+C DI+ VL+ +L+  AT+ E++VF+ KMKGDY+RYLAEF    +RKDAAENSL AYK AS IA ++L PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAIAELD LSEESYKDSTLIMQLLRDNLTLWTSDM
Sbjct:    1 MTERENNVYKAKLAEQAERYDEMVEAMKKVASMDVELTVEERNLLSVAYKNVIGARRASWRIITSIEQKEENKGAEEKLEMIKTYRGQVEKELRDICSDILNVLEKHLIPCATSGESKVFYYKMKGDYHRYLAEFATGSDRKDAAENSLIAYKAASDIAMNDLPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDM 235          
BLAST of 14-3-3 protein epsilon vs. Ensembl Fly
Match: 14-3-3epsilon (gene:FBgn0020238 transcript:FBtr0083566)

HSP 1 Score: 320.087 bits (819), Expect = 3.930e-109
Identity = 175/235 (74.47%), Postives = 202/235 (85.96%), Query Frame = 3
Query:   99 MGDREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPE-KLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDM 800
            M +RE  VYKAKLAEQAERY+EMV+AM++VA M+ +LTVEERNLLSVAYKNVIG+RRASWRII+SIEQK E K  E KL +IK +R Q+E+EL D+C DI+ VL+ +L+  AT+ E++VF+ KMKGDY+RYLAEF    +RKDAAENSL AYK AS IA ++L PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAIAELD LSEESYKDSTLIMQLLRDNLTLWTSDM
Sbjct:    1 MTERENNVYKAKLAEQAERYDEMVEAMKKVASMDVELTVEERNLLSVAYKNVIGARRASWRIITSIEQKEENKGAEEKLEMIKTYRGQVEKELRDICSDILNVLEKHLIPCATSGESKVFYYKMKGDYHRYLAEFATGSDRKDAAENSLIAYKAASDIAMNDLPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDM 235          
BLAST of 14-3-3 protein epsilon vs. Ensembl Fly
Match: 14-3-3epsilon (gene:FBgn0020238 transcript:FBtr0083565)

HSP 1 Score: 320.087 bits (819), Expect = 4.390e-109
Identity = 175/235 (74.47%), Postives = 202/235 (85.96%), Query Frame = 3
Query:   99 MGDREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPE-KLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDM 800
            M +RE  VYKAKLAEQAERY+EMV+AM++VA M+ +LTVEERNLLSVAYKNVIG+RRASWRII+SIEQK E K  E KL +IK +R Q+E+EL D+C DI+ VL+ +L+  AT+ E++VF+ KMKGDY+RYLAEF    +RKDAAENSL AYK AS IA ++L PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAIAELD LSEESYKDSTLIMQLLRDNLTLWTSDM
Sbjct:    1 MTERENNVYKAKLAEQAERYDEMVEAMKKVASMDVELTVEERNLLSVAYKNVIGARRASWRIITSIEQKEENKGAEEKLEMIKTYRGQVEKELRDICSDILNVLEKHLIPCATSGESKVFYYKMKGDYHRYLAEFATGSDRKDAAENSLIAYKAASDIAMNDLPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDM 235          
BLAST of 14-3-3 protein epsilon vs. Ensembl Fly
Match: 14-3-3epsilon (gene:FBgn0020238 transcript:FBtr0083568)

HSP 1 Score: 320.087 bits (819), Expect = 4.724e-109
Identity = 175/235 (74.47%), Postives = 202/235 (85.96%), Query Frame = 3
Query:   99 MGDREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPE-KLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDM 800
            M +RE  VYKAKLAEQAERY+EMV+AM++VA M+ +LTVEERNLLSVAYKNVIG+RRASWRII+SIEQK E K  E KL +IK +R Q+E+EL D+C DI+ VL+ +L+  AT+ E++VF+ KMKGDY+RYLAEF    +RKDAAENSL AYK AS IA ++L PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAIAELD LSEESYKDSTLIMQLLRDNLTLWTSDM
Sbjct:    1 MTERENNVYKAKLAEQAERYDEMVEAMKKVASMDVELTVEERNLLSVAYKNVIGARRASWRIITSIEQKEENKGAEEKLEMIKTYRGQVEKELRDICSDILNVLEKHLIPCATSGESKVFYYKMKGDYHRYLAEFATGSDRKDAAENSLIAYKAASDIAMNDLPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDM 235          
BLAST of 14-3-3 protein epsilon vs. Ensembl Fly
Match: 14-3-3zeta (gene:FBgn0004907 transcript:FBtr0088413)

HSP 1 Score: 271.166 bits (692), Expect = 4.110e-90
Identity = 146/231 (63.20%), Postives = 187/231 (80.95%), Query Frame = 3
Query:  105 DREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPEKLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSD 797
            D+EE V KAKLAEQ+ERY++M  AM+ V     +L+ EERNLLSVAYKNV+G+RR+SWR+ISSIEQK E     K  + +++RE++E+EL ++C +++ +LD  L+  A+N E++VF+LKMKGDYYRYLAE      R    ++S +AY++A  IA +++QPTHPIRLGLALNFSVFYYEILNS D+ACQLAK+AFDDAIAELD L+E+SYKDSTLIMQLLRDNLTLWTSD
Sbjct:    5 DKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEAS-ARKQQLAREYRERVEKELREICYEVLGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSKNAYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSD 234          
BLAST of 14-3-3 protein epsilon vs. Ensembl Zebrafish
Match: ywhae1 (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 1 [Source:ZFIN;Acc:ZDB-GENE-030131-779])

HSP 1 Score: 320.087 bits (819), Expect = 4.248e-109
Identity = 174/235 (74.04%), Postives = 204/235 (86.81%), Query Frame = 3
Query:   99 MGDREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPE-KLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDM 800
            MGDRE+ VY+AKLAEQAERY+EMVD+M++VA M+ +LTVEERNLLSVAYKNVIG+RRASWRIISSIEQK E K  E KL +I+++R+ +E EL  +C DI+ VLD +L+ +A + E++VF+ KMKGDY+RYLAEF    +RK+AAENSL AYK AS IA ++LQPTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAIAELD LSEESYKDSTLIMQLLRDNLTLWTSDM
Sbjct:    1 MGDREDLVYQAKLAEQAERYDEMVDSMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQTVENELKSICNDILDVLDKHLIPAANSGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTDLQPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDM 235          
BLAST of 14-3-3 protein epsilon vs. Ensembl Zebrafish
Match: ywhae1 (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 1 [Source:ZFIN;Acc:ZDB-GENE-030131-779])

HSP 1 Score: 320.087 bits (819), Expect = 4.248e-109
Identity = 174/235 (74.04%), Postives = 204/235 (86.81%), Query Frame = 3
Query:   99 MGDREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPE-KLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDM 800
            MGDRE+ VY+AKLAEQAERY+EMVD+M++VA M+ +LTVEERNLLSVAYKNVIG+RRASWRIISSIEQK E K  E KL +I+++R+ +E EL  +C DI+ VLD +L+ +A + E++VF+ KMKGDY+RYLAEF    +RK+AAENSL AYK AS IA ++LQPTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAIAELD LSEESYKDSTLIMQLLRDNLTLWTSDM
Sbjct:    1 MGDREDLVYQAKLAEQAERYDEMVDSMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQTVENELKSICNDILDVLDKHLIPAANSGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTDLQPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDM 235          
BLAST of 14-3-3 protein epsilon vs. Ensembl Zebrafish
Match: ywhae1 (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 1 [Source:ZFIN;Acc:ZDB-GENE-030131-779])

HSP 1 Score: 320.087 bits (819), Expect = 4.248e-109
Identity = 174/235 (74.04%), Postives = 204/235 (86.81%), Query Frame = 3
Query:   99 MGDREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPE-KLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDM 800
            MGDRE+ VY+AKLAEQAERY+EMVD+M++VA M+ +LTVEERNLLSVAYKNVIG+RRASWRIISSIEQK E K  E KL +I+++R+ +E EL  +C DI+ VLD +L+ +A + E++VF+ KMKGDY+RYLAEF    +RK+AAENSL AYK AS IA ++LQPTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAIAELD LSEESYKDSTLIMQLLRDNLTLWTSDM
Sbjct:    1 MGDREDLVYQAKLAEQAERYDEMVDSMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQTVENELKSICNDILDVLDKHLIPAANSGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTDLQPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDM 235          
BLAST of 14-3-3 protein epsilon vs. Ensembl Zebrafish
Match: ywhae2 (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 2 [Source:ZFIN;Acc:ZDB-GENE-050306-44])

HSP 1 Score: 307.375 bits (786), Expect = 3.858e-104
Identity = 168/235 (71.49%), Postives = 198/235 (84.26%), Query Frame = 3
Query:   99 MGDREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKD-PEKLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDM 800
            M DRE  VY+AKLAEQAERY+EMV++M+ VA  + DL+VEERNLLSVAYKNVIG+RRASWRIISSIEQK E K   +KL +I+++R+ +E EL  +C DI+ VLD +L+ +A   E++VF+ KMKGDY+RYLAEF    +RK+AAENSL AYK AS IA +EL PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAIAELD LSE+SYKDSTLIMQLLRDNLTLWTSD+
Sbjct:    1 MADREHLVYQAKLAEQAERYDEMVESMKNVAGKDEDLSVEERNLLSVAYKNVIGARRASWRIISSIEQKEESKGGADKLKMIREYRQTVENELKSICNDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEDSYKDSTLIMQLLRDNLTLWTSDI 235          
BLAST of 14-3-3 protein epsilon vs. Ensembl Zebrafish
Match: ywhaqb (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide b [Source:ZFIN;Acc:ZDB-GENE-030131-7135])

