Cylindromatosis (turban tumor syndrome), b

Overview
NameCylindromatosis (turban tumor syndrome), b
Smed IDSMED30035733
Length (bp)5967
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cylindromatosis (turban tumor syndrome), b (SMED30035733) t-SNE clustered cells

Violin plots show distribution of expression levels for Cylindromatosis (turban tumor syndrome), b (SMED30035733) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cylindromatosis (turban tumor syndrome), b (SMED30035733) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cylindromatosis (turban tumor syndrome), b (SMED30035733) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035733

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30035733SMESG000056845.1 SMESG000044775.1 SMESG000007087.1 SMESG000007085.1 Contig5578newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035733SMESG000056845.1 SMESG000044775.1 SMESG000007087.1 SMESG000007085.1 Contig5578uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035733SMESG000056847.1 SMESG000056838.1 SMESG000044770.1 SMESG000007140.1 Contig70newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035733SMESG000056847.1 SMESG000056838.1 SMESG000044770.1 SMESG000007140.1 Contig70uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035733SMESG000060632.1 Contig5578newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035733SMESG000060632.1 Contig5578uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035733SMESG000059757.1 Contig70newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035733SMESG000059757.1 Contig70uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30035733SMESG000056845.1 SMESG000044775.1 SMESG000007087.1 SMESG000007085.1 SMESG000056847.1 SMESG000056838.1 SMESG000044770.1 SMESG000007140.1 SMESG000044776.1 SMESG000044783.1 SMESG000038659.1 SMESG000030652.1 SMESG000025467.1 SMESG000013956.1 SMESG000056843.1 SMESG000044762.1 dd_Smed_v6_1137_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30035733SMESG000056845.1 SMESG000044775.1 SMESG000007087.1 SMESG000007085.1 SMESG000056847.1 SMESG000056838.1 SMESG000044770.1 SMESG000007140.1 SMESG000044776.1 SMESG000044783.1 SMESG000038659.1 SMESG000030652.1 SMESG000025467.1 SMESG000013956.1 SMESG000056843.1 SMESG000044762.1 dd_Smed_v6_1137_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30035733SMESG000056845.1 SMESG000044775.1 SMESG000007087.1 SMESG000007085.1 SMESG000056847.1 SMESG000056838.1 SMESG000044770.1 SMESG000007140.1 SMESG000044776.1 SMESG000044783.1 SMESG000038659.1 SMESG000030652.1 SMESG000025467.1 SMESG000013956.1 SMESG000056843.1 SMESG000044762.1 dd_Smed_v6_1137_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30035733SMESG000056845.1 SMESG000044775.1 SMESG000007087.1 SMESG000007085.1 SMESG000056847.1 SMESG000056838.1 SMESG000044770.1 SMESG000007140.1 SMESG000044776.1 SMESG000044783.1 SMESG000038659.1 SMESG000030652.1 SMESG000025467.1 SMESG000013956.1 SMESG000056843.1 SMESG000044762.1 dd_Smed_v6_1137_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035733SMESG000056845.1 SMESG000044775.1 SMESG000007087.1 SMESG000007085.1 SMESG000056847.1 SMESG000056838.1 SMESG000044770.1 SMESG000007140.1 SMESG000044776.1 SMESG000044783.1 SMESG000038659.1 SMESG000030652.1 SMESG000025467.1 SMESG000013956.1 SMESG000056843.1 SMESG000044762.1 dd_Smed_v6_1137_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
GABAergic neuronSMED30035733SMESG000056845.1 SMESG000044775.1 SMESG000007087.1 SMESG000007085.1 SMESG000056847.1 SMESG000056838.1 SMESG000044770.1 SMESG000007140.1 SMESG000044776.1 SMESG000044783.1 SMESG000038659.1 SMESG000030652.1 SMESG000025467.1 SMESG000013956.1 SMESG000056843.1 SMESG000044762.1 dd_Smed_v6_1137_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30035733SMESG000056845.1 SMESG000044775.1 SMESG000007087.1 SMESG000007085.1 SMESG000056847.1 SMESG000056838.1 SMESG000044770.1 SMESG000007140.1 SMESG000044776.1 SMESG000044783.1 SMESG000038659.1 SMESG000030652.1 SMESG000025467.1 SMESG000013956.1 SMESG000056843.1 SMESG000044762.1 dd_Smed_v6_1137_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035733SMESG000044783.1 SMESG000044771.1 dd_Smed_v4_8361_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Human
Match: CYLD (CYLD lysine 63 deubiquitinase [Source:HGNC Symbol;Acc:HGNC:2584])

HSP 1 Score: 163.31 bits (412), Expect = 8.840e-40
Identity = 136/495 (27.47%), Postives = 222/495 (44.85%), Query Frame = 2
Query: 4490 LFGTVKWTGVDEN-DCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENVKKSETSDQIVCGLNSSVIA----------------GDNKGIQGNANSCYFDSALFALFVKSDVLD-YLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXX-XXXXXXXYAIPRVSRCECVSKFLSLSEDQMKQYIGSNDLKELKMILEDSCVYIYHNKSKTCY 5860
             +G ++W G     +    GLEL+D     TDGTF G R FTC     +   L +   D+RF +  + P + +    +     G  S V+                 G  KGIQG+ NSCY DS LF LF  S VLD  L+ P   E+       E +E++   IV PLR  G+V      ++R +++K  A      +++   E ++ L   +   E LL I        +  F Q+F+  ++KV   T +++L+ S + +++ F E P+CLI+Q PR  K    +K   P  E+ I+ +  +  + C IC G A ++C+ C  D+ DI+   +      C+     HP          +  K LPD       +    MEL A++CIE  H+V+FVK                    K++  W FFDSM+      + + IP+V+ C  V ++L +S + +            + +L D+ + +Y + + + Y
Sbjct:  484 FYGVIRWIGQPPGLNEVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCRPDSRFAS--LQPVSNQIERCNSLAFGGYLSEVVEENTPPKMEKEGLEIMIGKKKGIQGHYNSCYLDSTLFCLFAFSSVLDTVLLRP--KEKNDVEYYSETQELLRTEIVNPLRIYGYVCATKIMKLRKILEKVEAASGFTSEEKDPEEFLNILFHHILRVEPLLKIRSAGQKVQDCYFYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECY-DDPDISAGKIKQFCKTCNTQVHLHPKRLNHKYNPVSLPKDLPDWDWRHGCIPCQNMELFAVLCIETSHYVAFVKYG------------------KDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLY 955          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Human
Match: CYLD (CYLD lysine 63 deubiquitinase [Source:HGNC Symbol;Acc:HGNC:2584])

HSP 1 Score: 163.31 bits (412), Expect = 8.840e-40
Identity = 136/495 (27.47%), Postives = 222/495 (44.85%), Query Frame = 2
Query: 4490 LFGTVKWTGVDEN-DCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENVKKSETSDQIVCGLNSSVIA----------------GDNKGIQGNANSCYFDSALFALFVKSDVLD-YLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXX-XXXXXXXYAIPRVSRCECVSKFLSLSEDQMKQYIGSNDLKELKMILEDSCVYIYHNKSKTCY 5860
             +G ++W G     +    GLEL+D     TDGTF G R FTC     +   L +   D+RF +  + P + +    +     G  S V+                 G  KGIQG+ NSCY DS LF LF  S VLD  L+ P   E+       E +E++   IV PLR  G+V      ++R +++K  A      +++   E ++ L   +   E LL I        +  F Q+F+  ++KV   T +++L+ S + +++ F E P+CLI+Q PR  K    +K   P  E+ I+ +  +  + C IC G A ++C+ C  D+ DI+   +      C+     HP          +  K LPD       +    MEL A++CIE  H+V+FVK                    K++  W FFDSM+      + + IP+V+ C  V ++L +S + +            + +L D+ + +Y + + + Y
Sbjct:  484 FYGVIRWIGQPPGLNEVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCRPDSRFAS--LQPVSNQIERCNSLAFGGYLSEVVEENTPPKMEKEGLEIMIGKKKGIQGHYNSCYLDSTLFCLFAFSSVLDTVLLRP--KEKNDVEYYSETQELLRTEIVNPLRIYGYVCATKIMKLRKILEKVEAASGFTSEEKDPEEFLNILFHHILRVEPLLKIRSAGQKVQDCYFYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECY-DDPDISAGKIKQFCKTCNTQVHLHPKRLNHKYNPVSLPKDLPDWDWRHGCIPCQNMELFAVLCIETSHYVAFVKYG------------------KDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLY 955          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Human
Match: CYLD (CYLD lysine 63 deubiquitinase [Source:HGNC Symbol;Acc:HGNC:2584])

HSP 1 Score: 163.31 bits (412), Expect = 9.541e-40
Identity = 136/495 (27.47%), Postives = 222/495 (44.85%), Query Frame = 2
Query: 4490 LFGTVKWTGVDEN-DCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENVKKSETSDQIVCGLNSSVIA----------------GDNKGIQGNANSCYFDSALFALFVKSDVLD-YLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXX-XXXXXXXYAIPRVSRCECVSKFLSLSEDQMKQYIGSNDLKELKMILEDSCVYIYHNKSKTCY 5860
             +G ++W G     +    GLEL+D     TDGTF G R FTC     +   L +   D+RF +  + P + +    +     G  S V+                 G  KGIQG+ NSCY DS LF LF  S VLD  L+ P   E+       E +E++   IV PLR  G+V      ++R +++K  A      +++   E ++ L   +   E LL I        +  F Q+F+  ++KV   T +++L+ S + +++ F E P+CLI+Q PR  K    +K   P  E+ I+ +  +  + C IC G A ++C+ C  D+ DI+   +      C+     HP          +  K LPD       +    MEL A++CIE  H+V+FVK                    K++  W FFDSM+      + + IP+V+ C  V ++L +S + +            + +L D+ + +Y + + + Y
Sbjct:  481 FYGVIRWIGQPPGLNEVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCRPDSRFAS--LQPVSNQIERCNSLAFGGYLSEVVEENTPPKMEKEGLEIMIGKKKGIQGHYNSCYLDSTLFCLFAFSSVLDTVLLRP--KEKNDVEYYSETQELLRTEIVNPLRIYGYVCATKIMKLRKILEKVEAASGFTSEEKDPEEFLNILFHHILRVEPLLKIRSAGQKVQDCYFYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECY-DDPDISAGKIKQFCKTCNTQVHLHPKRLNHKYNPVSLPKDLPDWDWRHGCIPCQNMELFAVLCIETSHYVAFVKYG------------------KDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLY 952          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Human
Match: CYLD (CYLD lysine 63 deubiquitinase [Source:HGNC Symbol;Acc:HGNC:2584])

HSP 1 Score: 163.31 bits (412), Expect = 9.541e-40
Identity = 136/495 (27.47%), Postives = 222/495 (44.85%), Query Frame = 2
Query: 4490 LFGTVKWTGVDEN-DCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENVKKSETSDQIVCGLNSSVIA----------------GDNKGIQGNANSCYFDSALFALFVKSDVLD-YLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXX-XXXXXXXYAIPRVSRCECVSKFLSLSEDQMKQYIGSNDLKELKMILEDSCVYIYHNKSKTCY 5860
             +G ++W G     +    GLEL+D     TDGTF G R FTC     +   L +   D+RF +  + P + +    +     G  S V+                 G  KGIQG+ NSCY DS LF LF  S VLD  L+ P   E+       E +E++   IV PLR  G+V      ++R +++K  A      +++   E ++ L   +   E LL I        +  F Q+F+  ++KV   T +++L+ S + +++ F E P+CLI+Q PR  K    +K   P  E+ I+ +  +  + C IC G A ++C+ C  D+ DI+   +      C+     HP          +  K LPD       +    MEL A++CIE  H+V+FVK                    K++  W FFDSM+      + + IP+V+ C  V ++L +S + +            + +L D+ + +Y + + + Y
Sbjct:  481 FYGVIRWIGQPPGLNEVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCRPDSRFAS--LQPVSNQIERCNSLAFGGYLSEVVEENTPPKMEKEGLEIMIGKKKGIQGHYNSCYLDSTLFCLFAFSSVLDTVLLRP--KEKNDVEYYSETQELLRTEIVNPLRIYGYVCATKIMKLRKILEKVEAASGFTSEEKDPEEFLNILFHHILRVEPLLKIRSAGQKVQDCYFYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECY-DDPDISAGKIKQFCKTCNTQVHLHPKRLNHKYNPVSLPKDLPDWDWRHGCIPCQNMELFAVLCIETSHYVAFVKYG------------------KDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLY 952          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Human
Match: CYLD (CYLD lysine 63 deubiquitinase [Source:HGNC Symbol;Acc:HGNC:2584])

HSP 1 Score: 163.31 bits (412), Expect = 9.541e-40
Identity = 136/495 (27.47%), Postives = 222/495 (44.85%), Query Frame = 2
Query: 4490 LFGTVKWTGVDEN-DCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENVKKSETSDQIVCGLNSSVIA----------------GDNKGIQGNANSCYFDSALFALFVKSDVLD-YLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXX-XXXXXXXYAIPRVSRCECVSKFLSLSEDQMKQYIGSNDLKELKMILEDSCVYIYHNKSKTCY 5860
             +G ++W G     +    GLEL+D     TDGTF G R FTC     +   L +   D+RF +  + P + +    +     G  S V+                 G  KGIQG+ NSCY DS LF LF  S VLD  L+ P   E+       E +E++   IV PLR  G+V      ++R +++K  A      +++   E ++ L   +   E LL I        +  F Q+F+  ++KV   T +++L+ S + +++ F E P+CLI+Q PR  K    +K   P  E+ I+ +  +  + C IC G A ++C+ C  D+ DI+   +      C+     HP          +  K LPD       +    MEL A++CIE  H+V+FVK                    K++  W FFDSM+      + + IP+V+ C  V ++L +S + +            + +L D+ + +Y + + + Y
Sbjct:  481 FYGVIRWIGQPPGLNEVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCRPDSRFAS--LQPVSNQIERCNSLAFGGYLSEVVEENTPPKMEKEGLEIMIGKKKGIQGHYNSCYLDSTLFCLFAFSSVLDTVLLRP--KEKNDVEYYSETQELLRTEIVNPLRIYGYVCATKIMKLRKILEKVEAASGFTSEEKDPEEFLNILFHHILRVEPLLKIRSAGQKVQDCYFYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECY-DDPDISAGKIKQFCKTCNTQVHLHPKRLNHKYNPVSLPKDLPDWDWRHGCIPCQNMELFAVLCIETSHYVAFVKYG------------------KDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLY 952          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Celegans
Match: cyld-1 (CYLinDromatosis (Human disease gene) homolog [Source:UniProtKB/TrEMBL;Acc:H2L265])

HSP 1 Score: 131.724 bits (330), Expect = 1.832e-30
Identity = 124/463 (26.78%), Postives = 199/463 (42.98%), Query Frame = 2
Query: 4496 GTVKWTGV---DENDCYFFG--LELDDRINIGTDGTFGGQRLFTCQNGHGVLAPL----NNVASDTRFTAKVVSPENVKKSETSDQIV-----------------CGLNSSV--IAGDNKGIQGNANSCYFDSALFALFVKSDVLDYLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENV-STLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTC-LGDELDITCTFLCSQHKCQHPACTKLLPDTVKSKSKVF--------------MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXX-XXXXXXXYAIPRVSRCECVSKFLSL 5749
            G V+W G    DE D       ++LD+ +      +             GVL P+    +N +  +   A VV       S+T + I                  CG+   +  + G  KGIQG  NSCY D+ L+A+FV++   D+L+   I   E     ++F++I+A  IV+PLRK  +V   H  ++R ++ +       +  +E D E +   + SK+   E  + +I  N  K +S ++   +  D      TS+ +L+  M    + F + P  LIMQ PR  +    +   LPL  I+I+   +  +  CS C   +E  C TC L   +  +    C   KC H   T LLP+    KS+                M L A++CIE  H+V++V    R ++ Q                W FFDSM+  + +S  + +P V  C  +S +LSL
Sbjct:  336 GVVRWLGEEIDDEGDRIVRSAIVQLDEDVPTAWRRSHDASSYTGSPVVGGVLVPIQSLKHNHSGSSSNGASVVQTSTYPTSQTYNNISRRTEDFGSMDSGVEKQKCGIAKDMQQLVGRQKGIQGYCNSCYLDATLYAMFVQTTCFDFLLEKSIKGSET---AQQFQKILAHEIVFPLRKVHYVRADHVMKLRKLLAELMPHVTGLTNEEKDPEEILGFIFSKVFHAEPFIKLIGQNHAK-DSQYLVPIVVDDWLGGAATSQHLLERHMRSAQVTFAKAPPVLIMQLPRYGQ-QKVFDKILPLETIDITPFVAGAVPACSKCQACSEVYCPTCFLTRRVFYSEVIFC--RKCFH--HTHLLPEIEDHKSRDLYPPGKPQKKPHSHKMVLSAVLCIETSHYVAYV----RTSSNQ----------------WVFFDSMADREGLSDGFNVPVVRECGNMSDWLSL 769          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Celegans
Match: cyld-1 (CYLinDromatosis (Human disease gene) homolog [Source:UniProtKB/TrEMBL;Acc:H2L265])

HSP 1 Score: 131.339 bits (329), Expect = 2.207e-30
Identity = 124/463 (26.78%), Postives = 198/463 (42.76%), Query Frame = 2
Query: 4496 GTVKWTGV---DENDCYFFG--LELDDRINIGTDGTFGGQRLFTCQNGHGVLAPL----NNVASDTRFTAKVVSPENVKKSETSDQIV-----------------CGLNSSV--IAGDNKGIQGNANSCYFDSALFALFVKSDVLDYLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENV-STLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTC-LGDELDITCTFLCSQHKCQHPACTKLLPDTVKSKSKVF--------------MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXXXXXX-XXXYAIPRVSRCECVSKFLSL 5749
            G V+W G    DE D       ++LD+ +      +             GVL P+    +N +  +   A VV       S+T + I                  CG+   +  + G  KGIQG  NSCY D+ L+A+FV++   D+L+   I   E     ++F++I+A  IV+PLRK  +V   H  ++R ++ +       +  +E D E +   + SK+   E  + +I  N  K +S ++   +  D      TS+ +L+  M    + F + P  LIMQ PR  +    +   LPL  I+I+   +  +  CS C   +E  C TC L   +  +    C   KC H   T LLP+    KS+                M L A++CIE  H+V++V    R ++ Q                W FFDSM+ +   S  + +P V  C  +S +LSL
Sbjct:  394 GVVRWLGEEIDDEGDRIVRSAIVQLDEDVPTAWRRSHDASSYTGSPVVGGVLVPIQSLKHNHSGSSSNGASVVQTSTYPTSQTYNNISRRTEDFGSMDSGVEKQKCGIAKDMQQLVGRQKGIQGYCNSCYLDATLYAMFVQTTCFDFLLEKSIKGSET---AQQFQKILAHEIVFPLRKVHYVRADHVMKLRKLLAELMPHVTGLTNEEKDPEEILGFIFSKVFHAEPFIKLIGQNHAK-DSQYLVPIVVDDWLGGAATSQHLLERHMRSAQVTFAKAPPVLIMQLPRYGQ-QKVFDKILPLETIDITPFVAGAVPACSKCQACSEVYCPTCFLTRRVFYSEVIFC--RKCFH--HTHLLPEIEDHKSRDLYPPGKPQKKPHSHKMVLSAVLCIETSHYVAYV----RTSSNQ----------------WVFFDSMADREGLSDGFNVPVVRECGNMSDWLSL 827          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Celegans
Match: cyld-1 (CYLinDromatosis (Human disease gene) homolog [Source:UniProtKB/TrEMBL;Acc:H2L265])

HSP 1 Score: 131.339 bits (329), Expect = 3.705e-30
Identity = 124/463 (26.78%), Postives = 198/463 (42.76%), Query Frame = 2
Query: 4496 GTVKWTGV---DENDCYFFG--LELDDRINIGTDGTFGGQRLFTCQNGHGVLAPL----NNVASDTRFTAKVVSPENVKKSETSDQIV-----------------CGLNSSV--IAGDNKGIQGNANSCYFDSALFALFVKSDVLDYLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENV-STLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTC-LGDELDITCTFLCSQHKCQHPACTKLLPDTVKSKSKVF--------------MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXXXXXX-XXXYAIPRVSRCECVSKFLSL 5749
            G V+W G    DE D       ++LD+ +      +             GVL P+    +N +  +   A VV       S+T + I                  CG+   +  + G  KGIQG  NSCY D+ L+A+FV++   D+L+   I   E     ++F++I+A  IV+PLRK  +V   H  ++R ++ +       +  +E D E +   + SK+   E  + +I  N  K +S ++   +  D      TS+ +L+  M    + F + P  LIMQ PR  +    +   LPL  I+I+   +  +  CS C   +E  C TC L   +  +    C   KC H   T LLP+    KS+                M L A++CIE  H+V++V    R ++ Q                W FFDSM+ +   S  + +P V  C  +S +LSL
Sbjct:  646 GVVRWLGEEIDDEGDRIVRSAIVQLDEDVPTAWRRSHDASSYTGSPVVGGVLVPIQSLKHNHSGSSSNGASVVQTSTYPTSQTYNNISRRTEDFGSMDSGVEKQKCGIAKDMQQLVGRQKGIQGYCNSCYLDATLYAMFVQTTCFDFLLEKSIKGSET---AQQFQKILAHEIVFPLRKVHYVRADHVMKLRKLLAELMPHVTGLTNEEKDPEEILGFIFSKVFHAEPFIKLIGQNHAK-DSQYLVPIVVDDWLGGAATSQHLLERHMRSAQVTFAKAPPVLIMQLPRYGQ-QKVFDKILPLETIDITPFVAGAVPACSKCQACSEVYCPTCFLTRRVFYSEVIFC--RKCFH--HTHLLPEIEDHKSRDLYPPGKPQKKPHSHKMVLSAVLCIETSHYVAYV----RTSSNQ----------------WVFFDSMADREGLSDGFNVPVVRECGNMSDWLSL 1079          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Fly
Match: CYLD (gene:FBgn0032210 transcript:FBtr0080070)