HSP 1 Score: 281.182 bits (718), Expect = 5.473e-94
Identity = 148/233 (63.52%), Postives = 192/233 (82.40%), Query Frame = 3
Query:  105 DREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPEKLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDMA 803
            DR E + KAKLAEQAERY++M   M+ V    S+L+ EERNLLSVAYKNV+G+RR++WR+ISSIEQK E  D +KL ++K++RE++E EL D+C D++ +L+  L+++++N E++VF+LKMKGDYYRYLAE     ++K   ENS  AY++A  I+ +E+QPTHPIRLGLALNFSVF+YEILNS ++AC LAK+AFD+AIAELD L+EESYKDSTLIMQLLRDNLTLWTSD A
Sbjct:    2 DRTELIQKAKLAEQAERYDDMASCMKSVTEAGSELSNEERNLLSVAYKNVVGARRSAWRVISSIEQKTEGND-KKLQMVKEYREKVESELRDICNDVLELLNKYLIENSSNPESKVFYLKMKGDYYRYLAEVAAGDDKKATIENSQDAYQKAFDISKTEMQPTHPIRLGLALNFSVFFYEILNSPEKACSLAKQAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSDNA 233          
BLAST of 14-3-3 protein epsilon vs. Ensembl Xenopus
Match: ywhae (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein epsilon [Source:NCBI gene;Acc:493518])

HSP 1 Score: 310.071 bits (793), Expect = 3.022e-105
Identity = 171/235 (72.77%), Postives = 202/235 (85.96%), Query Frame = 3
Query:   99 MGDREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPE-KLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDM 800
            M +RE+ VY+AKLAEQAERY+EMV++M++VA M+ +LTVEERNLLSVAYKNVIG+RRASWRIISSIEQK E K  E KL +I+++R+ +E EL  +C DI+ VLD +L+ +A + E++VF+ KMKGDY+RYLAEF    +RK+AAENSL AYK AS IA +EL PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAIAELD LSEESYKDSTLIMQLLRDNLTLWTSDM
Sbjct:    1 MEEREDLVYRAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVEAELKSICNDILDVLDKHLIPAANSGESKVFYYKMKGDYHRYLAEFAQGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDM 235          
BLAST of 14-3-3 protein epsilon vs. Ensembl Xenopus
Match: ywhae (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein epsilon [Source:NCBI gene;Acc:493518])

HSP 1 Score: 310.457 bits (794), Expect = 3.723e-105
Identity = 171/235 (72.77%), Postives = 202/235 (85.96%), Query Frame = 3
Query:   99 MGDREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPE-KLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDM 800
            M +RE+ VY+AKLAEQAERY+EMV++M++VA M+ +LTVEERNLLSVAYKNVIG+RRASWRIISSIEQK E K  E KL +I+++R+ +E EL  +C DI+ VLD +L+ +A + E++VF+ KMKGDY+RYLAEF    +RK+AAENSL AYK AS IA +EL PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAIAELD LSEESYKDSTLIMQLLRDNLTLWTSDM
Sbjct:    1 MEEREDLVYRAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVEAELKSICNDILDVLDKHLIPAANSGESKVFYYKMKGDYHRYLAEFAQGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDM 235          
BLAST of 14-3-3 protein epsilon vs. Ensembl Xenopus
Match: ywhae (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein epsilon [Source:NCBI gene;Acc:493518])

HSP 1 Score: 310.071 bits (793), Expect = 5.510e-105
Identity = 171/235 (72.77%), Postives = 202/235 (85.96%), Query Frame = 3
Query:   99 MGDREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPE-KLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDM 800
            M +RE+ VY+AKLAEQAERY+EMV++M++VA M+ +LTVEERNLLSVAYKNVIG+RRASWRIISSIEQK E K  E KL +I+++R+ +E EL  +C DI+ VLD +L+ +A + E++VF+ KMKGDY+RYLAEF    +RK+AAENSL AYK AS IA +EL PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAIAELD LSEESYKDSTLIMQLLRDNLTLWTSDM
Sbjct:    1 MEEREDLVYRAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVEAELKSICNDILDVLDKHLIPAANSGESKVFYYKMKGDYHRYLAEFAQGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDM 235          
BLAST of 14-3-3 protein epsilon vs. Ensembl Xenopus
Match: ywhab (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta [Source:NCBI gene;Acc:496529])

HSP 1 Score: 267.7 bits (683), Expect = 1.779e-88
Identity = 143/231 (61.90%), Postives = 187/231 (80.95%), Query Frame = 3
Query:  105 DREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPEKLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSD 797
            D+ E V KAKL+EQAERY++M  +M+ V  + ++L+ EERNLLSVAYKNV+G+RR+SWR+ISSIEQK E  D ++  + +++RE++E EL D+CKD++ +LD  L+ +AT  E++VF+LKMKGDYYRYL+E      +++    S  AY++A  I+ SE+QPTHPIRLGLALNFSVFYYEILNS ++AC LAK AFD+AIAELD L+EESYKDSTLIMQLLRDNLTLWTS+
Sbjct:    3 DKSELVQKAKLSEQAERYDDMAASMKAVTELGAELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGND-KRQQMAREYREKVETELQDICKDVLGLLDKYLVPNATPPESKVFYLKMKGDYYRYLSEVASGDSKQETVTCSQQAYQEAFEISKSEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKSAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSE 232          
BLAST of 14-3-3 protein epsilon vs. Ensembl Xenopus
Match: insm1 (insulinoma associated 1 [Source:Xenbase;Acc:XB-GENE-993149])

HSP 1 Score: 262.307 bits (669), Expect = 2.296e-86
Identity = 146/236 (61.86%), Postives = 184/236 (77.97%), Query Frame = 3
Query:   99 MGDREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPEK-LPVIKKFREQIEQELGDVCKDIIRVLDANLLQ--SATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSD 797
            M DRE+ V KA+LAEQAERY++M  AM+ V  +N  L+ EERNLLSVAYKNV+G+RR+SWR+ISSIEQK      EK + +++ +RE+IE+EL  VC+D++ +LD  L++  S T  E++VF+LKMKGDYYRYLAE     +R    E+S  AY +A  I+   +QPTHPIRLGLALN+SVFYYEI N+ ++AC LAK AFDDAIAELD L+E+SYKDSTLIMQLLRDNLTLWTSD
Sbjct:    1 MVDREQLVQKARLAEQAERYDDMAAAMKAVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNFLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSD 236          
BLAST of 14-3-3 protein epsilon vs. Ensembl Mouse
Match: Ywhae (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide [Source:MGI Symbol;Acc:MGI:894689])

HSP 1 Score: 310.457 bits (794), Expect = 2.611e-105
Identity = 172/235 (73.19%), Postives = 201/235 (85.53%), Query Frame = 3
Query:   99 MGDREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPE-KLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDM 800
            M DRE+ VY+AKLAEQAERY+EMV++M++VA M+ +LTVEERNLLSVAYKNVIG+RRASWRIISSIEQK E K  E KL +I+++R+ +E EL  +C DI+ VLD +L+ +A   E++VF+ KMKGDY+RYLAEF    +RK+AAENSL AYK AS IA +EL PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAIAELD LSEESYKDSTLIMQLLRDNLTLWTSDM
Sbjct:    1 MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDM 235          
BLAST of 14-3-3 protein epsilon vs. Ensembl Mouse
Match: Ywhaq (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta [Source:MGI Symbol;Acc:MGI:891963])

HSP 1 Score: 270.781 bits (691), Expect = 8.983e-90
Identity = 145/233 (62.23%), Postives = 184/233 (78.97%), Query Frame = 3
Query:  105 DREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPEKLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDMA 803
            ++ E + KAKLAEQAERY++M   M+ V    ++L+ EERNLLSVAYKNV+G RR++WR+ISSIEQK +  D +KL +IK +RE++E EL  +C  ++ +LD  L+ +ATN E++VF+LKMKGDY+RYLAE     +RK   ENS  AY++A  I+  E+QPTHPIRLGLALNFSVFYYEILN+ + AC LAK AFD+AIAELD L+E+SYKDSTLIMQLLRDNLTLWTSD A
Sbjct:    2 EKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSD-KKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIENSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSA 233          
BLAST of 14-3-3 protein epsilon vs. Ensembl Mouse
Match: Ywhaq (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta [Source:MGI Symbol;Acc:MGI:891963])

HSP 1 Score: 270.781 bits (691), Expect = 8.983e-90
Identity = 145/233 (62.23%), Postives = 184/233 (78.97%), Query Frame = 3
Query:  105 DREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPEKLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDMA 803
            ++ E + KAKLAEQAERY++M   M+ V    ++L+ EERNLLSVAYKNV+G RR++WR+ISSIEQK +  D +KL +IK +RE++E EL  +C  ++ +LD  L+ +ATN E++VF+LKMKGDY+RYLAE     +RK   ENS  AY++A  I+  E+QPTHPIRLGLALNFSVFYYEILN+ + AC LAK AFD+AIAELD L+E+SYKDSTLIMQLLRDNLTLWTSD A
Sbjct:    2 EKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSD-KKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIENSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSA 233          
BLAST of 14-3-3 protein epsilon vs. Ensembl Mouse
Match: Ywhab (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide [Source:MGI Symbol;Acc:MGI:1891917])