HSP 1 Score: 183.341 bits (464), Expect = 1.291e-47
Identity = 137/494 (27.73%), Postives = 225/494 (45.55%), Query Frame = 2
Query: 4301 GTFWRRQ------IVNSRGKRVIATSVNHVYKYEPYVIKTIPEEIQIFK-------------EIVINSAVKYYFLTATGY-QDLFGTVKWTGVDEND--CYFFGLELDDRIN----IGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRF-------TAKVVSPENVKKSETSD-----------QIVCGLNSSVIAGDNKGIQGNANSCYFDSALFALFVKSDVLDYLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGD---ELDITCTFLCSQHKCQHPACTKLLPDTVKSKSKV----------------------FMELQAIICIEKCHFVSFVK 5575
            GT W ++      I+N++ K   + SV+ + K    ++K  PEE   F              E+ I S V+   ++  G  +DL+G V+W G+          G+E++D  N    + +DG   G RLFTC +G  +  P N   +D RF       +A  VS  + KK   +D           QI      + I G  KGIQG+ NSCY D+ LF++F  + V D ++      Q+    + E ++++   IV PLRKN FV      ++R ++ +  +      +++   E +++LLS++   E  L +        +S F QLF+  D+K+   + +++ + S   +DI   E+P+C I+Q PR  K    Y   LP   ++++ I  N  + CS+C   AE++C+ C G       + CT  C       P C K     +K  + V                      +MEL A++CIE  H+V+FVK
Sbjct:   78 GTNWPKRAGPAAMILNNKSKTDPSNSVDLILKPASPILKIEPEEPLRFTIADYQPLIEIPGTELAIGSLVE---VSNPGVCEDLYGVVRWIGIPPGPQKNVLVGIEVEDESNLKNVVASDGRHNGVRLFTCHDGRAIFVPANRCTADRRFADVDNSISANRVSSNHAKKFGVADCPAIYGSIPPLQIHNSDELASICGKFKGIQGHHNSCYLDATLFSMFTFTSVFDSILYRRPGPQDIRNYS-EVQKVLRDEIVNPLRKNVFVRSDRVMKLRELLDQLSSVSGLTCEEKDPEEFLNSLLSQIMRVEPFLKL----SSGQDSYFYQLFVEKDEKLTLPSVQQLFEQSFHSSDIKLKEVPSCFIIQMPRFGKNYKMYPRILPSQVLDVTDIIENSPRQCSLCGKLAEYECRDCFGSLQAGSGLECTAFC-------PKCLKTFHSHIKRTNHVSKKIYSPKEFKIMAEHMVVPRLYMELFAVVCIETSHYVAFVK 556          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Fly
Match: CYLD (gene:FBgn0032210 transcript:FBtr0080071)

HSP 1 Score: 183.341 bits (464), Expect = 1.291e-47
Identity = 137/494 (27.73%), Postives = 225/494 (45.55%), Query Frame = 2
Query: 4301 GTFWRRQ------IVNSRGKRVIATSVNHVYKYEPYVIKTIPEEIQIFK-------------EIVINSAVKYYFLTATGY-QDLFGTVKWTGVDEND--CYFFGLELDDRIN----IGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRF-------TAKVVSPENVKKSETSD-----------QIVCGLNSSVIAGDNKGIQGNANSCYFDSALFALFVKSDVLDYLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGD---ELDITCTFLCSQHKCQHPACTKLLPDTVKSKSKV----------------------FMELQAIICIEKCHFVSFVK 5575
            GT W ++      I+N++ K   + SV+ + K    ++K  PEE   F              E+ I S V+   ++  G  +DL+G V+W G+          G+E++D  N    + +DG   G RLFTC +G  +  P N   +D RF       +A  VS  + KK   +D           QI      + I G  KGIQG+ NSCY D+ LF++F  + V D ++      Q+    + E ++++   IV PLRKN FV      ++R ++ +  +      +++   E +++LLS++   E  L +        +S F QLF+  D+K+   + +++ + S   +DI   E+P+C I+Q PR  K    Y   LP   ++++ I  N  + CS+C   AE++C+ C G       + CT  C       P C K     +K  + V                      +MEL A++CIE  H+V+FVK
Sbjct:   78 GTNWPKRAGPAAMILNNKSKTDPSNSVDLILKPASPILKIEPEEPLRFTIADYQPLIEIPGTELAIGSLVE---VSNPGVCEDLYGVVRWIGIPPGPQKNVLVGIEVEDESNLKNVVASDGRHNGVRLFTCHDGRAIFVPANRCTADRRFADVDNSISANRVSSNHAKKFGVADCPAIYGSIPPLQIHNSDELASICGKFKGIQGHHNSCYLDATLFSMFTFTSVFDSILYRRPGPQDIRNYS-EVQKVLRDEIVNPLRKNVFVRSDRVMKLRELLDQLSSVSGLTCEEKDPEEFLNSLLSQIMRVEPFLKL----SSGQDSYFYQLFVEKDEKLTLPSVQQLFEQSFHSSDIKLKEVPSCFIIQMPRFGKNYKMYPRILPSQVLDVTDIIENSPRQCSLCGKLAEYECRDCFGSLQAGSGLECTAFC-------PKCLKTFHSHIKRTNHVSKKIYSPKEFKIMAEHMVVPRLYMELFAVVCIETSHYVAFVK 556          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Fly
Match: CYLD (gene:FBgn0032210 transcript:FBtr0080072)

HSP 1 Score: 176.407 bits (446), Expect = 6.432e-46
Identity = 118/413 (28.57%), Postives = 192/413 (46.49%), Query Frame = 2
Query: 4484 QDLFGTVKWTGVDEND--CYFFGLELDDRIN----IGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRF-------TAKVVSPENVKKSETSD-----------QIVCGLNSSVIAGDNKGIQGNANSCYFDSALFALFVKSDVLDYLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGD---ELDITCTFLCSQHKCQHPACTKLLPDTVKSKSKV----------------------FMELQAIICIEKCHFVSFVK 5575
            +DL+G V+W G+          G+E++D  N    + +DG   G RLFTC +G  +  P N   +D RF       +A  VS  + KK   +D           QI      + I G  KGIQG+ NSCY D+ LF++F  + V D ++      Q+    + E ++++   IV PLRKN FV      ++R ++ +  +      +++   E +++LLS++   E  L +        +S F QLF+  D+K+   + +++ + S   +DI   E+P+C I+Q PR  K    Y   LP   ++++ I  N  + CS+C   AE++C+ C G       + CT  C       P C K     +K  + V                      +MEL A++CIE  H+V+FVK
Sbjct:   68 EDLYGVVRWIGIPPGPQKNVLVGIEVEDESNLKNVVASDGRHNGVRLFTCHDGRAIFVPANRCTADRRFADVDNSISANRVSSNHAKKFGVADCPAIYGSIPPLQIHNSDELASICGKFKGIQGHHNSCYLDATLFSMFTFTSVFDSILYRRPGPQDIRNYS-EVQKVLRDEIVNPLRKNVFVRSDRVMKLRELLDQLSSVSGLTCEEKDPEEFLNSLLSQIMRVEPFLKL----SSGQDSYFYQLFVEKDEKLTLPSVQQLFEQSFHSSDIKLKEVPSCFIIQMPRFGKNYKMYPRILPSQVLDVTDIIENSPRQCSLCGKLAEYECRDCFGSLQAGSGLECTAFC-------PKCLKTFHSHIKRTNHVSKKIYSPKEFKIMAEHMVVPRLYMELFAVVCIETSHYVAFVK 468          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Zebrafish
Match: cylda (cylindromatosis (turban tumor syndrome), a [Source:ZFIN;Acc:ZDB-GENE-061108-2])

HSP 1 Score: 169.088 bits (427), Expect = 7.533e-42
Identity = 135/492 (27.44%), Postives = 225/492 (45.73%), Query Frame = 2
Query: 4490 LFGTVKWTGVDEN-DCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENVKK--------------SETSDQIVCGLNSSVIAGDNKGIQGNANSCYFDSALFALFVKSDVLDYLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTV---KSKSKVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXXXXXXXX-XYAIPRVSRCECVSKFLSLSEDQMKQYIGSNDLKELKMILEDSCVYIYHNKSKTCY 5860
            L G ++W G+         GLEL++     TDGTF G R FTC     +   L     D+RF +   SP  +++              +E +          V+ G  KGIQG+ NSCY DS LF LF  S VLD ++    ++ + +   KE +E++   IV PLR +G+V      ++R +++K  A      +++   E ++ L   +   + LL +        +  F Q+F+    KV   TS+++L+ S + +D+ F E P+CLI+Q PR  K    +    P  E++I+ +  +  + C IC G A ++C+ C  D  DIT   +      C+     HP          +  K L ++V    S     MEL A++CIE  H+V+FVK                      +  W FFDSM+ +      + IP+VSRC  V ++L ++ +++      N     + +L D+ + +Y + + + Y
Sbjct:  440 LCGVIRWVGLPPGLQESLAGLELEEECVGCTDGTFKGIRYFTCPPKKALFVKLKCCRPDSRFPSLHHSPNPIERCNSIAFGGYLSEVVNENTPPRTENDGLEVMVGKKKGIQGHYNSCYLDSTLFCLFSFSSVLDTVLLRPRSKTDVE-YYKETQELLRTEIVNPLRIHGYVCATKIMKLRRILEKVEAASGFTSEEKDPEEFLNILFHHILRVDPLLRLRSAGQKVQDCYFYQIFMDKKDKVMVPTSQQLLEWSFINSDLKFAEAPSCLIIQMPRFGKDFKMFNKIFPSLELDITDLLDDTPRECRICGGLALYECRECYED-YDITPGKIKQFCEKCNTQVHLHPRRKIHRYVKLSVPKELHESVWRQGSYPHQQMELFAVLCIETSHYVAFVKYG------------------SADSAWLFFDSMADRDGGQNGFNIPQVSRCPEVGEYLKMTPEELHALDPKNIQGYARRLLCDAYMCMYQSPTMSLY 911          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Zebrafish
Match: cylda (cylindromatosis (turban tumor syndrome), a [Source:ZFIN;Acc:ZDB-GENE-061108-2])

HSP 1 Score: 169.088 bits (427), Expect = 9.359e-42
Identity = 135/492 (27.44%), Postives = 225/492 (45.73%), Query Frame = 2
Query: 4490 LFGTVKWTGVDEN-DCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENVKK--------------SETSDQIVCGLNSSVIAGDNKGIQGNANSCYFDSALFALFVKSDVLDYLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTV---KSKSKVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXXXXXXXX-XYAIPRVSRCECVSKFLSLSEDQMKQYIGSNDLKELKMILEDSCVYIYHNKSKTCY 5860
            L G ++W G+         GLEL++     TDGTF G R FTC     +   L     D+RF +   SP  +++              +E +          V+ G  KGIQG+ NSCY DS LF LF  S VLD ++    ++ + +   KE +E++   IV PLR +G+V      ++R +++K  A      +++   E ++ L   +   + LL +        +  F Q+F+    KV   TS+++L+ S + +D+ F E P+CLI+Q PR  K    +    P  E++I+ +  +  + C IC G A ++C+ C  D  DIT   +      C+     HP          +  K L ++V    S     MEL A++CIE  H+V+FVK                      +  W FFDSM+ +      + IP+VSRC  V ++L ++ +++      N     + +L D+ + +Y + + + Y
Sbjct:  479 LCGVIRWVGLPPGLQESLAGLELEEECVGCTDGTFKGIRYFTCPPKKALFVKLKCCRPDSRFPSLHHSPNPIERCNSIAFGGYLSEVVNENTPPRTENDGLEVMVGKKKGIQGHYNSCYLDSTLFCLFSFSSVLDTVLLRPRSKTDVE-YYKETQELLRTEIVNPLRIHGYVCATKIMKLRRILEKVEAASGFTSEEKDPEEFLNILFHHILRVDPLLRLRSAGQKVQDCYFYQIFMDKKDKVMVPTSQQLLEWSFINSDLKFAEAPSCLIIQMPRFGKDFKMFNKIFPSLELDITDLLDDTPRECRICGGLALYECRECYED-YDITPGKIKQFCEKCNTQVHLHPRRKIHRYVKLSVPKELHESVWRQGSYPHQQMELFAVLCIETSHYVAFVKYG------------------SADSAWLFFDSMADRDGGQNGFNIPQVSRCPEVGEYLKMTPEELHALDPKNIQGYARRLLCDAYMCMYQSPTMSLY 950          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Zebrafish
Match: cylda (cylindromatosis (turban tumor syndrome), a [Source:ZFIN;Acc:ZDB-GENE-061108-2])

HSP 1 Score: 169.088 bits (427), Expect = 9.359e-42
Identity = 135/492 (27.44%), Postives = 225/492 (45.73%), Query Frame = 2
Query: 4490 LFGTVKWTGVDEN-DCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENVKK--------------SETSDQIVCGLNSSVIAGDNKGIQGNANSCYFDSALFALFVKSDVLDYLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTV---KSKSKVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXXXXXXXX-XYAIPRVSRCECVSKFLSLSEDQMKQYIGSNDLKELKMILEDSCVYIYHNKSKTCY 5860
            L G ++W G+         GLEL++     TDGTF G R FTC     +   L     D+RF +   SP  +++              +E +          V+ G  KGIQG+ NSCY DS LF LF  S VLD ++    ++ + +   KE +E++   IV PLR +G+V      ++R +++K  A      +++   E ++ L   +   + LL +        +  F Q+F+    KV   TS+++L+ S + +D+ F E P+CLI+Q PR  K    +    P  E++I+ +  +  + C IC G A ++C+ C  D  DIT   +      C+     HP          +  K L ++V    S     MEL A++CIE  H+V+FVK                      +  W FFDSM+ +      + IP+VSRC  V ++L ++ +++      N     + +L D+ + +Y + + + Y
Sbjct:  479 LCGVIRWVGLPPGLQESLAGLELEEECVGCTDGTFKGIRYFTCPPKKALFVKLKCCRPDSRFPSLHHSPNPIERCNSIAFGGYLSEVVNENTPPRTENDGLEVMVGKKKGIQGHYNSCYLDSTLFCLFSFSSVLDTVLLRPRSKTDVE-YYKETQELLRTEIVNPLRIHGYVCATKIMKLRRILEKVEAASGFTSEEKDPEEFLNILFHHILRVDPLLRLRSAGQKVQDCYFYQIFMDKKDKVMVPTSQQLLEWSFINSDLKFAEAPSCLIIQMPRFGKDFKMFNKIFPSLELDITDLLDDTPRECRICGGLALYECRECYED-YDITPGKIKQFCEKCNTQVHLHPRRKIHRYVKLSVPKELHESVWRQGSYPHQQMELFAVLCIETSHYVAFVKYG------------------SADSAWLFFDSMADRDGGQNGFNIPQVSRCPEVGEYLKMTPEELHALDPKNIQGYARRLLCDAYMCMYQSPTMSLY 950          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Zebrafish
Match: cyldb (cylindromatosis (turban tumor syndrome), b [Source:ZFIN;Acc:ZDB-GENE-100208-1])

HSP 1 Score: 166.392 bits (420), Expect = 1.251e-41
Identity = 140/511 (27.40%), Postives = 230/511 (45.01%), Query Frame = 2
Query: 4397 KTIPEEIQIFKEIVINSAVKYYFLTATGYQDLFGTVKWTGVDEN--DCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRF------TAKVVSPENVKKSETSDQIVCGLNS----SVIAGDNKGIQGNANSCYFDSALFALFVKSDVLDYLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMEN-VSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGD---------ELDITCTFLCSQH--KCQHPACTKLLPDTVKSKSKV---FMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXXXX--XXXXXYAIPRVSRCECVSKFLSLSEDQMKQYIGSNDLKELKMILEDSCVYIYHN 5842
            K + E IQ      +        L+  G   ++G ++W GV E   +C+  GLELD      +DGT G +R FTC+    +  PL N   D+RF        K ++P +    E  D+ V  +      S + G  KGIQG+ NSCY D+ LF+LF  S   D + +     + AD   K    I+   IV  LR++GFV   +  + R   ++ G K      +E D E  ++ LL  +   E LL I         +   Q+ +  ++     + +++L++S V +++ F E+P+CLI+Q PR  K    +   +P  E++I+ +     + C +C   A+++C  CL D         +   TC      H  + +H      LPD     + V    M+L A++CI   H+VSFVK                     +  +W FFDSM+ +    +  Y+IP +  C  V  FLS SE+++     S   + ++ ++ DS + +Y  
Sbjct:  210 KDVSESIQALSHYSLEVGSMAEVLSLNGLT-VYGVIRWIGVPEGKKNCWA-GLELDTEATTCSDGTLGTKRYFTCEANKALFVPLTNCKPDSRFLLIPDEMLKPLNPPSATLVEDLDEDVPPVAEQDVLSHLVGRMKGIQGHFNSCYLDATLFSLFTSSVAFDRIFN-----RSADS-KKGISHILRRDIVNCLRRSGFVPAENVMKFR---EQLGCK--SFASEEKDPEEFITLLLQHVLHIEPLLKIRSQGEFPQEAYTHQIIVEKNQVAAVPSVQQLLEMSFVTSNLKFEEIPSCLIVQMPRFGKKFKMFPKIIPSTELDITDVLHCSPRECFLCGHLAKYECVQCLMDRKLQPGKIKQYCSTCNTQVHNHPTRQEHTPQKLTLPDCPAEDAPVQRHPMQLFAVLCINTSHYVSFVKYG------------------PDPRSWIFFDSMADRCGDDNKGYSIPVIRSCPEVGDFLSQSEEEISSADLSQCSEAVRRLMVDSYMCLYQT 689          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Zebrafish
Match: cyldb (cylindromatosis (turban tumor syndrome), b [Source:ZFIN;Acc:ZDB-GENE-100208-1])

HSP 1 Score: 154.066 bits (388), Expect = 5.651e-39
Identity = 120/420 (28.57%), Postives = 193/420 (45.95%), Query Frame = 2
Query: 4397 KTIPEEIQIFKEIVINSAVKYYFLTATGYQDLFGTVKWTGVDEN--DCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRF------TAKVVSPENVKKSETSDQIVCGLNS----SVIAGDNKGIQGNANSCYFDSALFALFVKSDVLDYLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMEN-VSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGD---------ELDITCTFLCSQH--KCQHPACTKLLPDTVKSKSKV---FMELQAIICIEKCHFVSFVK 5575
            K + E IQ      +        L+  G   ++G ++W GV E   +C+  GLELD      +DGT G +R FTC+    +  PL N   D+RF        K ++P +    E  D+ V  +      S + G  KGIQG+ NSCY D+ LF+LF  S   D + +     + AD   K    I+   IV  LR++GFV   +  + R   ++ G K      +E D E  ++ LL  +   E LL I         +   Q+ +  ++     + +++L++S V +++ F E+P+CLI+Q PR  K    +   +P  E++I+ +     + C +C   A+++C  CL D         +   TC      H  + +H      LPD     + V    M+L A++CI   H+VSFVK
Sbjct:   36 KDVSESIQALSHYSLEVGSMAEVLSLNGLT-VYGVIRWIGVPEGKKNCWA-GLELDTEATTCSDGTLGTKRYFTCEANKALFVPLTNCKPDSRFLLIPDEMLKPLNPPSATLVEDLDEDVPPVAEQDVLSHLVGRMKGIQGHFNSCYLDATLFSLFTSSVAFDRIFN-----RSADS-KKGISHILRRDIVNCLRRSGFVPAENVMKFR---EQLGCK--SFASEEKDPEEFITLLLQHVLHIEPLLKIRSQGEFPQEAYTHQIIVEKNQVAAVPSVQQLLEMSFVTSNLKFEEIPSCLIVQMPRFGKKFKMFPKIIPSTELDITDVLHCSPRECFLCGHLAKYECVQCLMDRKLQPGKIKQYCSTCNTQVHNHPTRQEHTPQKLTLPDCPAEDAPVQRHPMQLFAVLCINTSHYVSFVK 442          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Xenopus
Match: tril (TLR4 interactor with leucine-rich repeats [Source:Xenbase;Acc:XB-GENE-6050227])

HSP 1 Score: 158.303 bits (399), Expect = 2.296e-38
Identity = 134/498 (26.91%), Postives = 224/498 (44.98%), Query Frame = 2
Query: 4490 LFGTVKW----TGVDENDCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENVKKSETSDQIVCGLNSSVIAGDN----------------KGIQGNANSCYFDSALFALFVKSDVLD-YLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDIT-------CTFLCSQ---------HKCQHPACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXX-XXXXXXXYAIPRVSRCECVSKFLSLSEDQMKQYIGSNDLKELKMILEDSCVYIYHNKSKTCY 5860
             +G ++W     GV+E      GLEL+D     TDGTF G R FTC     +   L +   D+RF +  + P + +    +     G  S V+ G+                 KGIQG+ NSCY DS LF LF  S VLD  L+ P   E+       E + ++   IV PLR  G+V      ++R +++K  A      +++   E ++ L   +   + LL I        +  F Q+F+  ++ V   T +++L+ S + + + F E P+CLI+Q PR  K    +    P  ++ I+ +  +  + C IC G A ++C+ C  D+ DIT       C    +Q         HK    +  K LPD       +    M+L A++CIE  H+V+FVK                    +++ +W FFDSM+      + + IP+V+ C  V ++L +S +++      N     + +L D+ + +Y + + + Y
Sbjct:  421 FYGVIRWIGQPAGVNE---MLAGLELEDECAGCTDGTFKGTRYFTCAPKKALFVKLKSCRPDSRFAS--LQPVSNQIERCNSLAFGGYLSEVVEGNTPPRTEKEGLEVMIGKKKGIQGHYNSCYLDSTLFCLFSFSSVLDSVLLRP--KEKTDVEYYSETQALLRTEIVNPLRIYGYVCATKIMKLRKILEKVEAASGFTSEEKDPEEFLNILFHHILRVDPLLKIRSAGQKVQDCYFYQIFMDKNENVGVPTIQQLLEWSFINSSLKFAEAPSCLIVQMPRFGKDFKMFNKIFPSLDLNITDLLEDTPRQCRICGGLAMYECRECY-DDPDITAGKIKQFCKICNTQVHLHPKRQHHKFNPVSLPKELPDWDWRHGCIPYQKMDLFAVLCIETSHYVAFVKYG------------------RDDSSWVFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEELHALDSRNIQGCARRLLCDAYMCMYQSPTMSLY 892          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Xenopus
Match: tril (TLR4 interactor with leucine-rich repeats [Source:Xenbase;Acc:XB-GENE-6050227])

HSP 1 Score: 158.303 bits (399), Expect = 3.407e-38
Identity = 134/498 (26.91%), Postives = 224/498 (44.98%), Query Frame = 2
Query: 4490 LFGTVKW----TGVDENDCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENVKKSETSDQIVCGLNSSVIAGDN----------------KGIQGNANSCYFDSALFALFVKSDVLD-YLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDIT-------CTFLCSQ---------HKCQHPACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXX-XXXXXXXYAIPRVSRCECVSKFLSLSEDQMKQYIGSNDLKELKMILEDSCVYIYHNKSKTCY 5860
             +G ++W     GV+E      GLEL+D     TDGTF G R FTC     +   L +   D+RF +  + P + +    +     G  S V+ G+                 KGIQG+ NSCY DS LF LF  S VLD  L+ P   E+       E + ++   IV PLR  G+V      ++R +++K  A      +++   E ++ L   +   + LL I        +  F Q+F+  ++ V   T +++L+ S + + + F E P+CLI+Q PR  K    +    P  ++ I+ +  +  + C IC G A ++C+ C  D+ DIT       C    +Q         HK    +  K LPD       +    M+L A++CIE  H+V+FVK                    +++ +W FFDSM+      + + IP+V+ C  V ++L +S +++      N     + +L D+ + +Y + + + Y
Sbjct:  503 FYGVIRWIGQPAGVNE---MLAGLELEDECAGCTDGTFKGTRYFTCAPKKALFVKLKSCRPDSRFAS--LQPVSNQIERCNSLAFGGYLSEVVEGNTPPRTEKEGLEVMIGKKKGIQGHYNSCYLDSTLFCLFSFSSVLDSVLLRP--KEKTDVEYYSETQALLRTEIVNPLRIYGYVCATKIMKLRKILEKVEAASGFTSEEKDPEEFLNILFHHILRVDPLLKIRSAGQKVQDCYFYQIFMDKNENVGVPTIQQLLEWSFINSSLKFAEAPSCLIVQMPRFGKDFKMFNKIFPSLDLNITDLLEDTPRQCRICGGLAMYECRECY-DDPDITAGKIKQFCKICNTQVHLHPKRQHHKFNPVSLPKELPDWDWRHGCIPYQKMDLFAVLCIETSHYVAFVKYG------------------RDDSSWVFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEELHALDSRNIQGCARRLLCDAYMCMYQSPTMSLY 974          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Xenopus
Match: tril (TLR4 interactor with leucine-rich repeats [Source:Xenbase;Acc:XB-GENE-6050227])