HSP 1 Score: 268.085 bits (684), Expect = 1.061e-88
Identity = 145/231 (62.77%), Postives = 184/231 (79.65%), Query Frame = 3
Query:  105 DREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPEKLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSD 797
            D+ E V KAKLAEQAERY++M  AM+ V     +L+ EERNLLSVAYKNV+G+RR+SWR+ISSIEQK E ++ +K  + K++RE+IE EL D+C D++ +LD  L+ +AT  E++VF+LKMKGDY+RYL+E      ++    NS  AY++A  I+  E+QPTHPIRLGLALNFSVFYYEILNS ++AC LAK AFD+AIAELD L+EESYKDSTLIMQLLRDNLTLWTS+
Sbjct:    4 DKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTE-RNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLILNATQAESKVFYLKMKGDYFRYLSEVASGENKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSE 233          
BLAST of 14-3-3 protein epsilon vs. Ensembl Mouse
Match: Ywhaz (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide [Source:MGI Symbol;Acc:MGI:109484])

HSP 1 Score: 267.7 bits (683), Expect = 1.438e-88
Identity = 144/231 (62.34%), Postives = 184/231 (79.65%), Query Frame = 3
Query:  105 DREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPEKLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSD 797
            D+ E V KAKLAEQAERY++M   M+ V    ++L+ EERNLLSVAYKNV+G+RR+SWR++SSIEQK E  + +K  + +++RE+IE EL D+C D++ +L+  L+ +A+  E++VF+LKMKGDYYRYLAE     ++K   + S  AY++A  I+  E+QPTHPIRLGLALNFSVFYYEILNS ++AC LAK AFD+AIAELD LSEESYKDSTLIMQLLRDNLTLWTSD
Sbjct:    2 DKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAE-KKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQPESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSD 231          
BLAST of 14-3-3 protein epsilon vs. UniProt/SwissProt
Match: sp|P92177|1433E_DROME (14-3-3 protein epsilon OS=Drosophila melanogaster OX=7227 GN=14-3-3epsilon PE=1 SV=2)

HSP 1 Score: 320.087 bits (819), Expect = 4.401e-108
Identity = 175/235 (74.47%), Postives = 202/235 (85.96%), Query Frame = 3
Query:   99 MGDREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPE-KLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDM 800
            M +RE  VYKAKLAEQAERY+EMV+AM++VA M+ +LTVEERNLLSVAYKNVIG+RRASWRII+SIEQK E K  E KL +IK +R Q+E+EL D+C DI+ VL+ +L+  AT+ E++VF+ KMKGDY+RYLAEF    +RKDAAENSL AYK AS IA ++L PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAIAELD LSEESYKDSTLIMQLLRDNLTLWTSDM
Sbjct:    1 MTERENNVYKAKLAEQAERYDEMVEAMKKVASMDVELTVEERNLLSVAYKNVIGARRASWRIITSIEQKEENKGAEEKLEMIKTYRGQVEKELRDICSDILNVLEKHLIPCATSGESKVFYYKMKGDYHRYLAEFATGSDRKDAAENSLIAYKAASDIAMNDLPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDM 235          
BLAST of 14-3-3 protein epsilon vs. UniProt/SwissProt
Match: sp|P62262|1433E_SHEEP (14-3-3 protein epsilon OS=Ovis aries OX=9940 GN=YWHAE PE=1 SV=1)

HSP 1 Score: 310.457 bits (794), Expect = 1.827e-104
Identity = 172/235 (73.19%), Postives = 201/235 (85.53%), Query Frame = 3
Query:   99 MGDREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPE-KLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDM 800
            M DRE+ VY+AKLAEQAERY+EMV++M++VA M+ +LTVEERNLLSVAYKNVIG+RRASWRIISSIEQK E K  E KL +I+++R+ +E EL  +C DI+ VLD +L+ +A   E++VF+ KMKGDY+RYLAEF    +RK+AAENSL AYK AS IA +EL PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAIAELD LSEESYKDSTLIMQLLRDNLTLWTSDM
Sbjct:    1 MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDM 235          
BLAST of 14-3-3 protein epsilon vs. UniProt/SwissProt
Match: sp|P62260|1433E_RAT (14-3-3 protein epsilon OS=Rattus norvegicus OX=10116 GN=Ywhae PE=1 SV=1)

HSP 1 Score: 310.457 bits (794), Expect = 1.827e-104
Identity = 172/235 (73.19%), Postives = 201/235 (85.53%), Query Frame = 3
Query:   99 MGDREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPE-KLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDM 800
            M DRE+ VY+AKLAEQAERY+EMV++M++VA M+ +LTVEERNLLSVAYKNVIG+RRASWRIISSIEQK E K  E KL +I+++R+ +E EL  +C DI+ VLD +L+ +A   E++VF+ KMKGDY+RYLAEF    +RK+AAENSL AYK AS IA +EL PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAIAELD LSEESYKDSTLIMQLLRDNLTLWTSDM
Sbjct:    1 MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDM 235          
BLAST of 14-3-3 protein epsilon vs. UniProt/SwissProt
Match: sp|P62259|1433E_MOUSE (14-3-3 protein epsilon OS=Mus musculus OX=10090 GN=Ywhae PE=1 SV=1)

HSP 1 Score: 310.457 bits (794), Expect = 1.827e-104
Identity = 172/235 (73.19%), Postives = 201/235 (85.53%), Query Frame = 3
Query:   99 MGDREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPE-KLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDM 800
            M DRE+ VY+AKLAEQAERY+EMV++M++VA M+ +LTVEERNLLSVAYKNVIG+RRASWRIISSIEQK E K  E KL +I+++R+ +E EL  +C DI+ VLD +L+ +A   E++VF+ KMKGDY+RYLAEF    +RK+AAENSL AYK AS IA +EL PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAIAELD LSEESYKDSTLIMQLLRDNLTLWTSDM
Sbjct:    1 MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDM 235          
BLAST of 14-3-3 protein epsilon vs. UniProt/SwissProt
Match: sp|P62258|1433E_HUMAN (14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE PE=1 SV=1)

HSP 1 Score: 310.457 bits (794), Expect = 1.827e-104
Identity = 172/235 (73.19%), Postives = 201/235 (85.53%), Query Frame = 3
Query:   99 MGDREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPE-KLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDM 800
            M DRE+ VY+AKLAEQAERY+EMV++M++VA M+ +LTVEERNLLSVAYKNVIG+RRASWRIISSIEQK E K  E KL +I+++R+ +E EL  +C DI+ VLD +L+ +A   E++VF+ KMKGDY+RYLAEF    +RK+AAENSL AYK AS IA +EL PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAIAELD LSEESYKDSTLIMQLLRDNLTLWTSDM
Sbjct:    1 MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDM 235          
BLAST of 14-3-3 protein epsilon vs. TrEMBL
Match: A0A267H384 (14_3_3 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig008769g1 PE=3 SV=1)

HSP 1 Score: 327.405 bits (838), Expect = 1.528e-108
Identity = 177/233 (75.97%), Postives = 204/233 (87.55%), Query Frame = 3
Query:  105 DREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQK-DPEKLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDM 800
            DRE+KVY AKL+EQAERY+EMVDAM+ VA M+ +LTVEERNLLSVAYKNVIG+RRASWRI+SSIEQK E K   EKL V++ FR Q+EQEL  +C DI+ VLD++L+ SAT  E+RVF+ KMKGDY RYLAEF    ERK+AAENSL+AYK A+ IA+++L+PTHPIRLGLALNFSVFYYEILNSADRAC+LAK AFD+AIAELD LSEESYKDSTLIMQLLRDNLTLWTSDM
Sbjct:    5 DREDKVYFAKLSEQAERYDEMVDAMKAVAVMDVELTVEERNLLSVAYKNVIGARRASWRIVSSIEQKEESKSGSEKLDVVRTFRTQVEQELKKICDDILDVLDSHLIPSATVAESRVFYYKMKGDYLRYLAEFATGAERKEAAENSLTAYKAATDIANTQLKPTHPIRLGLALNFSVFYYEILNSADRACKLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDM 237          
BLAST of 14-3-3 protein epsilon vs. TrEMBL
Match: A0A267GD54 (14_3_3 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017163g1 PE=3 SV=1)

HSP 1 Score: 327.02 bits (837), Expect = 1.742e-108
Identity = 177/233 (75.97%), Postives = 204/233 (87.55%), Query Frame = 3
Query:  105 DREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQK-DPEKLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDM 800
            DRE+KVY AKL+EQAERY+EMVDAM+ VA M+ +LTVEERNLLSVAYKNVIG+RRASWRI+SSIEQK E K   EKL V++ FR Q+EQEL  +C DI+ VLD++L+ SAT  E+RVF+ KMKGDY RYLAEF    ERK+AAENSL+AYK A+ IA+++L+PTHPIRLGLALNFSVFYYEILNSADRAC+LAK AFD+AIAELD LSEESYKDSTLIMQLLRDNLTLWTSDM
Sbjct:    5 DREDKVYFAKLSEQAERYDEMVDAMKAVAVMDVELTVEERNLLSVAYKNVIGARRASWRIVSSIEQKEESKSGSEKLDVVRTFRTQVEQELKKICDDILVVLDSHLIPSATVAESRVFYYKMKGDYLRYLAEFATGAERKEAAENSLTAYKAATDIANTQLKPTHPIRLGLALNFSVFYYEILNSADRACKLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDM 237          
BLAST of 14-3-3 protein epsilon vs. TrEMBL
Match: A0A226F2M1 (14-3-3 protein OS=Folsomia candida OX=158441 GN=Fcan01_03876 PE=2 SV=1)