HSP 1 Score: 157.918 bits (398), Expect = 3.557e-38
Identity = 134/498 (26.91%), Postives = 224/498 (44.98%), Query Frame = 2
Query: 4490 LFGTVKW----TGVDENDCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENVKKSETSDQIVCGLNSSVIAGDN----------------KGIQGNANSCYFDSALFALFVKSDVLD-YLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDIT-------CTFLCSQ---------HKCQHPACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXX-XXXXXXXYAIPRVSRCECVSKFLSLSEDQMKQYIGSNDLKELKMILEDSCVYIYHNKSKTCY 5860
             +G ++W     GV+E      GLEL+D     TDGTF G R FTC     +   L +   D+RF +  + P + +    +     G  S V+ G+                 KGIQG+ NSCY DS LF LF  S VLD  L+ P   E+       E + ++   IV PLR  G+V      ++R +++K  A      +++   E ++ L   +   + LL I        +  F Q+F+  ++ V   T +++L+ S + + + F E P+CLI+Q PR  K    +    P  ++ I+ +  +  + C IC G A ++C+ C  D+ DIT       C    +Q         HK    +  K LPD       +    M+L A++CIE  H+V+FVK                    +++ +W FFDSM+      + + IP+V+ C  V ++L +S +++      N     + +L D+ + +Y + + + Y
Sbjct:  485 FYGVIRWIGQPAGVNE---MLAGLELEDECAGCTDGTFKGTRYFTCAPKKALFVKLKSCRPDSRFAS--LQPVSNQIERCNSLAFGGYLSEVVEGNTPPRTEKEGLEVMIGKKKGIQGHYNSCYLDSTLFCLFSFSSVLDSVLLRP--KEKTDVEYYSETQALLRTEIVNPLRIYGYVCATKIMKLRKILEKVEAASGFTSEEKDPEEFLNILFHHILRVDPLLKIRSAGQKVQDCYFYQIFMDKNENVGVPTIQQLLEWSFINSSLKFAEAPSCLIVQMPRFGKDFKMFNKIFPSLDLNITDLLEDTPRQCRICGGLAMYECRECY-DDPDITAGKIKQFCKICNTQVHLHPKRQHHKFNPVSLPKELPDWDWRHGCIPYQKMDLFAVLCIETSHYVAFVKYG------------------RDDSSWVFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEELHALDSRNIQGCARRLLCDAYMCMYQSPTMSLY 956          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Xenopus
Match: tril (TLR4 interactor with leucine-rich repeats [Source:Xenbase;Acc:XB-GENE-6050227])

HSP 1 Score: 132.494 bits (332), Expect = 1.600e-30
Identity = 107/391 (27.37%), Postives = 183/391 (46.80%), Query Frame = 2
Query: 4751 VIAGDNKGIQGNANSCYFDSALFALFVKSDVLD-YLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDIT-------CTFLCSQ---------HKCQHPACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXXXXXXXX-XYAIPRVSRCECVSKFLSLSEDQMKQYIGSNDLKELKMILEDSCVYIYHNKSKTCY 5860
            V+ G  KGIQG+ NSCY DS LF LF  S VLD  L+ P   E+       E + ++   IV PLR  G+V      ++R +++K  A      +++   E ++ L   +   + LL I        +  F Q+F+  ++ V   T +++L+ S + + + F E P+CLI+Q PR  K    +    P  ++ I+ +  +  + C IC G A ++C+ C  D+ DIT       C    +Q         HK    +  K LPD       +    M+L A++CIE  H+V+FVK                    +++ +W FFDSM+ +      + IP+V+ C  V ++L +S +++      N     + +L D+ + +Y + + + Y
Sbjct:  402 VMIGKKKGIQGHYNSCYLDSTLFCLFSFSSVLDSVLLRP--KEKTDVEYYSETQALLRTEIVNPLRIYGYVCATKIMKLRKILEKVEAASGFTSEEKDPEEFLNILFHHILRVDPLLKIRSAGQKVQDCYFYQIFMDKNENVGVPTIQQLLEWSFINSSLKFAEAPSCLIVQMPRFGKDFKMFNKIFPSLDLNITDLLEDTPRQCRICGGLAMYECRECY-DDPDITAGKIKQFCKICNTQVHLHPKRQHHKFNPVSLPKELPDWDWRHGCIPYQKMDLFAVLCIETSHYVAFVKYG------------------RDDSSWVFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEELHALDSRNIQGCARRLLCDAYMCMYQSPTMSLY 771          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Xenopus
Match: tril (TLR4 interactor with leucine-rich repeats [Source:Xenbase;Acc:XB-GENE-6050227])

HSP 1 Score: 132.88 bits (333), Expect = 2.067e-30
Identity = 130/499 (26.05%), Postives = 215/499 (43.09%), Query Frame = 2
Query: 4490 LFGTVKW----TGVDENDCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENVKKSETSDQIVCGLNSSVIAGDN----------------KGIQGNANSCYFDSALFALFVKSDVLD-YLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFM-TSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDIT-------CTFLCSQ---------HKCQHPACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXX-XXXXXXXYAIPRVSRCECVSKFLSLSEDQMKQYIGSNDLKELKMILEDSCVYIYHNKSKTCY 5860
             +G ++W     GV+E      GLEL+D     TDGTF G R FTC     +   L +   D+RF +  + P + +    +     G  S V+ G+                 KGIQG+ NSCY DS LF LF  S VLD  L+ P   E+       E + ++   IV PLR  G+V      ++R +++K              +E  S   S+    E+ L+I          +F  +   ++ K+        +L +++  N  +  E P+CLI+Q PR  K    +    P  ++ I+ +  +  + C IC G A ++C+ C  D+ DIT       C    +Q         HK    +  K LPD       +    M+L A++CIE  H+V+FVK                    +++ +W FFDSM+      + + IP+V+ C  V ++L +S +++      N     + +L D+ + +Y + + + Y
Sbjct:  502 FYGVIRWIGQPAGVNE---MLAGLELEDECAGCTDGTFKGTRYFTCAPKKALFVKLKSCRPDSRFAS--LQPVSNQIERCNSLAFGGYLSEVVEGNTPPRTEKEGLEVMIGKKKGIQGHYNSCYLDSTLFCLFSFSSVLDSVLLRP--KEKTDVEYYSETQALLRTEIVNPLRIYGYVCATKIMKLRKILEK--------------VEAASGFTSEEKDPEEFLNI----------LFHHILRNIESKLSVTDICAGLLWVTL--NIELVCEAPSCLIVQMPRFGKDFKMFNKIFPSLDLNITDLLEDTPRQCRICGGLAMYECRECY-DDPDITAGKIKQFCKICNTQVHLHPKRQHHKFNPVSLPKELPDWDWRHGCIPYQKMDLFAVLCIETSHYVAFVKYG------------------RDDSSWVFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEELHALDSRNIQGCARRLLCDAYMCMYQSPTMSLY 948          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Mouse
Match: Cyld (CYLD lysine 63 deubiquitinase [Source:MGI Symbol;Acc:MGI:1921506])

HSP 1 Score: 162.54 bits (410), Expect = 9.716e-40
Identity = 135/496 (27.22%), Postives = 222/496 (44.76%), Query Frame = 2
Query: 4490 LFGTVKWTGVDEN-DCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENVKKSETSDQIVCGLNSSVIA----------------GDNKGIQGNANSCYFDSALFALFVKSDVLDYLISPIINEQEADPIT--KEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXXXXXXXX-XYAIPRVSRCECVSKFLSLSEDQMKQYIGSNDLKELKMILEDSCVYIYHNKSKTCY 5860
             +G ++W G          GLEL+D     TDGTF G R FTC     +   L +   D+RF +  + P + +    +     G  S V+                 G  KGIQG+ NSCY DS LF LF  S  LD ++   +  +E + I    E +E++   IV PLR  G+V      ++R +++K  A      +++   E ++ L   +   E LL I        +  F Q+F+  ++KV   T +++L+ S + +++ F E P+CLI+Q PR  K    +K   P  E+ I+ +  +  + C IC G A ++C+ C  D+ DI+   +      CS     HP          +  K LPD       +    MEL A++CIE  H+V+FVK                    K++  W FFDSM+ +      + IP+V+ C  V ++L +S + +            + +L D+ + +Y + + + Y
Sbjct:  480 FYGVIRWIGQPPGLSDVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCRPDSRFAS--LQPVSNQIERCNSLAFGGYLSEVVEENTPPKMEKEGLEIMIGKKKGIQGHYNSCYLDSTLFCLFAFSSALDTVL---LRPKEKNDIEYYSETQELLRTEIVNPLRIYGYVCATKIMKLRKILEKVEAASGFTSEEKDPEEFLNILFHDILRVEPLLKIRSAGQKVQDCNFYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECY-DDPDISAGKIKQFCKTCSTQVHLHPRRLNHSYHPVSLPKDLPDWDWRHGCIPCQKMELFAVLCIETSHYVAFVKYG------------------KDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLY 951          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Mouse
Match: Cyld (CYLD lysine 63 deubiquitinase [Source:MGI Symbol;Acc:MGI:1921506])

HSP 1 Score: 162.54 bits (410), Expect = 9.716e-40
Identity = 135/496 (27.22%), Postives = 222/496 (44.76%), Query Frame = 2
Query: 4490 LFGTVKWTGVDEN-DCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENVKKSETSDQIVCGLNSSVIA----------------GDNKGIQGNANSCYFDSALFALFVKSDVLDYLISPIINEQEADPIT--KEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXXXXXXXX-XYAIPRVSRCECVSKFLSLSEDQMKQYIGSNDLKELKMILEDSCVYIYHNKSKTCY 5860
             +G ++W G          GLEL+D     TDGTF G R FTC     +   L +   D+RF +  + P + +    +     G  S V+                 G  KGIQG+ NSCY DS LF LF  S  LD ++   +  +E + I    E +E++   IV PLR  G+V      ++R +++K  A      +++   E ++ L   +   E LL I        +  F Q+F+  ++KV   T +++L+ S + +++ F E P+CLI+Q PR  K    +K   P  E+ I+ +  +  + C IC G A ++C+ C  D+ DI+   +      CS     HP          +  K LPD       +    MEL A++CIE  H+V+FVK                    K++  W FFDSM+ +      + IP+V+ C  V ++L +S + +            + +L D+ + +Y + + + Y
Sbjct:  480 FYGVIRWIGQPPGLSDVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCRPDSRFAS--LQPVSNQIERCNSLAFGGYLSEVVEENTPPKMEKEGLEIMIGKKKGIQGHYNSCYLDSTLFCLFAFSSALDTVL---LRPKEKNDIEYYSETQELLRTEIVNPLRIYGYVCATKIMKLRKILEKVEAASGFTSEEKDPEEFLNILFHDILRVEPLLKIRSAGQKVQDCNFYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECY-DDPDISAGKIKQFCKTCSTQVHLHPRRLNHSYHPVSLPKDLPDWDWRHGCIPCQKMELFAVLCIETSHYVAFVKYG------------------KDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLY 951          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Mouse
Match: Cyld (CYLD lysine 63 deubiquitinase [Source:MGI Symbol;Acc:MGI:1921506])

HSP 1 Score: 162.54 bits (410), Expect = 9.716e-40
Identity = 135/496 (27.22%), Postives = 222/496 (44.76%), Query Frame = 2
Query: 4490 LFGTVKWTGVDEN-DCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENVKKSETSDQIVCGLNSSVIA----------------GDNKGIQGNANSCYFDSALFALFVKSDVLDYLISPIINEQEADPIT--KEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXXXXXXXX-XYAIPRVSRCECVSKFLSLSEDQMKQYIGSNDLKELKMILEDSCVYIYHNKSKTCY 5860
             +G ++W G          GLEL+D     TDGTF G R FTC     +   L +   D+RF +  + P + +    +     G  S V+                 G  KGIQG+ NSCY DS LF LF  S  LD ++   +  +E + I    E +E++   IV PLR  G+V      ++R +++K  A      +++   E ++ L   +   E LL I        +  F Q+F+  ++KV   T +++L+ S + +++ F E P+CLI+Q PR  K    +K   P  E+ I+ +  +  + C IC G A ++C+ C  D+ DI+   +      CS     HP          +  K LPD       +    MEL A++CIE  H+V+FVK                    K++  W FFDSM+ +      + IP+V+ C  V ++L +S + +            + +L D+ + +Y + + + Y
Sbjct:  480 FYGVIRWIGQPPGLSDVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCRPDSRFAS--LQPVSNQIERCNSLAFGGYLSEVVEENTPPKMEKEGLEIMIGKKKGIQGHYNSCYLDSTLFCLFAFSSALDTVL---LRPKEKNDIEYYSETQELLRTEIVNPLRIYGYVCATKIMKLRKILEKVEAASGFTSEEKDPEEFLNILFHDILRVEPLLKIRSAGQKVQDCNFYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECY-DDPDISAGKIKQFCKTCSTQVHLHPRRLNHSYHPVSLPKDLPDWDWRHGCIPCQKMELFAVLCIETSHYVAFVKYG------------------KDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLY 951          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Mouse
Match: Cyld (CYLD lysine 63 deubiquitinase [Source:MGI Symbol;Acc:MGI:1921506])

HSP 1 Score: 162.54 bits (410), Expect = 1.089e-39
Identity = 135/496 (27.22%), Postives = 222/496 (44.76%), Query Frame = 2
Query: 4490 LFGTVKWTGVDEN-DCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENVKKSETSDQIVCGLNSSVIA----------------GDNKGIQGNANSCYFDSALFALFVKSDVLDYLISPIINEQEADPIT--KEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXX-XXXXXXXYAIPRVSRCECVSKFLSLSEDQMKQYIGSNDLKELKMILEDSCVYIYHNKSKTCY 5860
             +G ++W G          GLEL+D     TDGTF G R FTC     +   L +   D+RF +  + P + +    +     G  S V+                 G  KGIQG+ NSCY DS LF LF  S  LD ++   +  +E + I    E +E++   IV PLR  G+V      ++R +++K  A      +++   E ++ L   +   E LL I        +  F Q+F+  ++KV   T +++L+ S + +++ F E P+CLI+Q PR  K    +K   P  E+ I+ +  +  + C IC G A ++C+ C  D+ DI+   +      CS     HP          +  K LPD       +    MEL A++CIE  H+V+FVK                    K++  W FFDSM+      + + IP+V+ C  V ++L +S + +            + +L D+ + +Y + + + Y
Sbjct:  483 FYGVIRWIGQPPGLSDVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCRPDSRFAS--LQPVSNQIERCNSLAFGGYLSEVVEENTPPKMEKEGLEIMIGKKKGIQGHYNSCYLDSTLFCLFAFSSALDTVL---LRPKEKNDIEYYSETQELLRTEIVNPLRIYGYVCATKIMKLRKILEKVEAASGFTSEEKDPEEFLNILFHDILRVEPLLKIRSAGQKVQDCNFYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECY-DDPDISAGKIKQFCKTCSTQVHLHPRRLNHSYHPVSLPKDLPDWDWRHGCIPCQKMELFAVLCIETSHYVAFVKYG------------------KDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLY 954          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Mouse
Match: Cyld (CYLD lysine 63 deubiquitinase [Source:MGI Symbol;Acc:MGI:1921506])

HSP 1 Score: 162.155 bits (409), Expect = 1.387e-39
Identity = 135/496 (27.22%), Postives = 222/496 (44.76%), Query Frame = 2
Query: 4490 LFGTVKWTGVDEN-DCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENVKKSETSDQIVCGLNSSVIA----------------GDNKGIQGNANSCYFDSALFALFVKSDVLDYLISPIINEQEADPIT--KEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXX-XXXXXXXYAIPRVSRCECVSKFLSLSEDQMKQYIGSNDLKELKMILEDSCVYIYHNKSKTCY 5860
             +G ++W G          GLEL+D     TDGTF G R FTC     +   L +   D+RF +  + P + +    +     G  S V+                 G  KGIQG+ NSCY DS LF LF  S  LD ++   +  +E + I    E +E++   IV PLR  G+V      ++R +++K  A      +++   E ++ L   +   E LL I        +  F Q+F+  ++KV   T +++L+ S + +++ F E P+CLI+Q PR  K    +K   P  E+ I+ +  +  + C IC G A ++C+ C  D+ DI+   +      CS     HP          +  K LPD       +    MEL A++CIE  H+V+FVK                    K++  W FFDSM+      + + IP+V+ C  V ++L +S + +            + +L D+ + +Y + + + Y
Sbjct:  483 FYGVIRWIGQPPGLSDVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCRPDSRFAS--LQPVSNQIERCNSLAFGGYLSEVVEENTPPKMEKEGLEIMIGKKKGIQGHYNSCYLDSTLFCLFAFSSALDTVL---LRPKEKNDIEYYSETQELLRTEIVNPLRIYGYVCATKIMKLRKILEKVEAASGFTSEEKDPEEFLNILFHDILRVEPLLKIRSAGQKVQDCNFYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECY-DDPDISAGKIKQFCKTCSTQVHLHPRRLNHSYHPVSLPKDLPDWDWRHGCIPCQKMELFAVLCIETSHYVAFVKYG------------------KDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLY 954          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. UniProt/SwissProt
Match: sp|Q1RMU2|CYLD_BOVIN (Ubiquitin carboxyl-terminal hydrolase CYLD OS=Bos taurus OX=9913 GN=CYLD PE=2 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 1.189e-39
Identity = 137/495 (27.68%), Postives = 222/495 (44.85%), Query Frame = 2
Query: 4490 LFGTVKWTGVDEN-DCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENVKKSETSDQIVCGLNSSVIA----------------GDNKGIQGNANSCYFDSALFALFVKSDVLD-YLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXX-XXXXXXXYAIPRVSRCECVSKFLSLSEDQMKQYIGSNDLKELKMILEDSCVYIYHNKSKTCY 5860
             +G ++W G     +    GLEL+D     TDGTF G R FTC     +   L +   D+RF +  + P + +    +     G  S V+                 G  KGIQG+ NSCY DS LF LF  S VLD  L+ P   E+       E +E++   IV PLR  G+V      ++R +++K  A      +++   E ++ L   +   E LL I        +  F Q+F+  ++KV   T +++L+ S + +++ F E P+CLI+Q PR  K    +K   P  E+ I+ +  +  + C IC G A ++C+ C  D+ DI+   +      C+     HP          +  K LPD       +    MEL A++CIE  H+V+FVK                    K++  W FFDSM+      + + IP+V+ C  V ++L +S D +            + +L D+ + +Y + + + Y
Sbjct:  481 FYGVIRWIGQPPGLNEVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCRPDSRFAS--LQPVSNQIERCNSLAFGGYLSEVVEENTPPKMEKEGFEIMIGKKKGIQGHYNSCYLDSTLFCLFAFSSVLDTVLLRP--KEKNDVEYYSETQELLRTEIVNPLRIYGYVCATKIMKLRKILEKVEAASGFTSEEKDPEEFLNILFHHILRVEPLLKIRSAGQKVQDCYFYQIFMEKNEKVGVPTIQQLLECSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECY-DDPDISAGKIKQFCKTCNAQVHLHPKRLNHKYNPVSLPKDLPDWDWRHGCIPCQKMELFAVLCIETSHYVAFVKYG------------------KDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLDDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLY 952          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. UniProt/SwissProt
Match: sp|Q9NQC7|CYLD_HUMAN (Ubiquitin carboxyl-terminal hydrolase CYLD OS=Homo sapiens OX=9606 GN=CYLD PE=1 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 4.245e-39
Identity = 136/495 (27.47%), Postives = 222/495 (44.85%), Query Frame = 2
Query: 4490 LFGTVKWTGVDEN-DCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENVKKSETSDQIVCGLNSSVIA----------------GDNKGIQGNANSCYFDSALFALFVKSDVLD-YLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXX-XXXXXXXYAIPRVSRCECVSKFLSLSEDQMKQYIGSNDLKELKMILEDSCVYIYHNKSKTCY 5860
             +G ++W G     +    GLEL+D     TDGTF G R FTC     +   L +   D+RF +  + P + +    +     G  S V+                 G  KGIQG+ NSCY DS LF LF  S VLD  L+ P   E+       E +E++   IV PLR  G+V      ++R +++K  A      +++   E ++ L   +   E LL I        +  F Q+F+  ++KV   T +++L+ S + +++ F E P+CLI+Q PR  K    +K   P  E+ I+ +  +  + C IC G A ++C+ C  D+ DI+   +      C+     HP          +  K LPD       +    MEL A++CIE  H+V+FVK                    K++  W FFDSM+      + + IP+V+ C  V ++L +S + +            + +L D+ + +Y + + + Y
Sbjct:  484 FYGVIRWIGQPPGLNEVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCRPDSRFAS--LQPVSNQIERCNSLAFGGYLSEVVEENTPPKMEKEGLEIMIGKKKGIQGHYNSCYLDSTLFCLFAFSSVLDTVLLRP--KEKNDVEYYSETQELLRTEIVNPLRIYGYVCATKIMKLRKILEKVEAASGFTSEEKDPEEFLNILFHHILRVEPLLKIRSAGQKVQDCYFYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECY-DDPDISAGKIKQFCKTCNTQVHLHPKRLNHKYNPVSLPKDLPDWDWRHGCIPCQNMELFAVLCIETSHYVAFVKYG------------------KDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLY 955          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. UniProt/SwissProt
Match: sp|Q5RED8|CYLD_PONAB (Ubiquitin carboxyl-terminal hydrolase CYLD OS=Pongo abelii OX=9601 GN=CYLD PE=2 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 4.433e-39
Identity = 136/495 (27.47%), Postives = 222/495 (44.85%), Query Frame = 2
Query: 4490 LFGTVKWTGVDEN-DCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENVKKSETSDQIVCGLNSSVIA----------------GDNKGIQGNANSCYFDSALFALFVKSDVLD-YLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXX-XXXXXXXYAIPRVSRCECVSKFLSLSEDQMKQYIGSNDLKELKMILEDSCVYIYHNKSKTCY 5860
             +G ++W G     +    GLEL+D     TDGTF G R FTC     +   L +   D+RF +  + P + +    +     G  S V+                 G  KGIQG+ NSCY DS LF LF  S VLD  L+ P   E+       E +E++   IV PLR  G+V      ++R +++K  A      +++   E ++ L   +   E LL I        +  F Q+F+  ++KV   T +++L+ S + +++ F E P+CLI+Q PR  K    +K   P  E+ I+ +  +  + C IC G A ++C+ C  D+ DI+   +      C+     HP          +  K LPD       +    MEL A++CIE  H+V+FVK                    K++  W FFDSM+      + + IP+V+ C  V ++L +S + +            + +L D+ + +Y + + + Y
Sbjct:  484 FYGVIRWIGQPPGLNEVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCRPDSRFAS--LQPVSNQIERCNSLAFGGYLSEVVEENTPPKMEKEGLEIMIGKKKGIQGHYNSCYLDSTLFCLFAFSSVLDTVLLRP--KEKNDVEYYSETQELLRTEIVNPLRIYGYVCATKIMKLRKILEKVEAASGFTSEEKDPEEFLNILFHHILRVEPLLKIRSAGQKVQDCYFYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECY-DDPDISAGKIKQFCKTCNTQVHLHPKRLNHKYNPVSLPKDLPDWDWRHGCIPCQNMELFAVLCIETSHYVAFVKYG------------------KDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLY 955          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. UniProt/SwissProt
Match: sp|Q80TQ2|CYLD_MOUSE (Ubiquitin carboxyl-terminal hydrolase CYLD OS=Mus musculus OX=10090 GN=Cyld PE=1 SV=2)

HSP 1 Score: 162.54 bits (410), Expect = 6.797e-39
Identity = 135/496 (27.22%), Postives = 222/496 (44.76%), Query Frame = 2
Query: 4490 LFGTVKWTGVDEN-DCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENVKKSETSDQIVCGLNSSVIA----------------GDNKGIQGNANSCYFDSALFALFVKSDVLDYLISPIINEQEADPIT--KEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXXXXXXXX-XYAIPRVSRCECVSKFLSLSEDQMKQYIGSNDLKELKMILEDSCVYIYHNKSKTCY 5860
             +G ++W G          GLEL+D     TDGTF G R FTC     +   L +   D+RF +  + P + +    +     G  S V+                 G  KGIQG+ NSCY DS LF LF  S  LD ++   +  +E + I    E +E++   IV PLR  G+V      ++R +++K  A      +++   E ++ L   +   E LL I        +  F Q+F+  ++KV   T +++L+ S + +++ F E P+CLI+Q PR  K    +K   P  E+ I+ +  +  + C IC G A ++C+ C  D+ DI+   +      CS     HP          +  K LPD       +    MEL A++CIE  H+V+FVK                    K++  W FFDSM+ +      + IP+V+ C  V ++L +S + +            + +L D+ + +Y + + + Y
Sbjct:  480 FYGVIRWIGQPPGLSDVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCRPDSRFAS--LQPVSNQIERCNSLAFGGYLSEVVEENTPPKMEKEGLEIMIGKKKGIQGHYNSCYLDSTLFCLFAFSSALDTVL---LRPKEKNDIEYYSETQELLRTEIVNPLRIYGYVCATKIMKLRKILEKVEAASGFTSEEKDPEEFLNILFHDILRVEPLLKIRSAGQKVQDCNFYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECY-DDPDISAGKIKQFCKTCSTQVHLHPRRLNHSYHPVSLPKDLPDWDWRHGCIPCQKMELFAVLCIETSHYVAFVKYG------------------KDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLY 951          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. UniProt/SwissProt
Match: sp|Q66H62|CYLD_RAT (Ubiquitin carboxyl-terminal hydrolase CYLD OS=Rattus norvegicus OX=10116 GN=Cyld PE=1 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 1.033e-38
Identity = 136/495 (27.47%), Postives = 220/495 (44.44%), Query Frame = 2
Query: 4490 LFGTVKWTGVDEN-DCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENVKKSETSDQIVCGLNSSVIA----------------GDNKGIQGNANSCYFDSALFALFVKSDVLD-YLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXXXXXXXX-XYAIPRVSRCECVSKFLSLSEDQMKQYIGSNDLKELKMILEDSCVYIYHNKSKTCY 5860
             +G ++W G          GLEL+D     TDGTF G R FTC     +   L +   D+RF +  + P + +    +     G  S V+                 G  KGIQG+ NSCY DS LF LF  S  LD  L+ P   E+       E +E++   IV PLR  G+V      ++R +++K  A      +++   E ++ L   +   E LL I        +  F Q+F+  ++KV   T +++L+ S + +++ F E P+CLI+Q PR  K    +K   P  E+ I+ +  +  + C IC G A ++C+ C  D+ DI+   +      CS     HP          +  K LPD       +    MEL A++CIE  H+V+FVK                    K++  W FFDSM+ +      + IP+V+ C  V ++L +S + +            + +L D+ + +Y + + + Y
Sbjct:  481 FYGVIRWIGQPPGLSDVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCRPDSRFAS--LQPVSNQIERCNSLAFGGYLSEVVEENTPPKMEKEGLEIMIGKKKGIQGHYNSCYLDSTLFCLFAFSSALDTVLLRP--KEKNDVEYYSETQELLRTEIVNPLRIYGYVCATKIMKLRKILEKVEAASGFTSEEKDPEEFLNILFHDILRVEPLLKIRSAGQKVQDCNFYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECY-DDPDISAGKIKQFCKTCSTQVHLHPRRLNHTYHPVSLPKDLPDWDWRHGCIPCQKMELFAVLCIETSHYVAFVKYG------------------KDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLY 952          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. TrEMBL
Match: A0A2T7NIT4 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_19240 PE=4 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 7.155e-48
Identity = 164/583 (28.13%), Postives = 264/583 (45.28%), Query Frame = 2
Query: 4289 NGSNGTFWRRQIV-----NSRGKRVIATSVNHVYKYEPYVIKTIPEEIQIFKEIVINSAVKYYFLTATGYQDLFGTVKWTGV--DENDCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFT--AKVVSPENVKKSETSD--QIVCGLNSSV------IAGDNKGIQGNANSCYFDSALFALFVKSDVLDYLISPIINEQ---EADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMEN-VSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTC---LGDELDI-----TCTFLCSQHK---CQHPACTKLLPDTVKSKSKVF--------------------------MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXX-XXXXXXXYAIPRVSRCECVSKFLSLSEDQMKQYIGSNDLKEL----KMILEDSCVYIYHNKS 5848
            +GS G +W R  +     N  GK+  ++S       +P              ++V+ S V+       G   L+G +KW G   D+ +    GLE+++ I+ GTDGTF G+RLF+C        PLN    D RF   AK  S E     ET D    +C  +         + G ++GIQG+ NSCY D+ LF++F  + V D+    I NE    ++ P  +  ++++   IV PLR+  +V      ++R ++ K G     MM +E D E  +S LLS++   + LL    H     ++ F QLFL  D+K+   T++ ++++S +Q ++   E+P+CL++Q PR  K    Y+  +P  E++I+ I    ++ C +C   A F+CK C    G  L       TC  +  QHK     HP    + P+ +   S++                           MEL A++CI+  H+VSFVK                   +  E  W FFDSM+        Y IP V     +S++  LSED  +  +   D K L    + +L D+ + +Y + +
Sbjct:  349 SGSQGAWWTRLRMKSLDRNRDGKQSSSSSTTSSVPPDP--------------DLVVGSMVEVLL---QGKPPLYGVIKWIGTFDDQTNKVIAGLEMEEEISAGTDGTFKGKRLFSCAPHKAFFVPLNKCRKDKRFQGDAKRPSQEEFGTIETPDIDGEICPPDVKTPEDLLPVCGKSRGIQGHHNSCYLDATLFSMFYFTTVFDF----IFNEPPRPDSVPEHQRVQKVLKEGIVNPLRRYNYVRADKVLKLRELLDKLGT-IPGMMGEEKDPEEFLSALLSQVIKADPLL----HLSSGEHTYFYQLFLEKDEKLLLPTTQILVELSFLQGNVKLKEVPSCLMLQMPRFGKDYKMYRRIIPSLELDITDILETGIRECIVCGSLARFECKDCHLIHGQGLSTTAFCATCIKMSHQHKKRQAHHPKELMVPPEFLAKYSQICEESGPICRQNGEPLGTSHDYGLPKEKMELFAVLCIQTSHYVSFVK-----------------CGLGKEAPWVFFDSMADRMGEQGGYNIPEVQHVPELSRW--LSEDNFQSILDVEDDKNLPEHMRRLLCDAYMCMYQSPT 886          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. TrEMBL
Match: H3A9I5 (Uncharacterized protein OS=Latimeria chalumnae OX=7897 GN=LOC102365523 PE=3 SV=1)

HSP 1 Score: 194.512 bits (493), Expect = 1.548e-46
Identity = 143/502 (28.49%), Postives = 239/502 (47.61%), Query Frame = 2
Query: 4463 FLTATGYQDLFGTVKWTG-VDENDCYFFGLELDDRI-NIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTA------------KVVSPENVKKS--ETSDQIVCGLNSSVIAGDNKGIQGNANSCYFDSALFALFVKSDVLDYLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDIT----------CTFLCSQHKCQ--HPACTKLLPDTVK-------SKSKVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXX-XXXXXXXYAIPRVSRCECVSKFLSLSEDQMKQYIGSNDLKELKMILEDSCVYIYHNKSKTCY 5860
            ++   G   L+G ++W G V        GLEL++R+ N+ TDGTF G R F C    G+   L N   D+RF +            K+   EN  ++  E +   +       + G  KGIQG+ NSCY D+ LF +F  S VLD ++    ++ + D  ++  R+++   IV PLRKNG+V       +R +++  G +    + +E D E     L ++   E LL I        + +F Q+F+   + V   + +++L+ S V +D+ F E P+C I+Q PR  K    +   LP  E++I+ +  +  + CSIC   +  +C+ C  D  DIT          C+    QH+ +  H     LLP  ++       S     MEL A++CIE  H+V+FVK                      + +W FFDSM+  +   S + IP+VS C  V+++L +S D+++     +    ++ +L D+ + +YHN + + Y
Sbjct:  449 YMVEVGRDPLYGMIRWIGEVSGIHEPIAGLELEERLPNVATDGTFRGVRYFHCDPEKGLFVKLGNCRPDSRFASLHSSSNDISVLDKLALKENASETVEEDTPPEMGKEGGEKMTGWKKGIQGHCNSCYLDATLFCMFAFSSVLDTILLRPQDKNDEDSYSQT-RDLLRTEIVNPLRKNGYVCATKVMALRKILEA-GGQSTGFLTEEKDPEEFLNKLFQVLKVEPLLKIRSATQKPQDCIFYQIFMEKKQSVNIPSVQQLLEWSFVNSDLKFTEAPSCFIVQMPRFGKNFKMFSTILPTLELDITDLLEDTPRECSICQSLSMVECRNCYEDS-DITPGRIKQYCSVCSKQVHQHRNRKSHDPRNLLLPKELQDCNEFPGSIPHQTMELSAVLCIETSHYVAFVKYG------------------PADTDWLFFDSMADRKGGQSGFNIPQVSPCPEVAEYLKMSADELRDLDPKSMQGCVRRLLCDAYMCMYHNPTLSLY 929          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. TrEMBL
Match: A0A1S3P2U8 (ubiquitin carboxyl-terminal hydrolase CYLD-like isoform X3 OS=Salmo salar OX=8030 GN=LOC106582893 PE=3 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 3.999e-46
Identity = 143/515 (27.77%), Postives = 239/515 (46.41%), Query Frame = 2
Query: 4406 PEEIQIFKEIVINSAVKYYFLTATGYQDLFGTVKWTGV-DENDCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENVKKS--------ETSDQIVCGLNSS----VIAGDNKGIQGNANSCYFDSALFALFVKSDVLDYLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMEN-VSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGD---------ELDITCTFLCSQHKCQHPACTKLL--PDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXXXX--XXXXXYAIPRVSRCECVSKFLSLSEDQMKQYIGSNDLKELKMILEDSCVYIYHNKSKTCY 5860
            P E+    E+  N+ +  Y           G ++W GV  EN   + G+ELD  +N  +DGT+GGQ+ FTC+ G  +  PL   + D RF       E +K +        E +D+ V  +  S    ++ G  KGIQG+ NSCY D+ LF+LF  S  LD +       +++  I++  ++ I  R    LR+ GFV     + + N  ++ G      + +E D E  ++ LL ++   + LL +  +N    ++   Q+ L  ++     T +++L IS++   + F E+P+CL++  PR  K    + + +P  E +I+ +  N  + C +C   AE++C  CL D         +   TC      H  +   C + L  P  V + + V    M+L A++CI   H+VSFVK                        +W FFDSM+ +     S Y IP +  C  V  FLS SE+++ +   S   + ++ +L DS +Y+Y + S   Y
Sbjct:  233 PFEVGSIVEVTSNTGITVY-----------GVIRWMGVLSENKNDWAGIELDYEVNNCSDGTYGGQQYFTCKEGRALFVPLTKCSPDGRFLCPPSEKETLKATDIPPVIPLEETDENVPPIPESEALSLLVGKMKGIQGHYNSCYLDATLFSLFSSSMTLDSVCHKPAGTEKS--ISRSLKKDIVNR----LRRQGFVP---AESVMNFRKQLGCD--TFVTEEKDPEEFITILLQRVLCMKSLLKLRSNNNTSQDAYTFQIILDKEQVTQTPTVQQLLDISLLSCGLKFEEIPSCLMVHMPRFGKKYKMFPHIIPSTEFDITDLLYNSPRECFLCGRLAEYECPQCLQDRKLQPGRIKQYCTTCKTQVHTHPSRQSHCPRALAVPAEVPADAPVPRHKMQLFAVLCIHTSHYVSFVKYG------------------PGPRSWLFFDSMADRCGDDQSGYNIPEIRACPEVGDFLSQSEEELARADPSQAGEPVRRLLSDSYMYLYQSASMALY 707          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. TrEMBL
Match: A0A1S3P2Y0 (ubiquitin carboxyl-terminal hydrolase CYLD-like isoform X4 OS=Salmo salar OX=8030 GN=LOC106582893 PE=3 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 4.913e-46
Identity = 143/515 (27.77%), Postives = 239/515 (46.41%), Query Frame = 2
Query: 4406 PEEIQIFKEIVINSAVKYYFLTATGYQDLFGTVKWTGV-DENDCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENVKKS--------ETSDQIVCGLNSS----VIAGDNKGIQGNANSCYFDSALFALFVKSDVLDYLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMEN-VSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGD---------ELDITCTFLCSQHKCQHPACTKLL--PDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXXXX--XXXXXYAIPRVSRCECVSKFLSLSEDQMKQYIGSNDLKELKMILEDSCVYIYHNKSKTCY 5860
            P E+    E+  N+ +  Y           G ++W GV  EN   + G+ELD  +N  +DGT+GGQ+ FTC+ G  +  PL   + D RF       E +K +        E +D+ V  +  S    ++ G  KGIQG+ NSCY D+ LF+LF  S  LD +       +++  I++  ++ I  R    LR+ GFV     + + N  ++ G      + +E D E  ++ LL ++   + LL +  +N    ++   Q+ L  ++     T +++L IS++   + F E+P+CL++  PR  K    + + +P  E +I+ +  N  + C +C   AE++C  CL D         +   TC      H  +   C + L  P  V + + V    M+L A++CI   H+VSFVK                        +W FFDSM+ +     S Y IP +  C  V  FLS SE+++ +   S   + ++ +L DS +Y+Y + S   Y
Sbjct:  232 PFEVGSIVEVTSNTGITVY-----------GVIRWMGVLSENKNDWAGIELDYEVNNCSDGTYGGQQYFTCKEGRALFVPLTKCSPDGRFLCPPSEKETLKATDIPPVIPLEETDENVPPIPESEALSLLVGKMKGIQGHYNSCYLDATLFSLFSSSMTLDSVCHKPAGTEKS--ISRSLKKDIVNR----LRRQGFVP---AESVMNFRKQLGCD--TFVTEEKDPEEFITILLQRVLCMKSLLKLRSNNNTSQDAYTFQIILDKEQVTQTPTVQQLLDISLLSCGLKFEEIPSCLMVHMPRFGKKYKMFPHIIPSTEFDITDLLYNSPRECFLCGRLAEYECPQCLQDRKLQPGRIKQYCTTCKTQVHTHPSRQSHCPRALAVPAEVPADAPVPRHKMQLFAVLCIHTSHYVSFVKYG------------------PGPRSWLFFDSMADRCGDDQSGYNIPEIRACPEVGDFLSQSEEELARADPSQAGEPVRRLLSDSYMYLYQSASMALY 706          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. TrEMBL
Match: A0A1S3P338 (ubiquitin carboxyl-terminal hydrolase CYLD-like isoform X1 OS=Salmo salar OX=8030 GN=LOC106582893 PE=3 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 9.363e-46
Identity = 144/518 (27.80%), Postives = 239/518 (46.14%), Query Frame = 2
Query: 4406 PEEIQIFKEIVINSAVKYYFLTATGYQDLFGTVKWTGV-DENDCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENVKKS--------ETSDQIVCGLNSS----VIAGDNKGIQGNANSCYFDSALFALFVKSDVLDYLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMEN-VSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGD---------ELDITCTFLCSQHKCQHPACTKLL--PDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXX-----XXXXXXXYAIPRVSRCECVSKFLSLSEDQMKQYIGSNDLKELKMILEDSCVYIYHNKSKTCY 5860
            P E+    E+  N+ +  Y           G ++W GV  EN   + G+ELD  +N  +DGT+GGQ+ FTC+ G  +  PL   + D RF       E +K +        E +D+ V  +  S    ++ G  KGIQG+ NSCY D+ LF+LF  S  LD +       +++  I++  ++ I  R    LR+ GFV     + + N  ++ G      + +E D E  ++ LL ++   + LL +  +N    ++   Q+ L  ++     T +++L IS++   + F E+P+CL++  PR  K    + + +P  E +I+ +  N  + C +C   AE++C  CL D         +   TC      H  +   C + L  P  V + + V    M+L A++CI   H+VSFVK                        +W FFDSM+     S    S Y IP +  C  V  FLS SE+++ +   S   + ++ +L DS +Y+Y + S   Y
Sbjct:  233 PFEVGSIVEVTSNTGITVY-----------GVIRWMGVLSENKNDWAGIELDYEVNNCSDGTYGGQQYFTCKEGRALFVPLTKCSPDGRFLCPPSEKETLKATDIPPVIPLEETDENVPPIPESEALSLLVGKMKGIQGHYNSCYLDATLFSLFSSSMTLDSVCHKPAGTEKS--ISRSLKKDIVNR----LRRQGFVP---AESVMNFRKQLGCD--TFVTEEKDPEEFITILLQRVLCMKSLLKLRSNNNTSQDAYTFQIILDKEQVTQTPTVQQLLDISLLSCGLKFEEIPSCLMVHMPRFGKKYKMFPHIIPSTEFDITDLLYNSPRECFLCGRLAEYECPQCLQDRKLQPGRIKQYCTTCKTQVHTHPSRQSHCPRALAVPAEVPADAPVPRHKMQLFAVLCIHTSHYVSFVKYG------------------PGPRSWLFFDSMADRCVPSGDDQSGYNIPEIRACPEVGDFLSQSEEELARADPSQAGEPVRRLLSDSYMYLYQSASMALY 710          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Cavefish
Match: cylda (CYLD lysine 63 deubiquitinase [Source:NCBI gene;Acc:103044817])

HSP 1 Score: 164.466 bits (415), Expect = 1.985e-40
Identity = 132/492 (26.83%), Postives = 222/492 (45.12%), Query Frame = 2
Query: 4490 LFGTVKWTGVDENDC-YFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENVKK--------------SETSDQIVCGLNSSVIAGDNKGIQGNANSCYFDSALFALFVKSDVLDYLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXXXXXXXX-XYAIPRVSRCECVSKFLSLSEDQMKQYIGSNDLKELKMILEDSCVYIYHNKSKTCY 5860
            L G ++W G+         GLEL++     TDGTF G R FTC     +   L     D+RF ++  SP  +++              +E +          V+ G  KGIQG+ NSCY DS LF LF  S VLD ++    ++ + +    E +E++   IV PLR +G+V      ++R +++K  A      +++   E ++ L   +   + LL +        +  F Q+F+    KV   TS+++L+ S + +D+ F E P+CLI+Q PR  K    +    P  E++I+ +  +  + C IC G A ++C+ C  D  DIT   +      C+     HP          +  K L + V  +       MEL A++CIE  H+V+FVK                      +  W FFDSM+ +      + IP+VS C  V  +L ++ +++      N     + +L D+ + +Y + + + Y
Sbjct:  442 LCGVIRWVGLPPGLLEPLAGLELEEECVGCTDGTFKGTRYFTCPPKKALFVKLKCCRPDSRFPSQHHSPNPIERCNSIAFGGYLSEVVNENTPPRTENDGLEVMVGKKKGIQGHYNSCYLDSTLFCLFSFSSVLDTVLLRPKSKTDVE-YYLETQELLRTEIVNPLRIHGYVCATKIMKLRRILEKVEAASGFTSEEKDPEEFLNILFHHILRVDPLLKLRSAGQKVQDCYFYQIFMDKKDKVLVPTSQQLLEWSFINSDLKFAEAPSCLIIQMPRFGKDFKMFNKIFPSLELDITDLLEDTPRECRICGGLALYECRECYEDA-DITAGKIKQFCEKCNTQVHLHPRRKTHRYGKLSVPKELQEGVWRQGSFPHQQMELFAVLCIETSHYVAFVKYG------------------AADSAWLFFDSMADRDGGQNGFNIPQVSPCPEVGAYLKMTPEELHALDPKNIQGYARRLLCDAYMCMYQSPTMSLY 913          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Cavefish
Match: cylda (CYLD lysine 63 deubiquitinase [Source:NCBI gene;Acc:103044817])