HSP 1 Score: 326.25 bits (835), Expect = 4.481e-108
Identity = 177/235 (75.32%), Postives = 204/235 (86.81%), Query Frame = 3
Query:   99 MGDREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPE-KLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDM 800
            M DRE+ VYKAKLAEQAERY+EMV+AM++VA ++ +LTVEERNLLSVAYKNVIG+RRASWRIISSIEQK E K  E KL +I+++R Q+E+EL ++C DI+ VLD +L+  AT+ E++VF+ KMKGDY+RYLAEF    +RKDAAENSL AYK AS IA  EL PTHPIRLGLALNFSVFYYEILNSADRAC+LAK AFDDAIAELD LSEESYKDSTLIMQLLRDNLTLWTSDM
Sbjct:    1 MSDREDNVYKAKLAEQAERYDEMVEAMKKVASLDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEESKGSEDKLDMIRQYRAQVEKELKEICSDILNVLDKHLIPCATSGESKVFYFKMKGDYHRYLAEFATGTDRKDAAENSLVAYKAASDIAMEELPPTHPIRLGLALNFSVFYYEILNSADRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDM 235          
BLAST of 14-3-3 protein epsilon vs. TrEMBL
Match: A0A182Q9Y3 (14_3_3 domain-containing protein OS=Anopheles farauti OX=69004 PE=3 SV=1)

HSP 1 Score: 324.709 bits (831), Expect = 1.949e-107
Identity = 178/240 (74.17%), Postives = 203/240 (84.58%), Query Frame = 3
Query:   84 SLTIKMGDREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKD-PEKLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDM 800
            S T  M +RE  +YKAKLAEQAERY+EMV+AM++VA M+ +LTVEERNLLSVAYKNVIG+RRASWRIISSIEQK E K   EKL +IK +R Q+E+EL D+C DI+ VLD +L+  AT  E++VF+ KMKGDY+RYLAEF    +RKDAAENSL AYK AS IA ++L PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAIAELD LSEESYKDSTLIMQLLRDNLTLWTSDM
Sbjct:    6 SSTATMSERENNIYKAKLAEQAERYDEMVEAMKKVASMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGVEEKLEMIKNYRSQVEKELRDICSDILEVLDKHLIPCATTGESKVFYYKMKGDYHRYLAEFATGGDRKDAAENSLVAYKAASDIAMTDLPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDM 245          
BLAST of 14-3-3 protein epsilon vs. TrEMBL
Match: A0A1I8H1Q0 (14_3_3 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig021321g1 PE=3 SV=1)

HSP 1 Score: 324.324 bits (830), Expect = 2.218e-107
Identity = 174/235 (74.04%), Postives = 206/235 (87.66%), Query Frame = 3
Query:  105 DREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQK-DPEKLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDMAT 806
            DRE++VY AKL+EQAERY+EMVDAM+ VA M+ +LTVEERNLLSVAYKNVIG+RRASWRI+SSIEQK E K   +K+ ++KK+R Q+E+EL  +C+DI+ VLD++L+ SAT +E+RVFF KMKGDY RY+AEF    ERK+AAENSLSAYK A+ IA++ L PTHPIRLGLALNFSVFYYEILNSA+RACQLAK +FD+AIAELD LSEESYKDSTLIMQLLRDNLTLWTSDM T
Sbjct:    5 DREDQVYFAKLSEQAERYDEMVDAMKAVAVMDVELTVEERNLLSVAYKNVIGARRASWRIMSSIEQKEESKPGSDKVELVKKYRSQVEKELKQICEDILDVLDSHLIPSATVDESRVFFYKMKGDYLRYMAEFATGAERKEAAENSLSAYKNATDIANAHLPPTHPIRLGLALNFSVFYYEILNSAERACQLAKTSFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQT 239          
BLAST of 14-3-3 protein epsilon vs. Ensembl Cavefish
Match: ywhae1 (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein epsilon [Source:NCBI gene;Acc:103034995])

HSP 1 Score: 315.464 bits (807), Expect = 1.299e-107
Identity = 172/235 (73.19%), Postives = 203/235 (86.38%), Query Frame = 3
Query:   99 MGDREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPE-KLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDM 800
            M +RE+ VY+AKLAEQAERY+EMVD+M++VA M+ +LTVEERNLLSVAYKNVIG+RRASWRIISSIEQK E K  E KL +I+++R+ +E EL  +C DI+ VLD +L+ +A + E++VF+ KMKGDY+RYLAEF    +RK+AAENSL AYK AS IA ++LQPTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAIAELD LSEESYKDSTLIMQLLRDNLTLWTSDM
Sbjct:    1 MANREDLVYQAKLAEQAERYDEMVDSMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQTVETELKSICNDILDVLDKHLIPAANSGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTDLQPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDM 235          
BLAST of 14-3-3 protein epsilon vs. Ensembl Cavefish
Match: ywhae1 (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein epsilon [Source:NCBI gene;Acc:103034995])

HSP 1 Score: 315.464 bits (807), Expect = 2.271e-107
Identity = 172/235 (73.19%), Postives = 203/235 (86.38%), Query Frame = 3
Query:   99 MGDREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPE-KLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDM 800
            M +RE+ VY+AKLAEQAERY+EMVD+M++VA M+ +LTVEERNLLSVAYKNVIG+RRASWRIISSIEQK E K  E KL +I+++R+ +E EL  +C DI+ VLD +L+ +A + E++VF+ KMKGDY+RYLAEF    +RK+AAENSL AYK AS IA ++LQPTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAIAELD LSEESYKDSTLIMQLLRDNLTLWTSDM
Sbjct:    1 MANREDLVYQAKLAEQAERYDEMVDSMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQTVETELKSICNDILDVLDKHLIPAANSGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTDLQPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDM 235          
BLAST of 14-3-3 protein epsilon vs. Ensembl Cavefish
Match: ywhae2 (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 2 [Source:ZFIN;Acc:ZDB-GENE-050306-44])

HSP 1 Score: 291.197 bits (744), Expect = 6.763e-98
Identity = 165/235 (70.21%), Postives = 190/235 (80.85%), Query Frame = 3
Query:   99 MGDREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPE-KLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDM 800
            M DRE  VY+AKLAEQAERY+EMV++M+ VA  + +LTVEERNLLSVAYKNVIG+RRASWRIISSIEQK E K  E KL +I+++R+ +E+EL  +C DI+              +++VF+ KMKGDY+RYLAEF    +RK+AAENSL AYK AS IA  EL PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAIAELD LSEESYKDSTLIMQLLRDNLTLWTSDM
Sbjct:    1 MADREHFVYQAKLAEQAERYDEMVESMKSVAGKDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEESKGGEDKLKMIREYRQTVEKELKSICNDIL--------------DSKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMIELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDM 221          
BLAST of 14-3-3 protein epsilon vs. Ensembl Cavefish
Match: ywhaqb (14-3-3 protein beta/alpha-like [Source:NCBI gene;Acc:107197738])

HSP 1 Score: 281.952 bits (720), Expect = 2.467e-94
Identity = 148/233 (63.52%), Postives = 194/233 (83.26%), Query Frame = 3
Query:  105 DREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPEKLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDMA 803
            DR E + KAKLAEQAERY++M  +M+EV    ++L+ EERNLLSVAYKNV+G+RR++WR+ISSIEQK E  D +KL ++K++RE++E EL ++C D++ +L+  L++++TN E++VF+LKMKGDYYRYLAE     ++K   ENS  AY++A  I+ +E+QPTHPIRLGLALNFSVF+YEILNS ++AC LAK+AFD+AIAELD L+EESYKDSTLIMQLLRDNLTLWTSD A
Sbjct:    2 DRTELIQKAKLAEQAERYDDMAASMKEVTEAGTELSNEERNLLSVAYKNVVGARRSAWRVISSIEQKTEGND-KKLQMVKEYREKVESELKEICNDVLELLNKYLIENSTNPESKVFYLKMKGDYYRYLAEVASGDDKKATIENSQDAYQKAFDISKTEMQPTHPIRLGLALNFSVFFYEILNSPEKACSLAKQAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSDNA 233          
BLAST of 14-3-3 protein epsilon vs. Ensembl Cavefish
Match: ywhaqa (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta [Source:NCBI gene;Acc:103042311])