HSP 1 Score: 164.466 bits (415), Expect = 2.129e-40
Identity = 132/492 (26.83%), Postives = 222/492 (45.12%), Query Frame = 2
Query: 4490 LFGTVKWTGVDENDC-YFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENVKK--------------SETSDQIVCGLNSSVIAGDNKGIQGNANSCYFDSALFALFVKSDVLDYLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXXXXXXXX-XYAIPRVSRCECVSKFLSLSEDQMKQYIGSNDLKELKMILEDSCVYIYHNKSKTCY 5860
            L G ++W G+         GLEL++     TDGTF G R FTC     +   L     D+RF ++  SP  +++              +E +          V+ G  KGIQG+ NSCY DS LF LF  S VLD ++    ++ + +    E +E++   IV PLR +G+V      ++R +++K  A      +++   E ++ L   +   + LL +        +  F Q+F+    KV   TS+++L+ S + +D+ F E P+CLI+Q PR  K    +    P  E++I+ +  +  + C IC G A ++C+ C  D  DIT   +      C+     HP          +  K L + V  +       MEL A++CIE  H+V+FVK                      +  W FFDSM+ +      + IP+VS C  V  +L ++ +++      N     + +L D+ + +Y + + + Y
Sbjct:  481 LCGVIRWVGLPPGLLEPLAGLELEEECVGCTDGTFKGTRYFTCPPKKALFVKLKCCRPDSRFPSQHHSPNPIERCNSIAFGGYLSEVVNENTPPRTENDGLEVMVGKKKGIQGHYNSCYLDSTLFCLFSFSSVLDTVLLRPKSKTDVE-YYLETQELLRTEIVNPLRIHGYVCATKIMKLRRILEKVEAASGFTSEEKDPEEFLNILFHHILRVDPLLKLRSAGQKVQDCYFYQIFMDKKDKVLVPTSQQLLEWSFINSDLKFAEAPSCLIIQMPRFGKDFKMFNKIFPSLELDITDLLEDTPRECRICGGLALYECRECYEDA-DITAGKIKQFCEKCNTQVHLHPRRKTHRYGKLSVPKELQEGVWRQGSFPHQQMELFAVLCIETSHYVAFVKYG------------------AADSAWLFFDSMADRDGGQNGFNIPQVSPCPEVGAYLKMTPEELHALDPKNIQGYARRLLCDAYMCMYQSPTMSLY 952          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Cavefish
Match: cylda (CYLD lysine 63 deubiquitinase [Source:NCBI gene;Acc:103044817])

HSP 1 Score: 164.466 bits (415), Expect = 2.129e-40
Identity = 132/492 (26.83%), Postives = 222/492 (45.12%), Query Frame = 2
Query: 4490 LFGTVKWTGVDENDC-YFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENVKK--------------SETSDQIVCGLNSSVIAGDNKGIQGNANSCYFDSALFALFVKSDVLDYLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXXXXXXXX-XYAIPRVSRCECVSKFLSLSEDQMKQYIGSNDLKELKMILEDSCVYIYHNKSKTCY 5860
            L G ++W G+         GLEL++     TDGTF G R FTC     +   L     D+RF ++  SP  +++              +E +          V+ G  KGIQG+ NSCY DS LF LF  S VLD ++    ++ + +    E +E++   IV PLR +G+V      ++R +++K  A      +++   E ++ L   +   + LL +        +  F Q+F+    KV   TS+++L+ S + +D+ F E P+CLI+Q PR  K    +    P  E++I+ +  +  + C IC G A ++C+ C  D  DIT   +      C+     HP          +  K L + V  +       MEL A++CIE  H+V+FVK                      +  W FFDSM+ +      + IP+VS C  V  +L ++ +++      N     + +L D+ + +Y + + + Y
Sbjct:  481 LCGVIRWVGLPPGLLEPLAGLELEEECVGCTDGTFKGTRYFTCPPKKALFVKLKCCRPDSRFPSQHHSPNPIERCNSIAFGGYLSEVVNENTPPRTENDGLEVMVGKKKGIQGHYNSCYLDSTLFCLFSFSSVLDTVLLRPKSKTDVE-YYLETQELLRTEIVNPLRIHGYVCATKIMKLRRILEKVEAASGFTSEEKDPEEFLNILFHHILRVDPLLKLRSAGQKVQDCYFYQIFMDKKDKVLVPTSQQLLEWSFINSDLKFAEAPSCLIIQMPRFGKDFKMFNKIFPSLELDITDLLEDTPRECRICGGLALYECRECYEDA-DITAGKIKQFCEKCNTQVHLHPRRKTHRYGKLSVPKELQEGVWRQGSFPHQQMELFAVLCIETSHYVAFVKYG------------------AADSAWLFFDSMADRDGGQNGFNIPQVSPCPEVGAYLKMTPEELHALDPKNIQGYARRLLCDAYMCMYQSPTMSLY 952          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Cavefish
Match: cyldl (cylindromatosis (turban tumor syndrome), like [Source:ZFIN;Acc:ZDB-GENE-131127-190])

HSP 1 Score: 153.68 bits (387), Expect = 1.814e-37
Identity = 136/510 (26.67%), Postives = 215/510 (42.16%), Query Frame = 2
Query: 4430 EIVINSAVKYYFLTATGYQDLFGTVKWTG-VDENDCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSP-----------ENVKKSETSDQIVCGLNSSVIAGDNKGIQGNANSCYFDSALFALFVKSDVLDYLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGD---------ELDITCTFLCSQHKCQHP--ACTKLLPDTV----------KSKSKVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXXXXXXXXXYAIPRVSRCECVSKFLSLSEDQMKQYIGSNDLKELKMILEDSCVYIYHNKSKTCY 5860
            EI +NS V+        Y    GTV+W G + E      GLEL++   +  DGTF   R F C    G+   + +   D+RF     S            +NV       Q V       + G  +GIQG+ NSCY DSALF LF  S VLD L+    N+ +     K  +E +   IV PLR  GFV+     ++R  +Q+ G         E   E ++ ++  +   E  L           S F Q+F+  +  +   T +++L+ S   + +   E+P+CLI+  PR  K    +   +P  E++I+ +  N  + C +C   A  +C  C GD          L  TC+     H  + P    T  LP+             S  +  +EL A++CIE  H+VSFVK   + T                  +W FFDSM+ +   + Y +P+V  C  V ++L++   ++   +        K +  D  +Y+Y + +   Y
Sbjct:  264 EINLNSVVEVDLAKGPTY----GTVRWIGHLPEKTDLMAGLELEEDWGV-NDGTFRNDRYFFCPPKRGIFVKVASCRPDSRFLGDNASDGHFVSAVQDLQDNVPVPPLRSQDV----KDFLIGKQRGIQGHCNSCYMDSALF-LFTCSSVLDSLLYKGTNQND-----KHIQETLRKEIVGPLR-TGFVADRSVMKLRQQLQERGHS-PSYTTDEKPEEFLTLIMQDILSLEPPLKKPLGMKKVETSFFYQIFVDYNNTLVLPTVQQLLEHSFYTSCLRLEEVPSCLILTMPRSGKQFKMFPKIIPSLELDITALLYN-PQQCVLCGQLAHVECTECFGDPVFGNTGFKHLCDTCSAQVHLHPSRRPHKPTTMTLPEGFIRMWGSGGPPHSPPREKLELFAVLCIETSHYVSFVKHGPKAT------------------DWIFFDSMADRIEINGYNVPQVKECPEVGRYLTMPLAELAAQVPREMEGVAKRLFCDGYMYLYQSPNMGLY 737          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Cavefish
Match: ENSAMXT00000022455.2 (pep primary_assembly:Astyanax_mexicanus-2.0:21:17282006:17293930:1 gene:ENSAMXG00000021802.2 transcript:ENSAMXT00000022455.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 147.902 bits (372), Expect = 3.433e-35
Identity = 135/520 (25.96%), Postives = 223/520 (42.88%), Query Frame = 2
Query: 4490 LFGTVKWTG-VDENDCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENV-------------KKSETSDQIVCGLNS-SVIAGDNKGIQGNANSCYFDSALFALFVKSDVLDYLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLF--------------------LTVDKKVPFMTS----------EEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDI----------TCTFLCSQHK---CQHPACTKLLPDTVKSK---SKVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXX-XXXXXXXYAIPRVSRCECVSKFLSLSEDQMKQYIGSNDLKE-LKMILEDSCVYIYHNKSKTCY 5860
            +FG ++W G +        G+ELD  ++  TDG++ G+R F C    G+   L N   D+RF A       V             K+ E +   V G ++  V  G  KGIQG+ NSCY D++LF+LF     +D+++       +    +K+ +E++   IV PLR+ G+V    T  +R +++      A    +E D E     L +L   E LL I   +         QLF                          +P  +           + +L+ S + + + F E P+CL +  PR  K    +   LP  +++I+ +    L+ CSIC   A ++C  C  D LDI          TC      HK      P   ++   T +     ++  ++L A+ CIE  H+VSFVK     T                  +W FFDSM+  +   + + +P+V  C  V ++LSLSE ++ + + +  LKE ++ +L D+ + +YH    + Y
Sbjct:  468 IFGVIRWIGQIAGLSEPVAGIELDQELSAATDGSYLGERHFRCPPNKGLFVKLRNCRRDSRFPAPEAPINQVDRCNSIAFAEWGSKRVEDNTPPVLGPDARQVYEGFKKGIQGHLNSCYLDASLFSLFSCCSSVDWVL--FYPSSDDSHRSKDAQELLRCEIVNPLRRYGYVCASKTMALRKLLEAETTD-AGFTNEEKDPEEFLNKLFQLLRVEPLLKIRSMSQEPQECHIYQLFPPSISSSPSSPLHSPLSPSLSNSLSPIPLSSPAAGLMRVASVQALLESSFIHSGLKFTEAPSCLPLLMPRFGKEFKMFDTILPSLKLDITDLLDETLRQCSICQSVAAWECLQCYED-LDITPGQLKQYCNTCNAQVHAHKKRQTHSPLKVRIPKGTWEGPVHGARQQLDLFAVTCIETSHYVSFVKYGPLQT------------------DWLFFDSMADREGGENGFNVPQVRACPEVGRYLSLSEKELGR-LDTTSLKEPVRRLLCDAYMCLYHCPELSLY 964          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000692.1 (pep scaffold:Pmarinus_7.0:GL491130:1075:4385:-1 gene:ENSPMAG00000000632.1 transcript:ENSPMAT00000000692.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.9669 bits (219), Expect = 1.265e-19
Identity = 59/190 (31.05%), Postives = 89/190 (46.84%), Query Frame = 2
Query: 4490 LFGTVKWTGVDEN-DCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTA------------KVVSPENVKKSETSDQIVCGLN---SSVIAGDNKGIQGNANSCYFDSALFALFVKSDVLDYLI-SPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYG 5008
            +FG ++W GV    D    G+EL++ +   +DGTF   R FTC  G G          D+RF +              ++  N +      ++        ++V+ G  KGIQG+ NSCY DS LF +F  S V D ++  P  +    D  T   ++++   IV PLRKNGFVS     ++R  + K G
Sbjct:   35 VFGVIRWIGVPVGLDETLAGIELEEEMQGCSDGTFKQHRFFTCPTGKGFFIQFKKCRPDSRFMSMPHVGLDPVQRCNSLAFSNYRSERVEGEVPPPSEKEATAVVCGRTKGIQGHYNSCYLDSTLFCMFAFSTVFDGMLHRPQRSSDLKDYNT--VQQLLREDIVNPLRKNGFVSATKVMQLRKQLDKIG 222          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Nematostella
Match: EDO47295 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMM7])

HSP 1 Score: 155.606 bits (392), Expect = 7.088e-40
Identity = 134/494 (27.13%), Postives = 221/494 (44.74%), Query Frame = 2
Query: 4484 QDLFGTVKWTG--VDENDCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENVKKSETSDQIVCGLNSSVIA----------GDNKGIQGNANSCYFDSALFALFVKSDVLDYLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAE-FQCKTCLGDEL-DITCTFLCS---QHKCQHPACT--KLLPDTVKSK-----------SKVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXXXXXXXX-XYAIPRVSRCECVSKFLSLSEDQMKQYIGSNDLKEL----KMILEDSCVYIYHNKSKTCY 5860
            Q  +G ++W G   +  +    GLEL++  +  +DGTF G+R F C  G G    L     D+RF          + ++    + C     +I           G  +GIQG+ NSCY DS L+++F  + V D L+       + +   K  ++++   IV PLR+NGFV       +R ++ K G+      +++   E ++TLL ++   E LL +  H  C+  S + Q+    D+ +   T + +++ S +  D+   E+P+CLI+Q PR       Y    P   ++I+ I  N  + C +C  +A  F+CK C  +++  I  T  C    +    HP  T  KL P  V  +            +  MEL A++CI+  H+V+FVK  +                   +  W FFDSM+ +   S  Y IP V  C   S++L    D++   IG+N   EL    K +  D+ + +Y N     Y
Sbjct:   10 QPRYGVIRWIGQLAELKNKLVAGLELEEEQSGCSDGTFKGKRYFECPPGRGFFVLLKYCRKDSRFELDSPMDTPGRSAKNFGSMDCPSIEGIIPPPPSLPEQSTGMMRGIQGHHNSCYLDSTLYSMFAFTTVFDTLLHRERQSSDLEDYDK-VQKVLKEEIVNPLRRNGFVRADRVLRLRRLLDKLGSTSGLTDEEKDPEEFLNTLLHQVLKSESLLQLKSHGRCE-ESNYYQIITEKDEGIKLATVQTLIEQSFMAADLKLAEVPSCLILQMPRFGNKYKMYDIIFPNTTLDITDILDNVPRPCVLCGEQASTFECKECYEEKIFSIGITSFCRDCCKKVHSHPRRTSHKLTPIIVPREYSQYARRDGPLERYTMELFAVVCIQTSHYVAFVKCGQ-----------------GPDAPWCFFDSMADRKGESNGYNIPAVRACPEASRWLLAKPDEI---IGANRRGELPGNMKRLFGDAYMCMYQNFDTAMY 481          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Medaka
Match: cyldb (ubiquitin carboxyl-terminal hydrolase CYLD [Source:NCBI gene;Acc:101163809])

HSP 1 Score: 164.081 bits (414), Expect = 6.068e-41
Identity = 131/477 (27.46%), Postives = 218/477 (45.70%), Query Frame = 2
Query: 4493 FGTVKWTGVDENDCY-FFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRF---------TAKVVSPENVKKSETSDQIVCGLNSSVIAGDNKGIQGNANSCYFDSALFALFVKSDVLDYLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGD---------ELDITCTFLCSQH--KCQH-PACTKLLPDTVKSKSKVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXXXX--XXXXXYAIPRVSRCECVSKFLSLSEDQMKQYIGSNDLKE---LKMILEDSCVYIYHN 5842
            +G ++W G+ E     + G+ELD  ++  +DG +GGQR FTC++   +  P++  + D+RF         T     P N    E +  +      S+  G  KGIQG+ NSCY D+ LF+LF  S V+D +       Q+  P+    R I+       LR+ GFV     + + N  ++ G       +++ + E +S L  K+   E LL +         +  +Q+FL  ++     T +++L  S +  D+ F  +P+CLI+Q PR       + + +P  E++I+ +  N  + C IC   AEF+C  CL D         +  +TC      H  +C H P    +  D      +  M+L A++CI+  H+VSFVK                        +W FFDSM+ +     S Y IP +  C  +  FL  SE++  +   SN L+    ++ +L DS + +Y +
Sbjct:  250 YGVIRWLGIPEEMTEEWAGIELDYEVDGCSDGKYGGQRFFTCESNKALFLPISKCSPDSRFFCSTEKHKVTEIPPVPLNEDLEEDAPPVPESKALSLFLGRMKGIQGHINSCYLDATLFSLFSSSVVVDRICQKPAEPQQ--PLNCTLRTIVNR-----LRRQGFVP---AECVMNFRKQLGCDTFRTDEKDPE-EFISVLFQKVLCIEPLLKLRSEGETSQGANTLQIFLEKEQLQHIPTVQQLLDTSCMSEDLKFEMVPSCLIIQMPRFGNKYKMFSHIIPSMELDITDLLHNSPRECFICGHLAEFECPQCLPDRKLQPGRIKQYCLTCNTQVHSHPSRCSHFPRAVTVPADADTPVPRHTMQLFAVLCIQTSHYVSFVKYG------------------PEPHSWVFFDSMADRCGDDQSGYNIPEIRACPELGDFLCQSEEEQAR---SNPLQAPELVRRLLCDSYMLLYQS 694          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Medaka
Match: ENSORLT00000011257.2 (ubiquitin carboxyl-terminal hydrolase CYLD [Source:NCBI gene;Acc:101167576])

HSP 1 Score: 163.696 bits (413), Expect = 3.592e-40
Identity = 139/513 (27.10%), Postives = 226/513 (44.05%), Query Frame = 2
Query: 4490 LFGTVKW----TGVDENDCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENV-------------KKSETSDQIVCGLNS-SVIAGDNKGIQGNANSCYFDSALFALFVKSDVLDYLI-SPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLF--------------------LTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------------CSQHKCQHPACTKLLPDTVKSK----SKVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXX-XXXXXXXYAIPRVSRCECVSKFLSLSEDQMKQYIGSNDLKELKMILEDSCVYIYHNKSKTCY 5860
            L+G ++W    +GV E      G+ELD  ++ GTDG++ G+R F C    G+   L N   D+RF A       V             K+ E     V G  +  +  G  KGIQG+ NSCY D+ LF+LF      D+L+  P   E+    +  + ++ +   IV PLR+NG+V    T  +R +++      A    QE D E     L +L   E LL I   +         QLF                    L++   +   + + +L+ S +   + F E P+CL++  PR  K    +   LP   ++I+ +  + L+ CSIC   AE++C  C  D  DIT   L              +++  H      +P+   S     ++  M L A+ CIE  H+VSFVK   + T                  +W FFDSM+  +   + + IP+V  C  V ++LSLSE+++ +   ++  + ++ +L DS + +YH+   + Y
Sbjct:  426 LYGVIRWIGRISGVPET---VAGIELDQELSAGTDGSYLGERRFRCPANKGLFVKLRNCRRDSRFPAPETPVNQVERCNSIAFAEWGSKRVEEHTPPVDGDEARELYQGWKKGIQGHLNSCYLDATLFSLFSCCSSADWLLFWPSDPEEHRSAV--QAQDQLRCEIVNPLRRNGYVCASKTMALRRMLEAANND-ASFTSQEKDPEEFLNKLFQLLRVEPLLKIRSMSLDPQECHLYQLFPPTHPPSPSSPTSPVESPIPLSLPPSLRVASVQNLLETSFMHTGLKFVEAPSCLLLLMPRFGKDFKMFDAILPTLSLDITDLLDDTLRQCSICQSVAEWECLQCYEDP-DITPGHLKQYCQTCNTQVHSHRNRLSHSPVKIGIPEGPWSGPLICTRRKMSLFAVTCIETSHYVSFVKHGPQPT------------------DWLFFDSMADREGGQNGFNIPQVKACPEVGRYLSLSEEELSRVDPASLRETVRRLLCDSYMCLYHSPELSLY 913          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Medaka
Match: ENSORLT00000045278.1 (ubiquitin carboxyl-terminal hydrolase CYLD [Source:NCBI gene;Acc:101167576])

HSP 1 Score: 163.696 bits (413), Expect = 3.743e-40
Identity = 139/513 (27.10%), Postives = 226/513 (44.05%), Query Frame = 2
Query: 4490 LFGTVKW----TGVDENDCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENV-------------KKSETSDQIVCGLNS-SVIAGDNKGIQGNANSCYFDSALFALFVKSDVLDYLI-SPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLF--------------------LTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------------CSQHKCQHPACTKLLPDTVKSK----SKVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXX-XXXXXXXYAIPRVSRCECVSKFLSLSEDQMKQYIGSNDLKELKMILEDSCVYIYHNKSKTCY 5860
            L+G ++W    +GV E      G+ELD  ++ GTDG++ G+R F C    G+   L N   D+RF A       V             K+ E     V G  +  +  G  KGIQG+ NSCY D+ LF+LF      D+L+  P   E+    +  + ++ +   IV PLR+NG+V    T  +R +++      A    QE D E     L +L   E LL I   +         QLF                    L++   +   + + +L+ S +   + F E P+CL++  PR  K    +   LP   ++I+ +  + L+ CSIC   AE++C  C  D  DIT   L              +++  H      +P+   S     ++  M L A+ CIE  H+VSFVK   + T                  +W FFDSM+  +   + + IP+V  C  V ++LSLSE+++ +   ++  + ++ +L DS + +YH+   + Y
Sbjct:  455 LYGVIRWIGRISGVPET---VAGIELDQELSAGTDGSYLGERRFRCPANKGLFVKLRNCRRDSRFPAPETPVNQVERCNSIAFAEWGSKRVEEHTPPVDGDEARELYQGWKKGIQGHLNSCYLDATLFSLFSCCSSADWLLFWPSDPEEHRSAV--QAQDQLRCEIVNPLRRNGYVCASKTMALRRMLEAANND-ASFTSQEKDPEEFLNKLFQLLRVEPLLKIRSMSLDPQECHLYQLFPPTHPPSPSSPTSPVESPIPLSLPPSLRVASVQNLLETSFMHTGLKFVEAPSCLLLLMPRFGKDFKMFDAILPTLSLDITDLLDDTLRQCSICQSVAEWECLQCYEDP-DITPGHLKQYCQTCNTQVHSHRNRLSHSPVKIGIPEGPWSGPLICTRRKMSLFAVTCIETSHYVSFVKHGPQPT------------------DWLFFDSMADREGGQNGFNIPQVKACPEVGRYLSLSEEELSRVDPASLRETVRRLLCDSYMCLYHSPELSLY 942          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Medaka
Match: ENSORLT00000041324.1 (ubiquitin carboxyl-terminal hydrolase CYLD [Source:NCBI gene;Acc:101167576])

HSP 1 Score: 163.696 bits (413), Expect = 3.743e-40
Identity = 139/513 (27.10%), Postives = 226/513 (44.05%), Query Frame = 2
Query: 4490 LFGTVKW----TGVDENDCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENV-------------KKSETSDQIVCGLNS-SVIAGDNKGIQGNANSCYFDSALFALFVKSDVLDYLI-SPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLF--------------------LTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------------CSQHKCQHPACTKLLPDTVKSK----SKVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXX-XXXXXXXYAIPRVSRCECVSKFLSLSEDQMKQYIGSNDLKELKMILEDSCVYIYHNKSKTCY 5860
            L+G ++W    +GV E      G+ELD  ++ GTDG++ G+R F C    G+   L N   D+RF A       V             K+ E     V G  +  +  G  KGIQG+ NSCY D+ LF+LF      D+L+  P   E+    +  + ++ +   IV PLR+NG+V    T  +R +++      A    QE D E     L +L   E LL I   +         QLF                    L++   +   + + +L+ S +   + F E P+CL++  PR  K    +   LP   ++I+ +  + L+ CSIC   AE++C  C  D  DIT   L              +++  H      +P+   S     ++  M L A+ CIE  H+VSFVK   + T                  +W FFDSM+  +   + + IP+V  C  V ++LSLSE+++ +   ++  + ++ +L DS + +YH+   + Y
Sbjct:  455 LYGVIRWIGRISGVPET---VAGIELDQELSAGTDGSYLGERRFRCPANKGLFVKLRNCRRDSRFPAPETPVNQVERCNSIAFAEWGSKRVEEHTPPVDGDEARELYQGWKKGIQGHLNSCYLDATLFSLFSCCSSADWLLFWPSDPEEHRSAV--QAQDQLRCEIVNPLRRNGYVCASKTMALRRMLEAANND-ASFTSQEKDPEEFLNKLFQLLRVEPLLKIRSMSLDPQECHLYQLFPPTHPPSPSSPTSPVESPIPLSLPPSLRVASVQNLLETSFMHTGLKFVEAPSCLLLLMPRFGKDFKMFDAILPTLSLDITDLLDDTLRQCSICQSVAEWECLQCYEDP-DITPGHLKQYCQTCNTQVHSHRNRLSHSPVKIGIPEGPWSGPLICTRRKMSLFAVTCIETSHYVSFVKHGPQPT------------------DWLFFDSMADREGGQNGFNIPQVKACPEVGRYLSLSEEELSRVDPASLRETVRRLLCDSYMCLYHSPELSLY 942          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Medaka
Match: cylda (CYLD lysine 63 deubiquitinase [Source:NCBI gene;Acc:101156964])

HSP 1 Score: 162.925 bits (411), Expect = 5.585e-40
Identity = 130/492 (26.42%), Postives = 221/492 (44.92%), Query Frame = 2
Query: 4490 LFGTVKWTGVDENDC-YFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENVKK--------------SETSDQIVCGLNSSVIAGDNKGIQGNANSCYFDSALFALFVKSDVLDYLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTVKSKS---KVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXXXXXXXX-XYAIPRVSRCECVSKFLSLSEDQMKQYIGSNDLKELKMILEDSCVYIYHNKSKTCY 5860
            L G ++W G+         GLEL++     TDGTF G R FTC     +   L     D+RF +   SP  +++               E +          V+ G  KGIQG+ NSCY DS LF LF  S VLD ++    ++ + +   +E +E++   IV PLR +G+V      ++R +++K  A      +++   E +  L   +   + LL +        +  F Q+F+    KV   T +++L+ S + +D+ F E P+CLI+Q PR  K    +    P  E++I+ +  +  + C IC G A ++C+ C  D+ DIT   +      C+     HP          +  K L +    +    +  MEL A++CIE  H+V+FVK                      +  W FFDSM+ +      + IP+VS C  V  +L +S +++      +   + + +L D+ + +Y + + + Y
Sbjct:  446 LCGVIRWVGLPPGLLEPLAGLELEEECPGCTDGTFKGTRYFTCPPKKALFVKLKCCRPDSRFPSLHHSPNPIERCNSIAFGGYLSEVVHENTPPRTENDGLDVMVGKKKGIQGHYNSCYLDSTLFCLFSFSSVLDTVLLRPQSKTDVE-YYRETQELLRTEIVNPLRIHGYVCATKVMKLRRILEKVEAASGFTSEEKDPEEFLIILFHHILRVDPLLKLRSAGQKVQDCYFYQIFMDKKDKVGVPTIQQLLEWSFINSDLKFAEAPSCLIIQMPRFGKDFKMFNKIFPSLELDITDLLEDTPRECRICGGLAFYECRDCY-DDGDITAGKIKQFCEKCNTQVHLHPKRKAHRHGKLSVPKELQEGTGRQGGFPRQRMELFAVLCIETSHYVAFVKYG------------------TADSAWLFFDSMADRDGGQNGFNIPQVSPCPEVETYLKMSPEELHTLDPKSIQGQARRLLCDAYMCMYQSPTMSLY 917          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Planmine SMEST
Match: SMESG000007087.1 (SMESG000007087.1)

HSP 1 Score: 2894.38 bits (7502), Expect = 0.000e+0
Identity = 1442/1485 (97.10%), Postives = 1453/1485 (97.85%), Query Frame = 2
Query:  263 MHSDKSEDNSIKAVSNIDRQNSATSRTSNDSRDYMANKSVLPTIYCNKLGMDVIKPGAIDQIGKPKGASMNKYIAIQGKTKSFVKLFWKGKINNINCLGCELPEFWSEGTEGTFGRYKLFTCSYGRGVLILINDAVKSCESAEESNHLPLADNDELTANNICCFEPLDKLSKDIKVNSQVFCQQLKAGGKCKWMGLINGKGYVGIEFDEIHRRAERFNELSRILKIEGRIRFIPLECVENAKLHFIFDKIVDTGKIFYVDCEEDRDYLGNFAAINLTTRDGKSKQFIGELKWIGKINNEKCVGLDMEDETEFGMDGIINQDNRFDCMEKHGLITVLSNVNLYKYDNNVHLLPSGIINPDKYLRCKETFGDECIKAQRIKKDGMVNVKLLNGQANLKGTLKWHGLMNNVPVCAVQLLQEHENGTNGRFWRTRLFECRDKLAIATLTKNLSPSMPIDFIKDIFVEKNQKEFSRGSVRTDDIYHVGQFVKILPFDLFGQIECFHVVYEEMFVQIQLTKDQIKRLPFHQRIDRAAGNAIYSTVILLKDSIAKCSENLEFFNESSLINKECIEYRIPRPMETFRTGDLIKAGKTGNVKYFIVNNRFIINGISCLSVMESILGEAEEYLPESEAMKVDNSELEMKYFQGVFIDPKSIRSFEKCEINDFCIGNRVEFMSMDRKSSYNGRIKSTGIANKTIPSCVVQMPPSEPIVNRSLLQYTLNENLEFKILSGTANDFLFLIRANLLRKSELPETVNGIPVIDPEFIRIIEGVAVEPGKFIVFTCNNQRHSVQLKWKGLIDQKYCLGCVANFQCNFGTNGTFGQDKLFACEDKHGILIPLAAVSECCEMKGHKPIKWTRDGAIDENSICCTVEKNITKFQANCKLKNIKSNRKAIWKWSGLVNDVEVIGVEMNESLEKGTDGNFCKIQLFRSVHKRGALFKSEEFIISKSELKHVKEINLNVVDPFNVREIENGRQINKLTCYKSKGAIKILNIKWRGIVNGELCVGCELSGPVEWGTDGTFGNKIVFKCPARRGVLIPTEELIDSCETTAHSKITTLPNSGWLWKGDTYFINPDCICCTESTESLQKHPDLRIKSRIKVPNKENKQIGGSCEWIGLINGQEALGITMDNDVKGTNGIFSYFRMFTCEGGKGVLMLAENIFHDKESEKPQFIADKIVDINKIYSISPCXXXXXXXXXXXXXXXLNSPNGRNRDFIGEVKWTGRINDEKCV-XXXXXXXXXXXXXXXXXKSRIFQCMEKHGLVALLSDVELSENAENPQILDSGMIAPNKFIRFQEERSKKYLDDKNIKMNEFVIVKQGNPELKLKGKLRWIGWMNKLLVCVIELDQDHENGSNGTFWRRQIVNSRGKRVIATSVNHVYKYEPYVIKTIPEEIQIFKEIVINSAVKYYFLTATGYQDLFGTVKWTGVDENDCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENVKKSE 4714
            MHSDKSEDNSIKAVSNIDRQNSATSRTSNDSRDYMANKSVLPTI C+KLG+DVIKPGAIDQIGK KGA MNKYIAIQGKTKSFVKL WKGKINNINCLGCELPEFWSEGTEGTFGRYKLFTCSYGRGVLILINDAVKSCESAEESNHLPLADNDELTANNICCFEPLDKLSKDIKVNSQVFCQQLKAGGKCKWMGLINGKGYVGIEFDEIHRRAERFNELSRIL I+GRIRFI LECVENAKLHFIFDKIVDTGKIFYVDCEEDRDYLGNFAAINLTTRDGKSKQFIGELKWIGKINNEKCVGLDMEDETEFGMDGIINQDNRFDCMEKHGLITVLSNVNLYKYDNNVHLLPSGIINPDKYLRCKETFGDECIKAQRIKKDGMVNVKLLNGQANLKGTLKWHGLMNNVPVCAVQLLQEHENGTNGRFWRTRLFECRDKLAIATLTKNLSPSMPID IKDIFVEKNQKEFSRGSVRTDDIYHVGQFVKILPFDLFGQIECFHVVYEEMFVQIQLTKDQIKRLPFHQRIDRAAGNAIYSTVILLKDSIAKCSENLEFFNESSLINKECIEYRIPRPMETFRTGDLIKAGKTGNVKYFIVNNRFIINGISCLSVMESILGEAEEYLPESEA+KVDNSEL+MKYFQGVFIDPKSIRSFEKCEINDFCIGNRVEFMSMDRKSSY GRIKSTGIANKTIPSCVVQMPPSEPIVNRSLLQYTLNENLEFKILSGTANDFLFLIRANLLRKSELPETVNGIPVIDPEFIRIIEGVAVEPGKFIVFTCNNQRHSVQLKWKGLIDQKYCLGCVANFQCNFGTNGTFGQDKLFACEDKHGILIPLAAVSECCEMKGHKPIKWTRDGAIDENSICCTVEKNITKFQANCKLKNIKSN+KAIWKWSGLVNDVEVIGVEMNESLEKGTDGNFCKI LFRSV KRGALFKSEEFI SKSELKHVKEINLNVVDPFNVREIENGRQINKLTCYKSKGAIKILNIKWRGIVNGELCVGCELSGPVEWGTDGTFGNKIVFKCPARRGVLIPTEELIDSCETTAHSKITTLPNSGWLWKGDTYFINPDCICCTESTESLQKHPDLRIKSRIKVPNKENKQIGGSCEWIGLINGQEALGITMDNDVKGTNGIFS FRMFTCE GKGVLMLAENIFHDKE EKPQFIADKIVDINKIYSISPCEGENGIGIGKPIKINLNSPNGRNRDFIGEVKWTGRINDEKCV    +EEEMEHGMDGMIGKSRIFQCMEKHGLVALLSDVELSENAENPQILDSGMIAPNKFIRFQEERSKKYLDDKNIKMNEFV VKQ NPELKLKGKLRWIGWMNKLLVCVIELDQDHENGSNGTFWRR+IVNSRGKRVIATSVNHVYKYEPY+ K IPEEIQIFKEIVINSAVKYYFLTATGYQDLFGTVKWTGVDENDCYFFGLELDD I+IGTDGTFGGQRLFTCQNGHGVLAPLN VASDTRFTAK    E    +E
Sbjct:    1 MHSDKSEDNSIKAVSNIDRQNSATSRTSNDSRDYMANKSVLPTICCDKLGLDVIKPGAIDQIGKLKGAQMNKYIAIQGKTKSFVKLQWKGKINNINCLGCELPEFWSEGTEGTFGRYKLFTCSYGRGVLILINDAVKSCESAEESNHLPLADNDELTANNICCFEPLDKLSKDIKVNSQVFCQQLKAGGKCKWMGLINGKGYVGIEFDEIHRRAERFNELSRILNIDGRIRFISLECVENAKLHFIFDKIVDTGKIFYVDCEEDRDYLGNFAAINLTTRDGKSKQFIGELKWIGKINNEKCVGLDMEDETEFGMDGIINQDNRFDCMEKHGLITVLSNVNLYKYDNNVHLLPSGIINPDKYLRCKETFGDECIKAQRIKKDGMVNVKLLNGQANLKGTLKWHGLMNNVPVCAVQLLQEHENGTNGRFWRTRLFECRDKLAIATLTKNLSPSMPIDLIKDIFVEKNQKEFSRGSVRTDDIYHVGQFVKILPFDLFGQIECFHVVYEEMFVQIQLTKDQIKRLPFHQRIDRAAGNAIYSTVILLKDSIAKCSENLEFFNESSLINKECIEYRIPRPMETFRTGDLIKAGKTGNVKYFIVNNRFIINGISCLSVMESILGEAEEYLPESEAIKVDNSELKMKYFQGVFIDPKSIRSFEKCEINDFCIGNRVEFMSMDRKSSYKGRIKSTGIANKTIPSCVVQMPPSEPIVNRSLLQYTLNENLEFKILSGTANDFLFLIRANLLRKSELPETVNGIPVIDPEFIRIIEGVAVEPGKFIVFTCNNQRHSVQLKWKGLIDQKYCLGCVANFQCNFGTNGTFGQDKLFACEDKHGILIPLAAVSECCEMKGHKPIKWTRDGAIDENSICCTVEKNITKFQANCKLKNIKSNKKAIWKWSGLVNDVEVIGVEMNESLEKGTDGNFCKIPLFRSVTKRGALFKSEEFINSKSELKHVKEINLNVVDPFNVREIENGRQINKLTCYKSKGAIKILNIKWRGIVNGELCVGCELSGPVEWGTDGTFGNKIVFKCPARRGVLIPTEELIDSCETTAHSKITTLPNSGWLWKGDTYFINPDCICCTESTESLQKHPDLRIKSRIKVPNKENKQIGGSCEWIGLINGQEALGITMDNDVKGTNGIFSCFRMFTCESGKGVLMLAENIFHDKEREKPQFIADKIVDINKIYSISPCEGENGIGIGKPIKINLNSPNGRNRDFIGEVKWTGRINDEKCVGLDMVEEEMEHGMDGMIGKSRIFQCMEKHGLVALLSDVELSENAENPQILDSGMIAPNKFIRFQEERSKKYLDDKNIKMNEFVFVKQENPELKLKGKLRWIGWMNKLLVCVIELDQDHENGSNGTFWRRRIVNSRGKRVIATSVNHVYKYEPYLSKAIPEEIQIFKEIVINSAVKYYFLTATGYQDLFGTVKWTGVDENDCYFFGLELDDNIDIGTDGTFGGQRLFTCQNGHGVLAPLNTVASDTRFTAKETQHEEFLSAE 1485          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Planmine SMEST
Match: SMESG000056847.1 (SMESG000056847.1)

HSP 1 Score: 1547.72 bits (4006), Expect = 0.000e+0
Identity = 803/879 (91.35%), Postives = 832/879 (94.65%), Query Frame = 2
Query: 3227 KWRGIVNGELCVGCELSGPVEWGTDGTFGNKIVFKCPARRGVLIPTEELIDSCETTAHSKITTLPNSGWLWKG-DTYFINPDCICCTESTESLQKHPDLRIKSRIKVPNKENKQIGGSCEWIGLINGQEALGITMDNDVKGTNGIFSYFRMFTCEGGKGVLMLAENIFHDKESEKPQFIADKIVDINKIYSISPCXXXXXXXXXXXXXXXLNSPNGRNRDFIGEVKWTGRINDEKCVXXXXXXXXXXXXXXXXXKSRIFQCMEKHGLVALLSDVELSENAENPQILDSGMIAPNKFIRFQEERSKKYLDDKNIKMNEFVIVKQGNPELKLKGKLRWIGWMNKLLVCVIELDQDHENGSNGTFWRRQIVNSRGKRVIATSVNHVYKYEPYVIKTIPEEIQIFKEIVINSAVKYYFLTATGYQDLFGTVKWTGVDENDCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENVKKSETSDQIVCGLNSSVIAGDNKGIQGNANSCYFDSALFALFVKSDVLDYLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFLCSQHKCQHPACTKLLPDTVKSKSKVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXXXXXXXXXYAIPRVSRCECVSKFLSLSEDQMKQYIGSNDLKELKMILEDSCVYIYHNKSKTCY 5860
            KW G+VN    +G E++  +E GTDG F    +F+   +RG L  +EE I S    AH KITTL +SGWLWKG DTYFINPDCICCTESTE LQ+HPDLRIKSRIKVPNKENK IGGSCEWIGLINGQEALGITMDNDVKGTNGIFSYFRMFTCEGGKGVLMLAENIFHDKESEKPQFIADKIVDINKIYSISPCEGENGIGIGKPIKIN N PNGRNRDFIGEVKWTGRINDEKCVGLDMEEEMEHGM+GMIGKS+ F+CMEKHGLVALLSDVELSENAENPQ+LDSGMIAPNKFIRFQEERSKKYLDDKNIKMNEFVIVKQGNPELKLKGKLRWIGWMNKLLVCVIELDQDHENGSNGTFWRRQIVNSRGKRVIATSVNHVYKYEPYVIKTIPEEIQIFKEIVINSAVKYYFLTATGYQDLFGTVKWTGVDENDCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENVKKSETSDQIVCGLNSSVIAGDNKGIQGNANSCYFDSALFALFVKSDVLDYLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFLCSQHKCQHPACTKLLPDTVKSKSKVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSIS+SYAIPRVS+    S+FL+ S+++MK+ I   D  ++K I++DS ++IYHNKSKTCY
Sbjct:  296 KWSGLVNDVEVIGVEMNESLEKGTDGNFCKIQLFRSVHKRGALFKSEEFIIS----AHLKITTLRDSGWLWKGGDTYFINPDCICCTESTELLQQHPDLRIKSRIKVPNKENKHIGGSCEWIGLINGQEALGITMDNDVKGTNGIFSYFRMFTCEGGKGVLMLAENIFHDKESEKPQFIADKIVDINKIYSISPCEGENGIGIGKPIKINFNYPNGRNRDFIGEVKWTGRINDEKCVGLDMEEEMEHGMNGMIGKSQRFECMEKHGLVALLSDVELSENAENPQVLDSGMIAPNKFIRFQEERSKKYLDDKNIKMNEFVIVKQGNPELKLKGKLRWIGWMNKLLVCVIELDQDHENGSNGTFWRRQIVNSRGKRVIATSVNHVYKYEPYVIKTIPEEIQIFKEIVINSAVKYYFLTATGYQDLFGTVKWTGVDENDCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENVKKSETSDQIVCGLNSSVIAGDNKGIQGNANSCYFDSALFALFVKSDVLDYLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFLCSQHKCQHPACTKLLPDTVKSKSKVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSISNSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1170          

HSP 2 Score: 249.595 bits (636), Expect = 7.807e-67
Identity = 155/355 (43.66%), Postives = 204/355 (57.46%), Query Frame = 2
Query: 2789 MKGHKPIKWTRDGAIDENSICCTVEKNITKFQANCKLKNIKSNRKAIWKWSGLVNDVEVIGVEMNESLEKGTDGNFCKIQLFRSVHKRGALFKSEEFIISKSELKHVKEINLN------------VVDPFNVREIENGRQINKLTCYKSKGAIKILN---------IKWRGIVNGELCVGCELSGPVEWGTDGTFGNKIVFKCPARRGVLIPTEELIDSCETTAHSKITTLPNSGWLWKGDTYFINPDCICCTESTESLQKHPDLRIKSRIKVPNKENKQIGGSCEWIGLINGQEALGITMDNDVK-GTNGIFSYFRMFTCEGGKGVLMLAENIFHDKESEKPQFIADKIVDINK 3787
            ++GHKPIKWTRDGAIDENSICCTVEKNITKFQANCKLKNIKSNRKAIWKWSGLVNDVEVIGVEMNESLEKGTDGNFCKIQLFRSVHKRGALFKSEEFIIS     H+K   L              ++P  +   E+   + +    + K  IK+ N          +W G++NG+  +G  +   V+ GT+G F    +F C   +GVL+  E +    E+     I        +     Y I+P   C  E+   + K     IK     PN  N+   G  +W G IN ++ +G+ M+ +++ G NG+    + F C    G++ L  ++   + +E PQ +   ++  NK
Sbjct:  248 VEGHKPIKWTRDGAIDENSICCTVEKNITKFQANCKLKNIKSNRKAIWKWSGLVNDVEVIGVEMNESLEKGTDGNFCKIQLFRSVHKRGALFKSEEFIIS----AHLKITTLRDSGWLWKGGDTYFINPDCICCTESTELLQQHPDLRIKSRIKVPNKENKHIGGSCEWIGLINGQEALGITMDNDVK-GTNGIFSYFRMFTCEGGKGVLMLAENIFHDKESEKPQFIA----DKIVDINKIYSISP---CEGENGIGIGK----PIKINFNYPNGRNRDFIGEVKWTGRINDEKCVGLDMEEEMEHGMNGMIGKSQRFECMEKHGLVALLSDVELSENAENPQVLDSGMIAPNK 586          

HSP 3 Score: 230.72 bits (587), Expect = 6.026e-61
Identity = 138/383 (36.03%), Postives = 211/383 (55.09%), Query Frame = 2
Query:  524 WKGKINNINCLGCELPEFWSEGTEGTFGRYKLFTCSYGRGVLI-----LINDAVKSCESAEESNHLPLADNDELTANNICCFEPLDKLSK--DIKVNSQVFC---QQLKAGGKCKWMGLINGKGYVGIEFDEIHRRAERFNELSRILKIEGRIRFIPL-----ECVENAKLHFIFDKIVDTGKIFYVD-CE-EDRDYLGNFAAINLTTRDGKSKQFIGELKWIGKINNEKCVGLDMEDETEFGMDGIINQDNRFDCMEKHGLITVLSNVNLYKYDNNVHLLPSGIINPDKYLRCKETFGDECIKAQRIKKDGMVNVKLLNGQANLKGTLKWHGLMNNVPVCAVQLLQEHENGTNGRFWRTRLFECRDKLAIATLTKNLSPSMP 1621
            W G +N++  +G E+ E   +GT+G F + +LF   + RG L      +I+  +K     +        D   +  + ICC E  + L +  D+++ S++     +    GG C+W+GLING+  +GI  D   +         R+   EG    + L        E+ K  FI DKIVD  KI+ +  CE E+   +G    IN    +G+++ FIGE+KW G+IN+EKCVGLDME+E E GM+G+I +  RF+CMEKHGL+ +LS+V L +   N  +L SG+I P+K++R +E    + +  + IK +  V VK  N +  LKG L+W G MN + VC ++L Q+HENG+NG FWR ++   R K  IAT   ++    P
Sbjct:  297 WSGLVNDVEVIGVEMNESLEKGTDGNFCKIQLFRSVHKRGALFKSEEFIISAHLKITTLRDSGWLWKGGDTYFINPDCICCTESTELLQQHPDLRIKSRIKVPNKENKHIGGSCEWIGLINGQEALGITMDNDVKGTNGIFSYFRMFTCEGGKGVLMLAENIFHDKESEKPQFIADKIVDINKIYSISPCEGENGIGIGKPIKINFNYPNGRNRDFIGEVKWTGRINDEKCVGLDMEEEMEHGMNGMIGKSQRFECMEKHGLVALLSDVELSENAENPQVLDSGMIAPNKFIRFQEERSKKYLDDKNIKMNEFVIVKQGNPELKLKGKLRWIGWMNKLLVCVIELDQDHENGSNGTFWRRQIVNSRGKRVIATSVNHVYKYEP 679          