HSP 1 Score: 276.174 bits (705), Expect = 4.386e-92
Identity = 147/233 (63.09%), Postives = 192/233 (82.40%), Query Frame = 3
Query:  105 DREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPEKLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDMA 803
            D+ E + KAKLAEQAERY++M  +M+ V    S+LT EERNLLSVAYKNV+G+RR++WR+ISSIEQK E  D +KL ++K++RE++E+EL ++C D++ +L   L++++++ E++VF+LKMKGDYYRYLAE     ++KD   NS SAY+ A  I+  E+QPTHPIRLGLALNFSVFYYEILNS ++AC LAK+AFD+AIAELD L+E+SYKDSTLIMQLLRDNLTLWTSD A
Sbjct:    2 DKTELIQKAKLAEQAERYDDMAASMKLVTEQGSELTNEERNLLSVAYKNVVGARRSAWRVISSIEQKTEGSD-KKLQMVKEYREKVEEELREICNDVLGLLSKYLIENSSSAESKVFYLKMKGDYYRYLAEVASGDDKKDTISNSQSAYQDAFDISKKEMQPTHPIRLGLALNFSVFYYEILNSPEQACALAKQAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDNA 233          
BLAST of 14-3-3 protein epsilon vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007337.1 (pep scaffold:Pmarinus_7.0:GL477279:15491:28515:1 gene:ENSPMAG00000006598.1 transcript:ENSPMAT00000007337.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 317.39 bits (812), Expect = 1.146e-108
Identity = 170/235 (72.34%), Postives = 204/235 (86.81%), Query Frame = 3
Query:   99 MGDREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPE-KLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDM 800
            M +RE++VY+AKLAEQAERY+EMV+ M++VA +N++L+VEERNLLSVAYKNVIG+RRASWRIISSIEQK E K  E KL +I+++R+ +E+EL D+C DI+ VLD +L+ +A   E++VF+ KMKGDY+RYLAEF    +RK+AAENSL AYK AS IA +EL PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAIAELD LSE+SYKDSTLIMQLLRDNLTLWTSDM
Sbjct:    1 MEEREDQVYQAKLAEQAERYDEMVEVMKKVAGLNTELSVEERNLLSVAYKNVIGARRASWRIISSIEQKEESKGSEGKLKIIREYRQTVEKELKDICMDILEVLDKHLIPAAMTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIATTELPPTHPIRLGLALNFSVFYYEILNSPDRACKLAKTAFDDAIAELDTLSEDSYKDSTLIMQLLRDNLTLWTSDM 235          
BLAST of 14-3-3 protein epsilon vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006708.1 (pep scaffold:Pmarinus_7.0:GL478275:1612:6605:-1 gene:ENSPMAG00000006053.1 transcript:ENSPMAT00000006708.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 285.034 bits (728), Expect = 2.399e-96
Identity = 155/214 (72.43%), Postives = 185/214 (86.45%), Query Frame = 3
Query:  162 EMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPE-KLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDM 800
            EMV++M++VA ++ +L+VEERNLLSVAYKNVIG+RRASWRIISSIEQK E K  E KL +I+++R+ +E+EL  +C DI+ VLD +L+ +A+  E++VF+ KMKGDY+RYLAEFT   +RK+AAENSL AYK AS IA +EL PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAIAELD LSEESYKDSTLIMQLLRDNLTLWTSDM
Sbjct:    1 EMVESMKKVAALDVELSVEERNLLSVAYKNVIGARRASWRIISSIEQKEESKGGEEKLKLIREYRQMVEKELKSICGDILDVLDKHLIPTASTGESKVFYYKMKGDYHRYLAEFTTANDRKEAAENSLVAYKAASDIATTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDM 214          
BLAST of 14-3-3 protein epsilon vs. Ensembl Sea Lamprey
Match: ywhaqb (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide b [Source:ZFIN;Acc:ZDB-GENE-030131-7135])

HSP 1 Score: 267.7 bits (683), Expect = 2.012e-89
Identity = 143/231 (61.90%), Postives = 186/231 (80.52%), Query Frame = 3
Query:  105 DREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPEKLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSD 797
            ++ E V KAKLAEQAERY++M  AM+ V     +L+ EERNLLSVAYKNV+G+RR++WR+ISSIEQK++  D +K  + K++R ++E+EL D+C D++ +LD +L+ SAT+ E++VF+ KMKGDYYRYLAE  V I++  A E S +AY  A  ++ +E+ PTHPIRLGLALNFSVFYYEILNS ++AC LAK AFD+AIAELD L+E+SYKDSTLIMQLLRDNLTLW SD
Sbjct:    4 EKSELVQKAKLAEQAERYDDMSAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSAWRVISSIEQKSDASD-KKQHMAKEYRHKVEKELCDICNDVLALLDKHLIVSATSAESKVFYQKMKGDYYRYLAEVAVGIDKASAMERSQAAYLSAFDVSKAEMSPTHPIRLGLALNFSVFYYEILNSPEKACNLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWASD 233          
BLAST of 14-3-3 protein epsilon vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005915.1 (pep scaffold:Pmarinus_7.0:GL476980:154455:158510:1 gene:ENSPMAG00000005339.1 transcript:ENSPMAT00000005915.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 259.61 bits (662), Expect = 4.103e-86
Identity = 144/236 (61.02%), Postives = 184/236 (77.97%), Query Frame = 3
Query:   99 MGDREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPEK-LPVIKKFREQIEQELGDVCKDIIRVLDANLLQSA--TNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSD 797
            M DRE  V KA+LAEQAERY++M  AM+ V  +N  L+ EERNLLSVAYKNV+G+RR++WR+ISSIEQK      EK   ++K +RE++E+EL  VC+D++ +LD  L++S   + +E++VF+LKMKGDY+RYLAE     +R     NS  AYK+A  I    +QPTHPIRLGLALNFSVFYYEI N+ ++AC+LAK AFDD+IAELD+L+E+SYKDSTLIMQLLRDNLTLWTSD
Sbjct:    1 MADRELLVQKARLAEQAERYDDMAAAMKAVTELNEPLSNEERNLLSVAYKNVVGARRSAWRVISSIEQKTAGDGSEKKQAMVKAYREKVEKELETVCQDVLDLLDKFLVKSCDDSQQESKVFYLKMKGDYFRYLAEVAAGDKRDGVVLNSEKAYKEAYEICKEHMQPTHPIRLGLALNFSVFYYEIQNAPEQACELAKTAFDDSIAELDSLNEDSYKDSTLIMQLLRDNLTLWTSD 236          
BLAST of 14-3-3 protein epsilon vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011016.1 (pep scaffold:Pmarinus_7.0:GL483328:5531:6205:1 gene:ENSPMAG00000009989.1 transcript:ENSPMAT00000011016.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 229.18 bits (583), Expect = 1.395e-74
Identity = 125/209 (59.81%), Postives = 164/209 (78.47%), Query Frame = 3
Query:  180 REVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQK-AEQKDPEKLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNE--EARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSD 797
            R+V  +   L+ EERNLLSVAYKNV+G+RR++WR+ISSIEQK A   + ++L +++ +RE+IEQEL  VC D++ +LD +L+    +   E++VF+LKMKGDY+RYLAE     +R     NS  AYK+A  ++  ++ PTHPIRLGLALNFSVFYYEI N+ ++ACQLAK AFD+AIAELD+L+E+SYKDSTLIMQLLRDNLTLWTSD
Sbjct:    6 RQVTELTEPLSNEERNLLSVAYKNVVGARRSAWRVISSIEQKTATDGNEKRLGLVRSYREKIEQELEAVCGDVLNLLDNHLIPRCDHPQYESKVFYLKMKGDYFRYLAEVATGEKRDHVVSNSEKAYKEAYEVSKEQMMPTHPIRLGLALNFSVFYYEIQNAPEQACQLAKTAFDEAIAELDSLNEDSYKDSTLIMQLLRDNLTLWTSD 214          
BLAST of 14-3-3 protein epsilon vs. Ensembl Yeast
Match: BMH2 (14-3-3 protein, minor isoform; controls proteome at post-transcriptional level, binds proteins and DNA, involved in regulation of many processes including exocytosis, vesicle transport, Ras/MAPK signaling, and rapamycin-sensitive signaling; protein increases in abundance and relative distribution to the nucleus increases upon DNA replication stress; abundance relative to Bmh1p increases during sporulation [Source:SGD;Acc:S000002506])

HSP 1 Score: 293.123 bits (749), Expect = 3.429e-99
Identity = 160/234 (68.38%), Postives = 191/234 (81.62%), Query Frame = 3
Query:  108 REEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDP--EKLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDMA 803
            RE+ VY AKLAEQAERYEEMV+ M+ VA    +L+VEERNLLSVAYKNVIG+RRASWRI+SSIEQK E K+    ++ +I+ +R +IE EL  +  DI+ VLD++L+ SAT  E++VF+ KMKGDY+RYLAEF+    R+ A  +SL AYK AS IA +EL PTHPIRLGLALNFSVFYYEI NS D+AC LAK+AFDDAIAELD LSEESYKDSTLIMQLLRDNLTLWTSD++
Sbjct:    5 REDSVYLAKLAEQAERYEEMVENMKAVASSGQELSVEERNLLSVAYKNVIGARRASWRIVSSIEQKEESKEKSEHQVELIRSYRSKIETELTKISDDILSVLDSHLIPSATTGESKVFYYKMKGDYHRYLAEFSSGDAREKATNSSLEAYKTASEIATTELPPTHPIRLGLALNFSVFYYEIQNSPDKACHLAKQAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDIS 238          
BLAST of 14-3-3 protein epsilon vs. Ensembl Yeast
Match: BMH1 (14-3-3 protein, major isoform; controls proteome at post-transcriptional level, binds proteins and DNA, involved in regulation of exocytosis, vesicle transport, Ras/MAPK and rapamycin-sensitive signaling, aggresome formation, spindle position checkpoint; protein increases in abundance and relative distribution to the nucleus increases upon DNA replication stress; antiapoptotic gene similar to human 14-3-3; BMH1 has a paralog, BMH2, that arose from whole genome duplication [Source:SGD;Acc:S000000979])

HSP 1 Score: 291.582 bits (745), Expect = 1.025e-98
Identity = 161/234 (68.80%), Postives = 189/234 (80.77%), Query Frame = 3
Query:  108 REEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDP--EKLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDMA 803
            RE+ VY AKLAEQAERYEEMV+ M+ VA    +L+VEERNLLSVAYKNVIG+RRASWRI+SSIEQK E K+    ++ +I  +R +IE EL  +  DI+ VLD++L+ SAT  E++VF+ KMKGDY+RYLAEF+    R+ A   SL AYK AS IA +EL PTHPIRLGLALNFSVFYYEI NS D+AC LAK+AFDDAIAELD LSEESYKDSTLIMQLLRDNLTLWTSDM+
Sbjct:    5 REDSVYLAKLAEQAERYEEMVENMKTVASSGQELSVEERNLLSVAYKNVIGARRASWRIVSSIEQKEESKEKSEHQVELICSYRSKIETELTKISDDILSVLDSHLIPSATTGESKVFYYKMKGDYHRYLAEFSSGDAREKATNASLEAYKTASEIATTELPPTHPIRLGLALNFSVFYYEIQNSPDKACHLAKQAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMS 238          
BLAST of 14-3-3 protein epsilon vs. Ensembl Nematostella
Match: EDO41372 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4S2])