HSP 4 Score: 94.3597 bits (233), Expect = 6.839e-19
Identity = 131/506 (25.89%), Postives = 212/506 (41.90%), Query Frame = 2
Query: 2627 KWKGLIDQKYCLGCVANFQCNFGTNGTFGQDKLFACEDKHGILIPLAAVSECCEMKGHKPIKWTRDGA----------IDENSICCTVEKNITKFQANCKLKN-IKSNRK------AIWKWSGLVNDVEVIGVEMNESLEKGTDGNFCKIQLFRSVHKRGALFKSEEFIISKSELKHV----KEINLNVVDPFNVREIENGRQINK-----LTCYKSKGAIKILNIKWRGIVNGELCVGCELSGPVEWGTDGTFGNKIVFKCPARRGVLIPTEELIDSCETTAHSKITTLPNSGWLWKGDTYFINPDCICCTESTESLQKHPDLRIKSR----IKVPNKENKQIGGSCEWIGLINGQEALGITMDNDVK-GTNGIFSYFRMFTCEGGKGVLMLAENIFHDKESEKPQFIADKIVDINKIYSISPCXXXXXXXXXXXXXXXLNSPNGRNRDFIGEVKWTGRINDEKC--VXXXXXXXXXXXXXXXXXKSRIFQCMEKHGLVALLSDV 4045
            KW GL++    +G   N     GT+G F + +LF    K G L      SE   +  H  I   RD            I+ + ICCT    + +   + ++K+ IK   K         +W GL+N  E +G+ M+  + KGT+G F   ++F     +G L  +E     K   K      K +++N +   +  E ENG  I K           +    I  +KW G +N E CVG ++   +E G +G  G    F+C  + G++     L+   E + +++   + +SG         I P+     +   S +   D  IK      +K  N E K + G   WIG +N      I +D D + G+NG F + R      GK V+  + N  +  E    + I ++I    +I   S  +       G              +D  G VKWTG +++  C   GL++++ +  G DG  G  R+F C   HG++A L++V
Sbjct:  296 KWSGLVNDVEVIGVEMNESLEKGTDGNFCKIQLFRSVHKRGALFK----SEEFIISAHLKITTLRDSGWLWKGGDTYFINPDCICCTESTELLQQHPDLRIKSRIKVPNKENKHIGGSCEWIGLINGQEALGITMDNDV-KGTNGIFSYFRMFTCEGGKGVLMLAENIFHDKESEKPQFIADKIVDINKIYSISPCEGENGIGIGKPIKINFNYPNGRNRDFIGEVKWTGRINDEKCVGLDMEEEMEHGMNGMIGKSQRFECMEKHGLV----ALLSDVELSENAENPQVLDSG--------MIAPNKFIRFQEERSKKYLDDKNIKMNEFVIVKQGNPELK-LKGKLRWIGWMNKLLVCVIELDQDHENGSNGTF-WRRQIVNSRGKRVIATSVNHVYKYEPYVIKTIPEEIQIFKEIVINSAVKYYFLTATGY-------------QDLFGTVKWTG-VDENDCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNV 768          

HSP 5 Score: 77.7962 bits (190), Expect = 7.641e-14
Identity = 76/281 (27.05%), Postives = 118/281 (41.99%), Query Frame = 2
Query: 2621 QLKWKGLIDQKYCLGCVANFQCNFGTNGTFGQDKLFACEDKHGILIPLAAVSECCEMKGHKPIKWTRDGAIDENSICCTVEKNITKFQANCKLKNIKSNRKAIWK-------------WSGLVNDVEVIGVEMNESLEKGTDGNFCKIQLFRSVHKR------GALFKSEEFIISK--SELKHVKEINLNVVDPFNVREIENGRQINKLTCYKSKGAIKILNIKWRGI-VNGELCVGCELSGPVEWGTDGTFGNKIVFKCPARRGVLIPTEELIDSCETTA 3397
            ++KW G I+ + C+G     +   G NG  G+ + F C +KHG++  L+ V E  E   +  +     G I  N      E+   K+  +   KNIK N   I K             W G +N + V  +E+++  E G++G F + Q+  S  KR        ++K E ++I     E++  KEI +N    +              T Y+         +KW G+  N     G EL   +  GTDGTFG + +F C    GVL P   +      TA
Sbjct:  515 EVKWTGRINDEKCVGLDMEEEMEHGMNGMIGKSQRFECMEKHGLVALLSDV-ELSENAENPQV--LDSGMIAPNKFIRFQEERSKKYLDD---KNIKMNEFVIVKQGNPELKLKGKLRWIGWMNKLLVCVIELDQDHENGSNGTFWRRQIVNSRGKRVIATSVNHVYKYEPYVIKTIPEEIQIFKEIVINSAVKYYFL---------TATGYQDLFG----TVKWTGVDENDCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTA 776          

HSP 6 Score: 70.0922 bits (170), Expect = 1.821e-11
Identity = 75/330 (22.73%), Postives = 146/330 (44.24%), Query Frame = 2
Query:  701 HLPL--ADNDELTANNICCFEPLDKLSKDI-KVNSQVFCQQLKAGGKC--KWMGLINGKGYVGIEFDEIHRRAERFN----ELSRILKIEGRIRFIPLECVENAKLHFIFDKIVDTGKI------FYVD-----CEEDRDYLGNFAAINLTTR----DGKSKQFIGELKWIGKINNEKCVGLDMEDETEFGMDGIINQDNRFDCMEKHGLITVLSNVNLYKYDNNVHLLPSGIINPDKYLRCKETFGDECIKAQRIKKDGMVNVKLLNGQ-ANLKGTLKWHGLMNNVPVCAVQLLQEHENGTNGRFWRTRLFECRDKLAIATLTKNLSPS 1615
            H P+    +  +  N+ICC      + K+I K  +    + +K+  K   KW GL+N    +G+E +E   +    N    +L R +   G + F   E + +A  H     + D+G +      ++++     C E  + L     + + +R    + ++K   G  +WIG IN ++ +G+ M+++ + G +GI +    F C    G++ +  N+   K       +   I++ +K        G+  I    I K   +N    NG+  +  G +KW G +N+     + + +E E+G NG   +++ FEC +K  +  L  ++  S
Sbjct:  251 HKPIKWTRDGAIDENSICC-----TVEKNITKFQANCKLKNIKSNRKAIWKWSGLVNDVEVIGVEMNESLEKGTDGNFCKIQLFRSVHKRGAL-FKSEEFIISA--HLKITTLRDSGWLWKGGDTYFINPDCICCTESTELLQQHPDLRIKSRIKVPNKENKHIGGSCEWIGLINGQEALGITMDNDVK-GTNGIFSYFRMFTCEGGKGVLMLAENIFHDKESEKPQFIADKIVDINKIYSISPCEGENGIG---IGKPIKINFNYPNGRNRDFIGEVKWTGRINDEKCVGLDMEEEMEHGMNGMIGKSQRFECMEKHGLVALLSDVELS 568          

HSP 7 Score: 64.6994 bits (156), Expect = 7.609e-10
Identity = 88/381 (23.10%), Postives = 164/381 (43.04%), Query Frame = 2
Query:  524 WKGKINNINCLGCELPEFWSEGTEGTFGRYKLFTCSYGRGVLILINDAVKSCESAEESNHLP--LADNDELTANNICCFEPLDKLSKDIKVN-SQVFCQQLKAGGKCKWMGLINGKGYVGIEFDE--------IHRRAERFNELSRILKIEGRIRFIP-LECVENAKLHFIFDK-IVDTGKIFYVDCEEDRDYLGN----FAAINLTTRDGKSKQFIGELKWIGKINNEKCVGLDMEDETEFGMDGIINQDNRFDCMEKHGLITVLSNVNLYKYDNNVHLLPSGIIN-PDKYLRCKETFGDECIKAQRIKKDGMVNVKLLNGQANLKGTLKWHGL-MNNVPVCAVQLLQEHENGTNGRFWRTRLFECRDKLAIATLTKNLS 1609
            W G IN    LG  +     +GT G F  +++FTC  G+GVL+L  +     ES E+   +   + D +++ + + C  E    + K IK+N +    +     G+ KW G IN +  VG++ +E        +  +++RF  + +     G +  +  +E  ENA+   + D  ++   K      E  + YL +         +  +     +  G+L+WIG +N      ++++ + E G +G   +    +   K  + T +++V  YKY+      P  I   P++    KE   +  +K   +            G  +L GT+KW G+  N+     ++L      GT+G F   RLF C++   +     N++
Sbjct:  412 WIGLINGQEALGITMDND-VKGTNGIFSYFRMFTCEGGKGVLMLAENIFHDKES-EKPQFIADKIVDINKIYSISPCEGENGIGIGKPIKINFNYPNGRNRDFIGEVKWTGRINDEKCVGLDMEEEMEHGMNGMIGKSQRFECMEK----HGLVALLSDVELSENAENPQVLDSGMIAPNKFIRFQEERSKKYLDDKNIKMNEFVIVKQGNPELKLKGKLRWIGWMNKLLVCVIELDQDHENGSNGTFWRRQIVNSRGKRVIATSVNHV--YKYE------PYVIKTIPEEIQIFKEIVINSAVKYYFLTA---------TGYQDLFGTVKWTGVDENDCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVA 769          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Planmine SMEST
Match: SMESG000056847.1 (SMESG000056847.1)

HSP 1 Score: 1518.06 bits (3929), Expect = 0.000e+0
Identity = 783/831 (94.22%), Postives = 805/831 (96.87%), Query Frame = 2
Query: 3371 LIDSCETTAHSKITTLPNSGWLWKG-DTYFINPDCICCTESTESLQKHPDLRIKSRIKVPNKENKQIGGSCEWIGLINGQEALGITMDNDVKGTNGIFSYFRMFTCEGGKGVLMLAENIFHDKESEKPQFIADKIVDINKIYSISPCXXXXXXXXXXXXXXXLNSPNGRNRDFIGEVKWTGRINDEKCVXXXXXXXXXXXXXXXXXKSRIFQCMEKHGLVALLSDVELSENAENPQILDSGMIAPNKFIRFQEERSKKYLDDKNIKMNEFVIVKQGNPELKLKGKLRWIGWMNKLLVCVIELDQDHENGSNGTFWRRQIVNSRGKRVIATSVNHVYKYEPYVIKTIPEEIQIFKEIVINSAVKYYFLTATGYQDLFGTVKWTGVDENDCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENVKKSETSDQIVCGLNSSVIAGDNKGIQGNANSCYFDSALFALFVKSDVLDYLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFLCSQHKCQHPACTKLLPDTVKSKSKVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDXXXXXXXXXXYAIPRVSRCECVSKFLSLSEDQMKQYIGSNDLKELKMILEDSCVYIYHNKSKTCY 5860
            +I+     AH KITTL +SGWLWKG DTYFINPDCICCTESTE LQ+HPDLRIKSRIKVPNKENK IGGSCEWIGLINGQEALGITMDNDVKGTNGIFSYFRMFTCEGGKGVLMLAENIFHDKESEKPQFIADKIVDINKIYSISPCEGENGIGIGKPIKIN N PNGRNRDFIGEVKWTGRINDEKCVGLDMEEEMEHGM+GMIGKS+ F+CMEKHGLVALLSDVELSENAENPQ+LDSGMIAPNKFIRFQEERSKKYLDDKNIKMNEFVIVKQGNPELKLKGKLRWIGWMNKLLVCVIELDQDHENGSNGTFWRRQIVNSRGKRVIATSVNHVYKYEPYVIKTIPEEIQIFKEIVINSAVKYYFLTATGYQDLFGTVKWTGVDENDCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENVKKSETSDQIVCGLNSSVIAGDNKGIQGNANSCYFDSALFALFVKSDVLDYLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFLCSQHKCQHPACTKLLPDTVKSKSKVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSIS+SYAIPRVS+    S+FL+ S+++MK+ I   D  ++K I++DS ++IYHNKSKTCY
Sbjct:  242 IIEPILVAAHLKITTLRDSGWLWKGGDTYFINPDCICCTESTELLQQHPDLRIKSRIKVPNKENKHIGGSCEWIGLINGQEALGITMDNDVKGTNGIFSYFRMFTCEGGKGVLMLAENIFHDKESEKPQFIADKIVDINKIYSISPCEGENGIGIGKPIKINFNYPNGRNRDFIGEVKWTGRINDEKCVGLDMEEEMEHGMNGMIGKSQRFECMEKHGLVALLSDVELSENAENPQVLDSGMIAPNKFIRFQEERSKKYLDDKNIKMNEFVIVKQGNPELKLKGKLRWIGWMNKLLVCVIELDQDHENGSNGTFWRRQIVNSRGKRVIATSVNHVYKYEPYVIKTIPEEIQIFKEIVINSAVKYYFLTATGYQDLFGTVKWTGVDENDCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENVKKSETSDQIVCGLNSSVIAGDNKGIQGNANSCYFDSALFALFVKSDVLDYLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFLCSQHKCQHPACTKLLPDTVKSKSKVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSISNSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1072          

HSP 2 Score: 208.379 bits (529), Expect = 3.979e-54
Identity = 120/305 (39.34%), Postives = 177/305 (58.03%), Query Frame = 2
Query:  743 ICCFEPLDKLSK--DIKVNSQVFC---QQLKAGGKCKWMGLINGKGYVGIEFDEIHRRAERFNELSRILKIEGRIRFIPL-----ECVENAKLHFIFDKIVDTGKIFYVD-CE-EDRDYLGNFAAINLTTRDGKSKQFIGELKWIGKINNEKCVGLDMEDETEFGMDGIINQDNRFDCMEKHGLITVLSNVNLYKYDNNVHLLPSGIINPDKYLRCKETFGDECIKAQRIKKDGMVNVKLLNGQANLKGTLKWHGLMNNVPVCAVQLLQEHENGTNGRFWRTRLFECRDKLAIATLTKNLSPSMP 1621
            ICC E  + L +  D+++ S++     +    GG C+W+GLING+  +GI  D   +         R+   EG    + L        E+ K  FI DKIVD  KI+ +  CE E+   +G    IN    +G+++ FIGE+KW G+IN+EKCVGLDME+E E GM+G+I +  RF+CMEKHGL+ +LS+V L +   N  +L SG+I P+K++R +E    + +  + IK +  V VK  N +  LKG L+W G MN + VC ++L Q+HENG+NG FWR ++   R K  IAT   ++    P
Sbjct:  277 ICCTESTELLQQHPDLRIKSRIKVPNKENKHIGGSCEWIGLINGQEALGITMDNDVKGTNGIFSYFRMFTCEGGKGVLMLAENIFHDKESEKPQFIADKIVDINKIYSISPCEGENGIGIGKPIKINFNYPNGRNRDFIGEVKWTGRINDEKCVGLDMEEEMEHGMNGMIGKSQRFECMEKHGLVALLSDVELSENAENPQVLDSGMIAPNKFIRFQEERSKKYLDDKNIKMNEFVIVKQGNPELKLKGKLRWIGWMNKLLVCVIELDQDHENGSNGTFWRRQIVNSRGKRVIATSVNHVYKYEP 581          

HSP 3 Score: 78.5666 bits (192), Expect = 5.386e-14
Identity = 76/281 (27.05%), Postives = 118/281 (41.99%), Query Frame = 2
Query: 2621 QLKWKGLIDQKYCLGCVANFQCNFGTNGTFGQDKLFACEDKHGILIPLAAVSECCEMKGHKPIKWTRDGAIDENSICCTVEKNITKFQANCKLKNIKSNRKAIWK-------------WSGLVNDVEVIGVEMNESLEKGTDGNFCKIQLFRSVHKR------GALFKSEEFIISK--SELKHVKEINLNVVDPFNVREIENGRQINKLTCYKSKGAIKILNIKWRGI-VNGELCVGCELSGPVEWGTDGTFGNKIVFKCPARRGVLIPTEELIDSCETTA 3397
            ++KW G I+ + C+G     +   G NG  G+ + F C +KHG++  L+ V E  E   +  +     G I  N      E+   K+  +   KNIK N   I K             W G +N + V  +E+++  E G++G F + Q+  S  KR        ++K E ++I     E++  KEI +N    +              T Y+         +KW G+  N     G EL   +  GTDGTFG + +F C    GVL P   +      TA
Sbjct:  417 EVKWTGRINDEKCVGLDMEEEMEHGMNGMIGKSQRFECMEKHGLVALLSDV-ELSENAENPQV--LDSGMIAPNKFIRFQEERSKKYLDD---KNIKMNEFVIVKQGNPELKLKGKLRWIGWMNKLLVCVIELDQDHENGSNGTFWRRQIVNSRGKRVIATSVNHVYKYEPYVIKTIPEEIQIFKEIVINSAVKYYFL---------TATGYQDLFG----TVKWTGVDENDCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTA 678          

HSP 4 Score: 76.2554 bits (186), Expect = 2.193e-13
Identity = 75/293 (25.60%), Postives = 125/293 (42.66%), Query Frame = 2
Query:  446 IGKPKGASMNKYIAIQGKTKSFV-KLFWKGKINNINCLGCELPEFWSEGTEGTFGRYKLFTCSYGRGVLILINDAVKSCESAEESNHLPLADNDELTANNICCFEP------LDKLSKDIKVNSQVFCQQ----LKAGGKCKWMGLINGKGYVGIEFDEIHRRAERFNELSR-ILKIEGRIRFIPLECVENAKLH-FIFDKIVDTGKIFYVDCEEDRDYLGNFAAINLTTRDGKSKQFIGELKWIGKINNEKC--VGLDMEDETEFGMDGIINQDNRFDCMEKHGLITVLSNV 1279
            IGKP   + N      G+ + F+ ++ W G+IN+  C+G ++ E    G  G  G+ + F C    G++ L++D     E +E + +  + D+  +  N    F+       LD   K+IK+N  V  +Q    LK  GK +W+G +N      IE D+ H          R I+   G+ R I        K   ++   I +  +IF       ++ + N A           +   G +KW G ++   C   GL+++D    G DG       F C   HG++  L+NV
Sbjct:  396 IGKPIKINFN---YPNGRNRDFIGEVKWTGRINDEKCVGLDMEEEMEHGMNGMIGKSQRFECMEKHGLVALLSDV----ELSENAENPQVLDSGMIAPNKFIRFQEERSKKYLD--DKNIKMNEFVIVKQGNPELKLKGKLRWIGWMNKLLVCVIELDQDHENGSNGTFWRRQIVNSRGK-RVIATSVNHVYKYEPYVIKTIPEEIQIF-------KEIVINSAVKYYFLTATGYQDLFGTVKWTG-VDENDCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNV 670          

HSP 5 Score: 74.7146 bits (182), Expect = 8.066e-13
Identity = 95/399 (23.81%), Postives = 161/399 (40.35%), Query Frame = 2
Query: 2627 KWKGLIDQKYCLGCVANFQCNFGTNGTFGQDKLFACEDKHGILIPLAAVSECCEMKGHKPIKWTRDGAIDENSIC----CTVEKNI---TKFQANCKLKNIKSNRKAIW--KWSGLVNDVEVIGVEMNESLEKGTDGNFCKIQLFRSVHKRGALFKSEEFIISKSELKHVKE----INLNVVDPFNVREIENGR----------QINKLTCYKSKGAIKIL--NIKWRGIVNGELCVGCELSGPVEWGTDGTFGNKIVFKCPARRGVLIPTEELIDSCETTAHSKITTLPNSGWLWKGDTYFINPDCICCTESTESLQKHPDLRIKSRIK---VPNKENKQIGGSCEWIGLI-NGQEALGITMDNDVK-GTNGIFSYFRMFTCEGGKGVLMLAENIFHD 3733
            +W GLI+ +  LG   +     GTNG F   ++F CE   G+L+    +    + +  KP ++  D  +D N I     C  E  I      + N    N + NR  I   KW+G +ND + +G++M E +E G +G   K Q F  + K G +      ++S  EL    E    ++  ++ P      +  R          ++N+    K       L   ++W G +N  L    EL    E G++GTF  + +     +R +                           ++K + Y I           E +Q   ++ I S +K   +     + + G+ +W G+  N     G+ +D+ +  GT+G F   R+FTC+ G GVL    N+  D
Sbjct:  313 EWIGLINGQEALGITMDNDVK-GTNGIFSYFRMFTCEGGKGVLMLAENIFH--DKESEKP-QFIADKIVDINKIYSISPCEGENGIGIGKPIKINFNYPNGR-NRDFIGEVKWTGRINDEKCVGLDMEEEMEHGMNGMIGKSQRFECMEKHGLV-----ALLSDVELSENAENPQVLDSGMIAPNKFIRFQEERSKKYLDDKNIKMNEFVIVKQGNPELKLKGKLRWIGWMNKLLVCVIELDQDHENGSNGTFWRRQIVNSRGKRVIATSVNH---------------------VYKYEPYVIKT-------IPEEIQIFKEIVINSAVKYYFLTATGYQDLFGTVKWTGVDENDCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASD 673          

HSP 6 Score: 65.0846 bits (157), Expect = 6.578e-10
Identity = 89/382 (23.30%), Postives = 164/382 (42.93%), Query Frame = 2
Query:  524 WKGKINNINCLGCELPEFWSEGTEGTFGRYKLFTCSYGRGVLILINDAVKSCESAEESNHLP--LADNDELTANNICCFEPLDKLSKDIKVN-SQVFCQQLKAGGKCKWMGLINGKGYVGIEFDE--------IHRRAERFNELSRILKIEGRIRFIP-LECVENAKLHFIFDK-IVDTGKIFYVDCEEDRDYLGN----FAAINLTTRDGKSKQFIGELKWIGKINNEKCVGLDMEDETEFGMDGIINQDNRFDCMEKHGLITVLSNVNLYKYDNNVHLLPSGIINPDKYLRCKETFGDECIKAQRIKKDGMVNVKLL--NGQANLKGTLKWHGL-MNNVPVCAVQLLQEHENGTNGRFWRTRLFECRDKLAIATLTKNLS 1609
            W G IN    LG  +     +GT G F  +++FTC  G+GVL+L  +     ES E+   +   + D +++ + + C  E    + K IK+N +    +     G+ KW G IN +  VG++ +E        +  +++RF  + +     G +  +  +E  ENA+   + D  ++   K      E  + YL +         +  +     +  G+L+WIG +N      ++++ + E G +G   +    +   K  + T +++V  YKY+      P  I          +T  +E    + I  +  V    L   G  +L GT+KW G+  N+     ++L      GT+G F   RLF C++   +     N++
Sbjct:  314 WIGLINGQEALGITMDND-VKGTNGIFSYFRMFTCEGGKGVLMLAENIFHDKES-EKPQFIADKIVDINKIYSISPCEGENGIGIGKPIKINFNYPNGRNRDFIGEVKWTGRINDEKCVGLDMEEEMEHGMNGMIGKSQRFECMEK----HGLVALLSDVELSENAENPQVLDSGMIAPNKFIRFQEERSKKYLDDKNIKMNEFVIVKQGNPELKLKGKLRWIGWMNKLLVCVIELDQDHENGSNGTFWRRQIVNSRGKRVIATSVNHV--YKYE------PYVI----------KTIPEEIQIFKEIVINSAVKYYFLTATGYQDLFGTVKWTGVDENDCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVA 671          

HSP 7 Score: 62.7734 bits (151), Expect = 3.249e-9
Identity = 48/188 (25.53%), Postives = 86/188 (45.74%), Query Frame = 2
Query: 3227 KWRGIVNGELCVGCELSGPVEWGTDGTFGNKIVFKCPARRGVLIPTEELIDSCETTAHSKITTLPNSGWLWKGDTYFINPDCICCTESTESLQKHPDLRIKSRIKVPNKENKQIGGSCEWIGLINGQEALGITMDNDVK-GTNGIFSYFRMFTCEGGKGVLMLAENIFHDKESEKPQFIADKIVDINK 3787
            +W G++NG+  +G  +   V+ GT+G F    +F C   +GVL+  E +    E+     I        +     Y I+P   C  E+   + K     IK     PN  N+   G  +W G IN ++ +G+ M+ +++ G NG+    + F C    G++ L  ++   + +E PQ +   ++  NK
Sbjct:  313 EWIGLINGQEALGITMDNDVK-GTNGIFSYFRMFTCEGGKGVLMLAENIFHDKESEKPQFIA----DKIVDINKIYSISP---CEGENGIGIGK----PIKINFNYPNGRNRDFIGEVKWTGRINDEKCVGLDMEEEMEHGMNGMIGKSQRFECMEKHGLVALLSDVELSENAENPQVLDSGMIAPNK 488          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Planmine SMEST
Match: SMESG000056847.1 (SMESG000056847.1)