HSP 1 Score: 282.722 bits (722), Expect = 4.776e-95
Identity = 153/235 (65.11%), Postives = 199/235 (84.68%), Query Frame = 3
Query:   99 MGDREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQK--DPEKLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSD 797
            M D+EE VY AKLAEQAERY++MV++M+EVA+M ++L+ E+RNLLSVAYKNVIG+RRASWRII+SIEQK E K  D  KL +I+ +R+ IE+EL  +C +I+ +LD +L++++ +EE++VF+ KMKGDY+RY+AEF+ +  R +AA+ S +AYK+A TIA   L  THPIRLGLALNFSVFYYEI N+ ++AC+LAK+AFDDAI+ELD+L EESYKDSTLIMQLLRDNLTLWTSD
Sbjct:    1 MADKEEHVYMAKLAEQAERYDDMVNSMKEVAKMGTELSTEDRNLLSVAYKNVIGARRASWRIITSIEQKEESKGEDMAKLEMIRNYRKTIEEELKTICGEILSLLDDSLIKNSQSEESKVFYNKMKGDYHRYVAEFSKE-GRDEAAKQSETAYKEAQTIATEHLAKTHPIRLGLALNFSVFYYEIQNAPEKACKLAKEAFDDAISELDSLQEESYKDSTLIMQLLRDNLTLWTSD 234          
BLAST of 14-3-3 protein epsilon vs. Ensembl Nematostella
Match: EDO42175 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S252])

HSP 1 Score: 241.121 bits (614), Expect = 9.706e-79
Identity = 143/234 (61.11%), Postives = 175/234 (74.79%), Query Frame = 3
Query:  108 REEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPEKLPVI-KKFREQIEQELGDVCKDIIRVLDANLL---QSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSD 797
            REE ++ AK+AEQAERY++MV+AM  V +    L  EERNLLSVAYKNV+G+RR+SWR+ISS+EQKA    PE++  + KK+RE I  EL   C +++ +L+  LL   Q   N EA+VF+LKM+GDY+RYL E      RK+  E S  AYK AS  A+ EL P+HPIRLGLALNFSVFYYEI N    AC+LAK+AFDDAIA LDNL +ESYKDSTLIMQLLRDNLTLWTS+
Sbjct:   11 REELIHLAKMAEQAERYDDMVNAMSAVTKEGKPLNDEERNLLSVAYKNVVGARRSSWRVISSMEQKA----PEEMAALTKKYREDITNELNGKCAEVLDILENYLLKDGQDDINTEAKVFYLKMRGDYHRYLVEVAEGDSRKENIEKSREAYKDASAKAE-ELSPSHPIRLGLALNFSVFYYEIENKPPEACKLAKEAFDDAIAVLDNLKDESYKDSTLIMQLLRDNLTLWTSE 239          
BLAST of 14-3-3 protein epsilon vs. Ensembl Nematostella
Match: EDO42859 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0E0])

HSP 1 Score: 239.195 bits (609), Expect = 5.877e-78
Identity = 134/235 (57.02%), Postives = 178/235 (75.74%), Query Frame = 3
Query:   99 MGDREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPEKLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIA--DSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSD 797
            M  +EE V  AK AEQAERYE+M  AM+E   ++  L  EERNLLSVAYKNV+G++R+SWR+ISSIEQK E  + +K    + +R+ IE EL +VC+ ++++L++ L+ +A + E++VF+LKMKGDYYRY  E      R++  + ++ AY +A  IA  D +L PT PIRLGLALNFSVFYYEI+  + +AC LAKKAFDDAIAELD+L+E+ YKDSTLIMQLLRDNLTLW+S+
Sbjct:    1 MASKEELVQMAKYAEQAERYEDMAKAMKEATEISETLEQEERNLLSVAYKNVVGAKRSSWRVISSIEQKLEGSERKKQNT-ETYRQTIENELNEVCETVLKLLESKLIPNAQSTESKVFYLKMKGDYYRYEGEVAGADRRREVVQKAMKAYSEAQEIAEKDPKLPPTDPIRLGLALNFSVFYYEIVEDSKQACDLAKKAFDDAIAELDSLNEDQYKDSTLIMQLLRDNLTLWSSE 234          
BLAST of 14-3-3 protein epsilon vs. Ensembl Nematostella
Match: EDO42821 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0E3])

HSP 1 Score: 182.57 bits (462), Expect = 1.768e-55
Identity = 114/268 (42.54%), Postives = 156/268 (58.21%), Query Frame = 3
Query:  108 REEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXE-QKAEQKDPEKLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKD----------------------------------------AAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLW 788
            R E V  AKLAEQ ER+E+++  M++   +N  L  E RNLLSV YKNV+GS+R +WR +     Q        +L  I K++E+IE EL  +C++I+ +++  LL +A + EA+VF+ KM GDY+RYLAE     ++KD                                        AAE SL AYK AS+ A   L PT P+RLGLALNF+VFY EILN A+ A   +K+A+  A+ E+D+LSEE Y+DS LIM LL DN+T+W
Sbjct:    5 RNELVQLAKLAEQTERFEDVILYMKKAIEINPSLNKEHRNLLSVGYKNVVGSKRFAWRHLHHDALQSGRYIRDSQLKGIIKYKEKIEMELKTLCREILTLIETCLLDAAEDAEAKVFYDKMTGDYWRYLAEIYSGKQQKDSYGTAVEHEDACDNYDASDNYIACGNYDACDIDNWYDDDEAAERSLGAYKHASSTAAEYLSPTDPVRLGLALNFAVFYKEILNEAEMAIMHSKQAYAAALPEMDSLSEEVYRDSNLIMHLLNDNITIW 272          
BLAST of 14-3-3 protein epsilon vs. Ensembl Medaka
Match: ywhae2 (14-3-3 protein epsilon [Source:NCBI gene;Acc:101175099])

HSP 1 Score: 310.457 bits (794), Expect = 2.330e-104
Identity = 169/235 (71.91%), Postives = 202/235 (85.96%), Query Frame = 3
Query:   99 MGDREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPE-KLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDM 800
            M DR+  VY+AKLAEQAERY+EMV++M++VA M+ +LTVEERNLLSVAYKNVIG+RRASWRIISS+EQK E K  E KL +I+++R+ +E+EL  +C DI+ VLD +L+ +AT  E++VF+ KMKGDY+RYLAEF    +RK+AAENSL AYK AS IA  EL PTHPIRLGLALNFSVFYYEILNS DRAC+LAK+AFD+AIAELD LSEESYKDSTLIMQLLRDNLTLWTSD+
Sbjct:   71 MADRDNLVYQAKLAEQAERYDEMVESMKKVASMDVELTVEERNLLSVAYKNVIGARRASWRIISSLEQKEENKGGEDKLKMIREYRKTVEKELKSICNDILDVLDKHLILAATTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMIELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKEAFDNAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDI 305          
BLAST of 14-3-3 protein epsilon vs. Ensembl Medaka
Match: ywhae2 (14-3-3 protein epsilon [Source:NCBI gene;Acc:101175099])

HSP 1 Score: 310.457 bits (794), Expect = 4.484e-104
Identity = 169/235 (71.91%), Postives = 202/235 (85.96%), Query Frame = 3
Query:   99 MGDREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPE-KLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDM 800
            M DR+  VY+AKLAEQAERY+EMV++M++VA M+ +LTVEERNLLSVAYKNVIG+RRASWRIISS+EQK E K  E KL +I+++R+ +E+EL  +C DI+ VLD +L+ +AT  E++VF+ KMKGDY+RYLAEF    +RK+AAENSL AYK AS IA  EL PTHPIRLGLALNFSVFYYEILNS DRAC+LAK+AFD+AIAELD LSEESYKDSTLIMQLLRDNLTLWTSD+
Sbjct:   71 MADRDNLVYQAKLAEQAERYDEMVESMKKVASMDVELTVEERNLLSVAYKNVIGARRASWRIISSLEQKEENKGGEDKLKMIREYRKTVEKELKSICNDILDVLDKHLILAATTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMIELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKEAFDNAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDI 305          
BLAST of 14-3-3 protein epsilon vs. Ensembl Medaka
Match: ENSORLT00000012247.2 (14-3-3 protein epsilon [Source:NCBI gene;Acc:101165659])

HSP 1 Score: 304.294 bits (778), Expect = 5.836e-103
Identity = 168/235 (71.49%), Postives = 199/235 (84.68%), Query Frame = 3
Query:   99 MGDREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPE-KLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDM 800
            MG+RE+ VY+AKLAEQAERY+EMV +M++VA M+ +LTVEERNLLSVAYKNVIG+RRASWRIISSIEQ+ E K  E KL +I+++R+ +E+EL  +C DI+  L+ +LL SA   E++VF+ KMKGDY+RYLAEF     RK+AAENSL AYK A+ +A  EL PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAIAELD LSE+SYKDSTLIMQLLRDNLTLWTSDM
Sbjct:    1 MGEREDLVYQAKLAEQAERYDEMVVSMKKVASMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQREESKGGEDKLKMIREYRQTVEKELKTICGDILDALERHLLPSAVMGESKVFYNKMKGDYHRYLAEFATGNNRKEAAENSLVAYKTATDLAMLELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEDSYKDSTLIMQLLRDNLTLWTSDM 235          
BLAST of 14-3-3 protein epsilon vs. Ensembl Medaka
Match: ENSORLT00000027323.1 (14-3-3 protein zeta [Source:NCBI gene;Acc:101163516])

HSP 1 Score: 273.092 bits (697), Expect = 9.750e-91
Identity = 152/241 (63.07%), Postives = 191/241 (79.25%), Query Frame = 3
Query:   90 TIKMGDREEK--VYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPEKLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDMAT 806
            T+ M +  +K  V KAKLAEQAERY++M  AM+ V   +  L+ EERNLLSVAYKNV+G+RR+SWR++SSIEQKAE  D +K  + +++RE+IEQEL D+C D++ +LD  L+  A+  E++VF+LKMKGDYYRYLAE     ++K    +S +AYK+A  I+  E+QPTHPIRLGLALN+SVF+YEILNS + ACQLAK+AFDDAIAELD LSEESYKDSTLIMQLLRDNLTLWTSD  T
Sbjct:    6 TVIMSEAPQKDLVQKAKLAEQAERYDDMATAMKTVTEDSEQLSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKAEGSDRKK-AMAQEYREKIEQELKDICNDVLGLLDKFLIPKASTAESKVFYLKMKGDYYRYLAEVASKEDKKGIIGDSQAAYKEAFEISKMEMQPTHPIRLGLALNYSVFFYEILNSPEEACQLAKQAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDNQT 245          
BLAST of 14-3-3 protein epsilon vs. Ensembl Medaka
Match: ENSORLT00000032209.1 (14-3-3 protein zeta [Source:NCBI gene;Acc:101163516])

HSP 1 Score: 272.322 bits (695), Expect = 1.498e-90
Identity = 149/229 (65.07%), Postives = 185/229 (80.79%), Query Frame = 3
Query:  120 VYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPEKLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDMAT 806
            V KAKLAEQAERY++M  AM+ V   +  L+ EERNLLSVAYKNV+G+RR+SWR++SSIEQKAE  D +K  + +++RE+IEQEL D+C D++ +LD  L+  A+  E++VF+LKMKGDYYRYLAE     ++K    +S +AYK+A  I+  E+QPTHPIRLGLALN+SVF+YEILNS + ACQLAK+AFDDAIAELD LSEESYKDSTLIMQLLRDNLTLWTSD  T
Sbjct:   10 VQKAKLAEQAERYDDMATAMKTVTEDSEQLSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKAEGSDRKK-AMAQEYREKIEQELKDICNDVLGLLDKFLIPKASTAESKVFYLKMKGDYYRYLAEVASKEDKKGIIGDSQAAYKEAFEISKMEMQPTHPIRLGLALNYSVFFYEILNSPEEACQLAKQAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDNQT 237          
BLAST of 14-3-3 protein epsilon vs. Planmine SMEST
Match: SMESG000075252.1 (SMESG000075252.1)

HSP 1 Score: 446.817 bits (1148), Expect = 2.204e-159
Identity = 236/236 (100.00%), Postives = 236/236 (100.00%), Query Frame = 3
Query:   99 MGDREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPEKLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDMAT 806
            MGDREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVIGSRRASWRIISSIEQKAEQKDPEKLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDMAT
Sbjct:    1 MGDREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVIGSRRASWRIISSIEQKAEQKDPEKLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDMAT 236          
BLAST of 14-3-3 protein epsilon vs. Planmine SMEST
Match: SMESG000075252.1 (SMESG000075252.1)

HSP 1 Score: 446.432 bits (1147), Expect = 4.266e-159
Identity = 236/236 (100.00%), Postives = 236/236 (100.00%), Query Frame = 3
Query:   99 MGDREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPEKLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDMAT 806
            MGDREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVIGSRRASWRIISSIEQKAEQKDPEKLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDMAT
Sbjct:    1 MGDREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVIGSRRASWRIISSIEQKAEQKDPEKLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDMAT 236          
BLAST of 14-3-3 protein epsilon vs. Planmine SMEST
Match: SMESG000047644.1 (SMESG000047644.1)

HSP 1 Score: 360.533 bits (924), Expect = 2.261e-125
Identity = 188/233 (80.69%), Postives = 214/233 (91.85%), Query Frame = 3
Query:   99 MGDREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPEKLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSD 797
            M DRE KVY+AKLAEQAERY+EMVDAMR+VA+M  +L +EERNLLSVAYKNVIGSRRASWRI+SSIEQKAEQKDP +LP+IK +R Q+E+EL +VC DII +LD ++L +A+  EA+VFFLKMKGDYYRYL+EFTVD ERK AAENSL+AYK+A+ IA+S+LQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAI ELDNL+EESYKDSTLIMQLLRDNLTLWTSD
Sbjct:    1 MTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPSRLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSD 233          
BLAST of 14-3-3 protein epsilon vs. Planmine SMEST
Match: SMESG000076939.1 (SMESG000076939.1)

HSP 1 Score: 277.715 bits (709), Expect = 1.230e-92
Identity = 153/235 (65.11%), Postives = 193/235 (82.13%), Query Frame = 3
Query:   99 MGDREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQKDPEKLPV--IKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLS-EESYKDSTLIMQLLRDNLTLWTS 794
            M DREE VY+AKLAEQAERY+EMV +M+ VA  +S+L+VEERNLLSVA+KNVIGSRRASWRI+S+IEQ+ E K   ++ +   K +R+Q+E+EL +VC ++++VLD  LL  A+N E++VF+LKMKGDYYRY AEF VD ER++ A+ SL+AY+ A T A+S L  THPIRLGLALNFSVFY+EI+ + ++AC LAK AFD AI ELDNL+ EE+YKDSTLIMQLLRDNLTLW S
Sbjct:    1 MADREENVYRAKLAEQAERYDEMVKSMKCVAASDSELSVEERNLLSVAFKNVIGSRRASWRILSTIEQREEAKGSSQMRIELAKAYRKQVEKELAEVCDEVVKVLDTQLLPKASNTESQVFYLKMKGDYYRYRAEFAVDKEREEVAQKSLAAYESAMTEAES-LSATHPIRLGLALNFSVFYFEIMGNPEKACSLAKTAFDQAIGELDNLTEEENYKDSTLIMQLLRDNLTLWNS 234          
BLAST of 14-3-3 protein epsilon vs. Planmine SMEST
Match: SMESG000058073.1 (SMESG000058073.1)

HSP 1 Score: 266.929 bits (681), Expect = 1.680e-88
Identity = 144/235 (61.28%), Postives = 195/235 (82.98%), Query Frame = 3
Query:   99 MGDREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVXXXXXXXXXXXXXXEQKAEQK--DPEKLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEE-SYKDSTLIMQLLRDNLTLWTS 794
            M DR++ VYKAKL+EQAERY+EMV +++ VA    +LTVEERNLLSVAYKNVIGSRR+SWRI+SSIEQK E K     ++ + + +R+Q+E+EL  +C ++I++LD +L++ A+  E++VF+LKMKGDYYRY AEF+++ +R++ AE S  AY +A  +++ EL  THPIRLGLALN+SVF+YEI+ S+++AC+LAKKAFD AI+ELD+L+EE SYKDSTLIMQLLRDNLTLWT+
Sbjct:    1 MTDRDDNVYKAKLSEQAERYDEMVKSIKLVAESGVELTVEERNLLSVAYKNVIGSRRSSWRILSSIEQKEESKAISTSRIEIARNYRKQVEKELSGICIEVIKILDDHLIKVASTTESKVFYLKMKGDYYRYNAEFSIEKDRQEIAEKSNQAYSEALQLSE-ELGATHPIRLGLALNYSVFFYEIMGSSEKACELAKKAFDKAISELDSLTEEDSYKDSTLIMQLLRDNLTLWTA 234          
The following BLAST results are available for this feature:
BLAST of 14-3-3 protein epsilon vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
YWHAE3.804e-10573.19tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
YWHAE3.804e-10573.19tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
YWHAE3.386e-9372.77tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
YWHAE3.386e-9372.77tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
YWHAQ6.265e-8961.80tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
back to top
BLAST of 14-3-3 protein epsilon vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ftt-28.050e-9162.6614-3-3-like protein 2 [Source:UniProtKB/Swiss-Pro... [more]
ftt-28.050e-9162.6614-3-3-like protein 2 [Source:UniProtKB/Swiss-Pro... [more]
ftt-28.050e-9162.6614-3-3-like protein 2 [Source:UniProtKB/Swiss-Pro... [more]
par-53.186e-8863.2014-3-3-like protein 1 [Source:UniProtKB/Swiss-Pro... [more]
par-53.186e-8863.2014-3-3-like protein 1 [Source:UniProtKB/Swiss-Pro... [more]
back to top
BLAST of 14-3-3 protein epsilon vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
14-3-3epsilon3.311e-10974.47gene:FBgn0020238 transcript:FBtr0083567[more]
14-3-3epsilon3.930e-10974.47gene:FBgn0020238 transcript:FBtr0083566[more]
14-3-3epsilon4.390e-10974.47gene:FBgn0020238 transcript:FBtr0083565[more]
14-3-3epsilon4.724e-10974.47gene:FBgn0020238 transcript:FBtr0083568[more]
14-3-3zeta4.110e-9063.20gene:FBgn0004907 transcript:FBtr0088413[more]
back to top
BLAST of 14-3-3 protein epsilon vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ywhae14.248e-10974.04tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
ywhae14.248e-10974.04tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
ywhae14.248e-10974.04tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
ywhae23.858e-10471.49tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
ywhaqb5.473e-9463.52tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
back to top
BLAST of 14-3-3 protein epsilon vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ywhae3.022e-10572.77tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
ywhae3.723e-10572.77tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
ywhae5.510e-10572.77tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
ywhab1.779e-8861.90tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
insm12.296e-8661.86insulinoma associated 1 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of 14-3-3 protein epsilon vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ywhae2.611e-10573.19tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
Ywhaq8.983e-9062.23tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
Ywhaq8.983e-9062.23tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
Ywhab1.061e-8862.77tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
Ywhaz1.438e-8862.34tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
back to top
BLAST of 14-3-3 protein epsilon vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P92177|1433E_DROME4.401e-10874.4714-3-3 protein epsilon OS=Drosophila melanogaster ... [more]
sp|P62262|1433E_SHEEP1.827e-10473.1914-3-3 protein epsilon OS=Ovis aries OX=9940 GN=YW... [more]
sp|P62260|1433E_RAT1.827e-10473.1914-3-3 protein epsilon OS=Rattus norvegicus OX=101... [more]
sp|P62259|1433E_MOUSE1.827e-10473.1914-3-3 protein epsilon OS=Mus musculus OX=10090 GN... [more]
sp|P62258|1433E_HUMAN1.827e-10473.1914-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=... [more]
back to top
BLAST of 14-3-3 protein epsilon vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267H3841.528e-10875.9714_3_3 domain-containing protein OS=Macrostomum li... [more]
A0A267GD541.742e-10875.9714_3_3 domain-containing protein OS=Macrostomum li... [more]
A0A226F2M14.481e-10875.3214-3-3 protein OS=Folsomia candida OX=158441 GN=Fc... [more]
A0A182Q9Y31.949e-10774.1714_3_3 domain-containing protein OS=Anopheles fara... [more]
A0A1I8H1Q02.218e-10774.0414_3_3 domain-containing protein OS=Macrostomum li... [more]
back to top
BLAST of 14-3-3 protein epsilon vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ywhae11.299e-10773.19tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
ywhae12.271e-10773.19tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
ywhae26.763e-9870.21tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
ywhaqb2.467e-9463.5214-3-3 protein beta/alpha-like [Source:NCBI gene;A... [more]
ywhaqa4.386e-9263.09tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
back to top
BLAST of 14-3-3 protein epsilon vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007337.11.146e-10872.34pep scaffold:Pmarinus_7.0:GL477279:15491:28515:1 g... [more]
ENSPMAT00000006708.12.399e-9672.43pep scaffold:Pmarinus_7.0:GL478275:1612:6605:-1 ge... [more]
ywhaqb2.012e-8961.90tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
ENSPMAT00000005915.14.103e-8661.02pep scaffold:Pmarinus_7.0:GL476980:154455:158510:1... [more]
ENSPMAT00000011016.11.395e-7459.81pep scaffold:Pmarinus_7.0:GL483328:5531:6205:1 gen... [more]
back to top
BLAST of 14-3-3 protein epsilon vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
BMH23.429e-9968.3814-3-3 protein, minor isoform; controls proteome a... [more]
BMH11.025e-9868.8014-3-3 protein, major isoform; controls proteome a... [more]
back to top
BLAST of 14-3-3 protein epsilon vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO413724.776e-9565.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421759.706e-7961.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428595.877e-7857.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428211.768e-5542.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 14-3-3 protein epsilon vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ywhae22.330e-10471.9114-3-3 protein epsilon [Source:NCBI gene;Acc:10117... [more]
ywhae24.484e-10471.9114-3-3 protein epsilon [Source:NCBI gene;Acc:10117... [more]
ENSORLT00000012247.25.836e-10371.4914-3-3 protein epsilon [Source:NCBI gene;Acc:10116... [more]
ENSORLT00000027323.19.750e-9163.0714-3-3 protein zeta [Source:NCBI gene;Acc:10116351... [more]
ENSORLT00000032209.11.498e-9065.0714-3-3 protein zeta [Source:NCBI gene;Acc:10116351... [more]
back to top
BLAST of 14-3-3 protein epsilon vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000075252.12.204e-159100.00SMESG000075252.1[more]
SMESG000075252.14.266e-159100.00SMESG000075252.1[more]
SMESG000047644.12.261e-12580.69SMESG000047644.1[more]
SMESG000076939.11.230e-9265.11SMESG000076939.1[more]
SMESG000058073.11.680e-8861.28SMESG000058073.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035734 ID=SMED30035734|Name=14-3-3 protein epsilon|organism=Schmidtea mediterranea sexual|type=transcript|length=1076bp
ATTTAGTGTTGCTAGGATAAGTAGTACTTTCATTTTAAATTTTTTATAAA
ACTACAATTTCTTGCACATAAAATTTTATTATTTCATTGACAATAAAGAT
GGGAGATAGAGAAGAAAAAGTTTACAAAGCAAAATTAGCCGAACAAGCTG
AAAGATATGAAGAAATGGTTGATGCTATGCGAGAAGTGGCACGAATGAAT
AGTGATTTGACAGTCGAAGAGCGGAATCTTTTGTCAGTCGCTTATAAAAA
TGTAATAGGTTCTAGAAGAGCATCGTGGCGAATAATAAGTAGTATCGAAC
AAAAAGCAGAACAAAAAGATCCAGAAAAATTACCTGTTATTAAAAAATTT
CGTGAACAAATTGAACAAGAGTTGGGAGATGTATGCAAGGACATCATTAG
AGTGTTGGATGCTAATCTATTGCAAAGTGCAACAAATGAAGAAGCACGAG
TATTTTTCCTCAAAATGAAAGGAGATTATTACCGATATCTGGCCGAATTC
ACTGTGGACATCGAACGAAAGGATGCTGCTGAAAACAGTTTGAGTGCATA
CAAGCAAGCCTCGACAATTGCTGACAGTGAATTACAACCGACCCATCCTA
TCAGATTGGGATTGGCATTGAATTTCTCGGTATTTTATTACGAAATTCTC
AACTCAGCTGATCGCGCCTGCCAATTGGCGAAAAAAGCATTTGATGATGC
AATAGCAGAATTGGATAATTTGTCTGAGGAAAGCTACAAGGATTCGACAT
TAATAATGCAATTGTTGCGCGACAATTTGACCTTGTGGACATCTGACATG
GCGACGGAAGAGAAAAGCAAGGACAAAGTTGAAGATGTTGAAAATGAAAA
TGATTAGAAAATTCTAGTTTGATGATTTAAAAATTAGTTTCTCGATTATT
TGTTAATTATTTGTTTCTTGAATTAGTAATTAAATCATTGTTGCTTTTGA
ATTAGTTGAATTTTATTTTATTTTTTCTAAATAGATGTCGTTACAAATTC
TTTCAGTTGTATTGTTGTTTGTTCGGTATTATGAGTATGGTTGAGCAGGA
GCATTGGATCAATTATTCTATCACTA
back to top

protein sequence of SMED30035734-orf-1

>SMED30035734-orf-1 ID=SMED30035734-orf-1|Name=SMED30035734-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=253bp
MGDREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYK
NVIGSRRASWRIISSIEQKAEQKDPEKLPVIKKFREQIEQELGDVCKDII
RVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSA
YKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDD
AIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDMATEEKSKDKVEDVENE
ND*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000165MAPK cascade
GO:0034504protein localization to nucleus
GO:0034605cellular response to heat
GO:0046827positive regulation of protein export from nucleus
GO:0000077DNA damage checkpoint
GO:0007088regulation of mitotic nuclear division
GO:0007093mitotic cell cycle checkpoint
GO:0007095mitotic G2 DNA damage checkpoint
GO:0007280pole cell migration
GO:0007294germarium-derived oocyte fate determination
GO:0007411axon guidance
GO:0007444imaginal disc development
GO:0008103oocyte microtubule cytoskeleton polarization
GO:0008340determination of adult lifespan
GO:0009314response to radiation
GO:0009411response to UV
GO:0040008regulation of growth
GO:0045927positive regulation of growth
GO:0046579positive regulation of Ras protein signal transduction
GO:0048190wing disc dorsal/ventral pattern formation
GO:0070374positive regulation of ERK1 and ERK2 cascade
Vocabulary: cellular component
TermDefinition
GO:0042470melanosome
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005694chromosome
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005875microtubule associated complex
GO:0005886plasma membrane
GO:0045172germline ring canal
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR03681514-3-3_dom_sf
IPR00030814-3-3
IPR02341014-3-3_domain
IPR02340914-3-3_CS
Vocabulary: molecular function
TermDefinition
GO:0019904protein domain specific binding
GO:0005515protein binding
GO:0046982protein heterodimerization activity
GO:0050815phosphoserine binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 191..211
NoneNo IPR availableCOILSCoilCoilcoord: 237..252
NoneNo IPR availableCOILSCoilCoilcoord: 10..30
NoneNo IPR availablePANTHERPTHR18860:SF7014-3-3-LIKE PROTEIN GF14 IOTAcoord: 3..242
IPR00030814-3-3 proteinPRINTSPR003051433ZETAcoord: 115..137
score: 68.57
coord: 84..108
score: 41.3
coord: 177..203
score: 78.99
coord: 204..233
score: 91.52
coord: 150..176
score: 72.79
coord: 36..65
score: 86.05
IPR00030814-3-3 proteinPIRSFPIRSF00086814-3-3coord: 1..243
e-value: 2.5E-114
score: 378.2
IPR00030814-3-3 proteinPANTHERPTHR1886014-3-3 PROTEINcoord: 3..242
IPR02341014-3-3 domainSMARTSM001011433_4coord: 4..244
e-value: 1.3E-151
score: 519.7
IPR02341014-3-3 domainPFAMPF0024414-3-3coord: 10..231
e-value: 3.0E-102
score: 340.8
IPR03681514-3-3 domain superfamilyGENE3DG3DSA:1.20.190.20coord: 1..246
e-value: 3.4E-118
score: 395.5
IPR03681514-3-3 domain superfamilySUPERFAMILYSSF4844514-3-3 proteincoord: 1..233
IPR02340914-3-3 protein, conserved sitePROSITEPS007961433_1coord: 42..52
IPR02340914-3-3 protein, conserved sitePROSITEPS007971433_2coord: 213..232