HSP 1 Score: 1495.33 bits (3870), Expect = 0.000e+0
Identity = 765/814 (93.98%), Postives = 780/814 (95.82%), Query Frame = 2
Query: 3227 KWRGIVNGELCVGCELSGPVEWGTDGTFGNKIVFKCPARRGVLIPTEELIDSCETTAHSKITTLPNSGWLWKG-DTYFINPDCICCTESTESLQKHPDLRIKSRIKVPNKENKQIGGSCEWIGLINGQEALGITMDNDVKGTNGIFSYFRMFTCEGGKGVLMLAENIFHDKESEKPQFIADKIVDINKIYSISPCXXXXXXXXXXXXXXXLNSPNGRNRDFIGEVKWTGRINDEKCVXXXXXXXXXXXXXXXXXKSRIFQCMEKHGLVALLSDVELSENAENPQILDSGMIAPNKFIRFQEERSKKYLDDKNIKMNEFVIVKQGNPELKLKGKLRWIGWMNKLLVCVIELDQDHENGSNGTFWRRQIVNSRGKRVIATSVNHVYKYEPYVIKTIPEEIQIFKEIVINSAVKYYFLTATGYQDLFGTVKWTGVDENDCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENVKKSETSDQIVCGLNSSVIAGDNKGIQGNANSCYFDSALFALFVKSDVLDYLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFLCSQHKCQHPACTKLLPDTVKSKSKVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFD 5665
            KW G+VN    +G E++  +E GTDG F    +F+   +RG L  +EE I S    AH KITTL +SGWLWKG DTYFINPDCICCTESTE LQ+HPDLRIKSRIKVPNKENK IGGSCEWIGLINGQEALGITMDNDVKGTNGIFSYFRMFTCEGGKGVLMLAENIFHDKESEKPQFIADKIVDINKIYSISPCEGENGIGIGKPIKIN N PNGRNRDFIGEVKWTGRINDEKCVGLDMEEEMEHGM+GMIGKS+ F+CMEKHGLVALLSDVELSENAENPQ+LDSGMIAPNKFIRFQEERSKKYLDDKNIKMNEFVIVKQGNPELKLKGKLRWIGWMNKLLVCVIELDQDHENGSNGTFWRRQIVNSRGKRVIATSVNHVYKYEPYVIKTIPEEIQIFKEIVINSAVKYYFLTATGYQDLFGTVKWTGVDENDCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENVKKSETSDQIVCGLNSSVIAGDNKGIQGNANSCYFDSALFALFVKSDVLDYLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFLCSQHKCQHPACTKLLPDTVKSKSKVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFD
Sbjct:  296 KWSGLVNDVEVIGVEMNESLEKGTDGNFCKIQLFRSVHKRGALFKSEEFIIS----AHLKITTLRDSGWLWKGGDTYFINPDCICCTESTELLQQHPDLRIKSRIKVPNKENKHIGGSCEWIGLINGQEALGITMDNDVKGTNGIFSYFRMFTCEGGKGVLMLAENIFHDKESEKPQFIADKIVDINKIYSISPCEGENGIGIGKPIKINFNYPNGRNRDFIGEVKWTGRINDEKCVGLDMEEEMEHGMNGMIGKSQRFECMEKHGLVALLSDVELSENAENPQVLDSGMIAPNKFIRFQEERSKKYLDDKNIKMNEFVIVKQGNPELKLKGKLRWIGWMNKLLVCVIELDQDHENGSNGTFWRRQIVNSRGKRVIATSVNHVYKYEPYVIKTIPEEIQIFKEIVINSAVKYYFLTATGYQDLFGTVKWTGVDENDCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENVKKSETSDQIVCGLNSSVIAGDNKGIQGNANSCYFDSALFALFVKSDVLDYLISPIINEQEADPITKEFREIIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVSTLLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFLCSQHKCQHPACTKLLPDTVKSKSKVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFD 1105          

HSP 2 Score: 249.21 bits (635), Expect = 5.910e-67
Identity = 155/355 (43.66%), Postives = 204/355 (57.46%), Query Frame = 2
Query: 2789 MKGHKPIKWTRDGAIDENSICCTVEKNITKFQANCKLKNIKSNRKAIWKWSGLVNDVEVIGVEMNESLEKGTDGNFCKIQLFRSVHKRGALFKSEEFIISKSELKHVKEINLN------------VVDPFNVREIENGRQINKLTCYKSKGAIKILN---------IKWRGIVNGELCVGCELSGPVEWGTDGTFGNKIVFKCPARRGVLIPTEELIDSCETTAHSKITTLPNSGWLWKGDTYFINPDCICCTESTESLQKHPDLRIKSRIKVPNKENKQIGGSCEWIGLINGQEALGITMDNDVK-GTNGIFSYFRMFTCEGGKGVLMLAENIFHDKESEKPQFIADKIVDINK 3787
            ++GHKPIKWTRDGAIDENSICCTVEKNITKFQANCKLKNIKSNRKAIWKWSGLVNDVEVIGVEMNESLEKGTDGNFCKIQLFRSVHKRGALFKSEEFIIS     H+K   L              ++P  +   E+   + +    + K  IK+ N          +W G++NG+  +G  +   V+ GT+G F    +F C   +GVL+  E +    E+     I        +     Y I+P   C  E+   + K     IK     PN  N+   G  +W G IN ++ +G+ M+ +++ G NG+    + F C    G++ L  ++   + +E PQ +   ++  NK
Sbjct:  248 VEGHKPIKWTRDGAIDENSICCTVEKNITKFQANCKLKNIKSNRKAIWKWSGLVNDVEVIGVEMNESLEKGTDGNFCKIQLFRSVHKRGALFKSEEFIIS----AHLKITTLRDSGWLWKGGDTYFINPDCICCTESTELLQQHPDLRIKSRIKVPNKENKHIGGSCEWIGLINGQEALGITMDNDVK-GTNGIFSYFRMFTCEGGKGVLMLAENIFHDKESEKPQFIA----DKIVDINKIYSISP---CEGENGIGIGK----PIKINFNYPNGRNRDFIGEVKWTGRINDEKCVGLDMEEEMEHGMNGMIGKSQRFECMEKHGLVALLSDVELSENAENPQVLDSGMIAPNK 586          

HSP 3 Score: 230.72 bits (587), Expect = 5.464e-61
Identity = 138/383 (36.03%), Postives = 211/383 (55.09%), Query Frame = 2
Query:  524 WKGKINNINCLGCELPEFWSEGTEGTFGRYKLFTCSYGRGVLI-----LINDAVKSCESAEESNHLPLADNDELTANNICCFEPLDKLSK--DIKVNSQVFC---QQLKAGGKCKWMGLINGKGYVGIEFDEIHRRAERFNELSRILKIEGRIRFIPL-----ECVENAKLHFIFDKIVDTGKIFYVD-CE-EDRDYLGNFAAINLTTRDGKSKQFIGELKWIGKINNEKCVGLDMEDETEFGMDGIINQDNRFDCMEKHGLITVLSNVNLYKYDNNVHLLPSGIINPDKYLRCKETFGDECIKAQRIKKDGMVNVKLLNGQANLKGTLKWHGLMNNVPVCAVQLLQEHENGTNGRFWRTRLFECRDKLAIATLTKNLSPSMP 1621
            W G +N++  +G E+ E   +GT+G F + +LF   + RG L      +I+  +K     +        D   +  + ICC E  + L +  D+++ S++     +    GG C+W+GLING+  +GI  D   +         R+   EG    + L        E+ K  FI DKIVD  KI+ +  CE E+   +G    IN    +G+++ FIGE+KW G+IN+EKCVGLDME+E E GM+G+I +  RF+CMEKHGL+ +LS+V L +   N  +L SG+I P+K++R +E    + +  + IK +  V VK  N +  LKG L+W G MN + VC ++L Q+HENG+NG FWR ++   R K  IAT   ++    P
Sbjct:  297 WSGLVNDVEVIGVEMNESLEKGTDGNFCKIQLFRSVHKRGALFKSEEFIISAHLKITTLRDSGWLWKGGDTYFINPDCICCTESTELLQQHPDLRIKSRIKVPNKENKHIGGSCEWIGLINGQEALGITMDNDVKGTNGIFSYFRMFTCEGGKGVLMLAENIFHDKESEKPQFIADKIVDINKIYSISPCEGENGIGIGKPIKINFNYPNGRNRDFIGEVKWTGRINDEKCVGLDMEEEMEHGMNGMIGKSQRFECMEKHGLVALLSDVELSENAENPQVLDSGMIAPNKFIRFQEERSKKYLDDKNIKMNEFVIVKQGNPELKLKGKLRWIGWMNKLLVCVIELDQDHENGSNGTFWRRQIVNSRGKRVIATSVNHVYKYEP 679          

HSP 4 Score: 94.3597 bits (233), Expect = 7.213e-19
Identity = 131/506 (25.89%), Postives = 212/506 (41.90%), Query Frame = 2
Query: 2627 KWKGLIDQKYCLGCVANFQCNFGTNGTFGQDKLFACEDKHGILIPLAAVSECCEMKGHKPIKWTRDGA----------IDENSICCTVEKNITKFQANCKLKN-IKSNRK------AIWKWSGLVNDVEVIGVEMNESLEKGTDGNFCKIQLFRSVHKRGALFKSEEFIISKSELKHV----KEINLNVVDPFNVREIENGRQINK-----LTCYKSKGAIKILNIKWRGIVNGELCVGCELSGPVEWGTDGTFGNKIVFKCPARRGVLIPTEELIDSCETTAHSKITTLPNSGWLWKGDTYFINPDCICCTESTESLQKHPDLRIKSR----IKVPNKENKQIGGSCEWIGLINGQEALGITMDNDVK-GTNGIFSYFRMFTCEGGKGVLMLAENIFHDKESEKPQFIADKIVDINKIYSISPCXXXXXXXXXXXXXXXLNSPNGRNRDFIGEVKWTGRINDEKC--VXXXXXXXXXXXXXXXXXKSRIFQCMEKHGLVALLSDV 4045
            KW GL++    +G   N     GT+G F + +LF    K G L      SE   +  H  I   RD            I+ + ICCT    + +   + ++K+ IK   K         +W GL+N  E +G+ M+  + KGT+G F   ++F     +G L  +E     K   K      K +++N +   +  E ENG  I K           +    I  +KW G +N E CVG ++   +E G +G  G    F+C  + G++     L+   E + +++   + +SG         I P+     +   S +   D  IK      +K  N E K + G   WIG +N      I +D D + G+NG F + R      GK V+  + N  +  E    + I ++I    +I   S  +       G              +D  G VKWTG +++  C   GL++++ +  G DG  G  R+F C   HG++A L++V
Sbjct:  296 KWSGLVNDVEVIGVEMNESLEKGTDGNFCKIQLFRSVHKRGALFK----SEEFIISAHLKITTLRDSGWLWKGGDTYFINPDCICCTESTELLQQHPDLRIKSRIKVPNKENKHIGGSCEWIGLINGQEALGITMDNDV-KGTNGIFSYFRMFTCEGGKGVLMLAENIFHDKESEKPQFIADKIVDINKIYSISPCEGENGIGIGKPIKINFNYPNGRNRDFIGEVKWTGRINDEKCVGLDMEEEMEHGMNGMIGKSQRFECMEKHGLV----ALLSDVELSENAENPQVLDSG--------MIAPNKFIRFQEERSKKYLDDKNIKMNEFVIVKQGNPELK-LKGKLRWIGWMNKLLVCVIELDQDHENGSNGTF-WRRQIVNSRGKRVIATSVNHVYKYEPYVIKTIPEEIQIFKEIVINSAVKYYFLTATGY-------------QDLFGTVKWTG-VDENDCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNV 768          

HSP 5 Score: 77.411 bits (189), Expect = 1.010e-13
Identity = 76/281 (27.05%), Postives = 118/281 (41.99%), Query Frame = 2
Query: 2621 QLKWKGLIDQKYCLGCVANFQCNFGTNGTFGQDKLFACEDKHGILIPLAAVSECCEMKGHKPIKWTRDGAIDENSICCTVEKNITKFQANCKLKNIKSNRKAIWK-------------WSGLVNDVEVIGVEMNESLEKGTDGNFCKIQLFRSVHKR------GALFKSEEFIISK--SELKHVKEINLNVVDPFNVREIENGRQINKLTCYKSKGAIKILNIKWRGI-VNGELCVGCELSGPVEWGTDGTFGNKIVFKCPARRGVLIPTEELIDSCETTA 3397
            ++KW G I+ + C+G     +   G NG  G+ + F C +KHG++  L+ V E  E   +  +     G I  N      E+   K+  +   KNIK N   I K             W G +N + V  +E+++  E G++G F + Q+  S  KR        ++K E ++I     E++  KEI +N    +              T Y+         +KW G+  N     G EL   +  GTDGTFG + +F C    GVL P   +      TA
Sbjct:  515 EVKWTGRINDEKCVGLDMEEEMEHGMNGMIGKSQRFECMEKHGLVALLSDV-ELSENAENPQV--LDSGMIAPNKFIRFQEERSKKYLDD---KNIKMNEFVIVKQGNPELKLKGKLRWIGWMNKLLVCVIELDQDHENGSNGTFWRRQIVNSRGKRVIATSVNHVYKYEPYVIKTIPEEIQIFKEIVINSAVKYYFL---------TATGYQDLFG----TVKWTGVDENDCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTA 776          

HSP 6 Score: 70.0922 bits (170), Expect = 1.954e-11
Identity = 75/330 (22.73%), Postives = 146/330 (44.24%), Query Frame = 2
Query:  701 HLPL--ADNDELTANNICCFEPLDKLSKDI-KVNSQVFCQQLKAGGKC--KWMGLINGKGYVGIEFDEIHRRAERFN----ELSRILKIEGRIRFIPLECVENAKLHFIFDKIVDTGKI------FYVD-----CEEDRDYLGNFAAINLTTR----DGKSKQFIGELKWIGKINNEKCVGLDMEDETEFGMDGIINQDNRFDCMEKHGLITVLSNVNLYKYDNNVHLLPSGIINPDKYLRCKETFGDECIKAQRIKKDGMVNVKLLNGQ-ANLKGTLKWHGLMNNVPVCAVQLLQEHENGTNGRFWRTRLFECRDKLAIATLTKNLSPS 1615
            H P+    +  +  N+ICC      + K+I K  +    + +K+  K   KW GL+N    +G+E +E   +    N    +L R +   G + F   E + +A  H     + D+G +      ++++     C E  + L     + + +R    + ++K   G  +WIG IN ++ +G+ M+++ + G +GI +    F C    G++ +  N+   K       +   I++ +K        G+  I    I K   +N    NG+  +  G +KW G +N+     + + +E E+G NG   +++ FEC +K  +  L  ++  S
Sbjct:  251 HKPIKWTRDGAIDENSICC-----TVEKNITKFQANCKLKNIKSNRKAIWKWSGLVNDVEVIGVEMNESLEKGTDGNFCKIQLFRSVHKRGAL-FKSEEFIISA--HLKITTLRDSGWLWKGGDTYFINPDCICCTESTELLQQHPDLRIKSRIKVPNKENKHIGGSCEWIGLINGQEALGITMDNDVK-GTNGIFSYFRMFTCEGGKGVLMLAENIFHDKESEKPQFIADKIVDINKIYSISPCEGENGIG---IGKPIKINFNYPNGRNRDFIGEVKWTGRINDEKCVGLDMEEEMEHGMNGMIGKSQRFECMEKHGLVALLSDVELS 568          

HSP 7 Score: 64.6994 bits (156), Expect = 7.906e-10
Identity = 88/381 (23.10%), Postives = 164/381 (43.04%), Query Frame = 2
Query:  524 WKGKINNINCLGCELPEFWSEGTEGTFGRYKLFTCSYGRGVLILINDAVKSCESAEESNHLP--LADNDELTANNICCFEPLDKLSKDIKVN-SQVFCQQLKAGGKCKWMGLINGKGYVGIEFDE--------IHRRAERFNELSRILKIEGRIRFIP-LECVENAKLHFIFDK-IVDTGKIFYVDCEEDRDYLGN----FAAINLTTRDGKSKQFIGELKWIGKINNEKCVGLDMEDETEFGMDGIINQDNRFDCMEKHGLITVLSNVNLYKYDNNVHLLPSGIIN-PDKYLRCKETFGDECIKAQRIKKDGMVNVKLLNGQANLKGTLKWHGL-MNNVPVCAVQLLQEHENGTNGRFWRTRLFECRDKLAIATLTKNLS 1609
            W G IN    LG  +     +GT G F  +++FTC  G+GVL+L  +     ES E+   +   + D +++ + + C  E    + K IK+N +    +     G+ KW G IN +  VG++ +E        +  +++RF  + +     G +  +  +E  ENA+   + D  ++   K      E  + YL +         +  +     +  G+L+WIG +N      ++++ + E G +G   +    +   K  + T +++V  YKY+      P  I   P++    KE   +  +K   +            G  +L GT+KW G+  N+     ++L      GT+G F   RLF C++   +     N++
Sbjct:  412 WIGLINGQEALGITMDND-VKGTNGIFSYFRMFTCEGGKGVLMLAENIFHDKES-EKPQFIADKIVDINKIYSISPCEGENGIGIGKPIKINFNYPNGRNRDFIGEVKWTGRINDEKCVGLDMEEEMEHGMNGMIGKSQRFECMEK----HGLVALLSDVELSENAENPQVLDSGMIAPNKFIRFQEERSKKYLDDKNIKMNEFVIVKQGNPELKLKGKLRWIGWMNKLLVCVIELDQDHENGSNGTFWRRQIVNSRGKRVIATSVNHV--YKYE------PYVIKTIPEEIQIFKEIVINSAVKYYFLTA---------TGYQDLFGTVKWTGVDENDCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVA 769          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Planmine SMEST
Match: SMESG000056845.1 (SMESG000056845.1)

HSP 1 Score: 1291.17 bits (3340), Expect = 0.000e+0
Identity = 626/663 (94.42%), Postives = 640/663 (96.53%), Query Frame = 2
Query:  374 KSVLPTIYCNKLGMDVIKPGAIDQIGKPKGASMNKYIAIQGKTKSFVKLFWKGKINNINCLGCELPEFWSEGTEGTFGRYKLFTCSYGRGVLILINDAVKSCESAEESNHLPLADNDELTANNICCFEPLDKLSKDIKVNSQVFCQQLKAGGKCKWMGLINGKGYVGIEFDEIHRRAERFNELSRILKIEGRIRFIPLECVENAKLHFIFDKIVDTGKIFYVDCEEDRDYLGNFAAINLTTRDGKSKQFIGELKWIGKINNEKCVGLDMEDETEFGMDGIINQDNRFDCMEKHGLITVLSNVNLYKYDNNVHLLPSGIINPDKYLRCKETFGDECIKAQRIKKDGMVNVKLLNGQANLKGTLKWHGLMNNVPVCAVQLLQEHENGTNGRFWRTRLFECRDKLAIATLTKNLSPSMPIDFIKDIFVEKNQKEFSRGSVRTDDIYHVGQFVKILPFDLFGQIECFHVVYEEMFVQIQLTKDQIKRLPFHQRIDRAAGNAIYSTVILLKDSIAKCSENLEFFNESSLINKECIEYRIPRPMETFRTGDLIKAGKTGNVKYFIVNNRFIINGISCLSVMESILGEAEEYLPESEAMKVDNSELEMKYFQGVFIDPKSIRSFEKCEINDFCIGNRVEFMSMDRKSSYNGRIKSTGIANKTIPSCVVQM 2362
            +SVLPTIYCNKLGMDVIKPGAIDQIGKPKGASMNKYIAIQGKTKSFVKLFWKGKINNINCLGCELPE+W EGTEGTFGR+KLFTCSY RGVLI INDAVKSCESA+ESN LPL DNDELT NNICCFEPL+KLS DI+VNS+VFCQQLKAGGKCKWMGLINGKGYVGIEFDEIHRRAERFNELSRILKIEGRIRFIPLECVENAKLHFIFDKIVDTGKIFYVDCEEDRDYLGNF AINLTTRDGKSKQFIGELKWIGKINNEKCVGLDMEDE EF MDGIINQDNRFDCMEKHGLITVLSN+N+      + +    IINPDKYLRCKETFGDECIKAQRIKKDGMVNVKLLNGQANLKGTLKW+GLMNNVPVCAVQLLQEHENGTNGRFWRTRLFECRDKLAIATLT+NLSPSMPIDFIKDIFVEKNQKEFSRGSVRT DIYHVGQFVKILPFDLFGQIECFHVVYEEMFVQ+QLTKDQIKRLPFHQRIDRAA NAIYSTVILLKDSIAKCSENLEFFNESSLINKECIEYRIPRPMETFRTGDLIKAGKTGNVKYFIVNNRFIINGISCLSVMESILGEAEEYLPESEAMKVDNSELEMKYFQGVFIDPKSIRSFEKCEINDFCIGNRVEFMSMDRKSSYNGRIKSTGIANKTIPSCVVQM
Sbjct:  410 QSVLPTIYCNKLGMDVIKPGAIDQIGKPKGASMNKYIAIQGKTKSFVKLFWKGKINNINCLGCELPEYWREGTEGTFGRHKLFTCSYSRGVLIPINDAVKSCESADESNDLPLTDNDELTENNICCFEPLEKLSNDIEVNSRVFCQQLKAGGKCKWMGLINGKGYVGIEFDEIHRRAERFNELSRILKIEGRIRFIPLECVENAKLHFIFDKIVDTGKIFYVDCEEDRDYLGNFGAINLTTRDGKSKQFIGELKWIGKINNEKCVGLDMEDEMEFTMDGIINQDNRFDCMEKHGLITVLSNINM----TIMFICYLWIINPDKYLRCKETFGDECIKAQRIKKDGMVNVKLLNGQANLKGTLKWYGLMNNVPVCAVQLLQEHENGTNGRFWRTRLFECRDKLAIATLTQNLSPSMPIDFIKDIFVEKNQKEFSRGSVRTGDIYHVGQFVKILPFDLFGQIECFHVVYEEMFVQVQLTKDQIKRLPFHQRIDRAASNAIYSTVILLKDSIAKCSENLEFFNESSLINKECIEYRIPRPMETFRTGDLIKAGKTGNVKYFIVNNRFIINGISCLSVMESILGEAEEYLPESEAMKVDNSELEMKYFQGVFIDPKSIRSFEKCEINDFCIGNRVEFMSMDRKSSYNGRIKSTGIANKTIPSCVVQM 1068          

HSP 2 Score: 257.299 bits (656), Expect = 8.947e-69
Identity = 155/327 (47.40%), Postives = 196/327 (59.94%), Query Frame = 2
Query:  569 PEFWSEGTEGTFGRYKLFTCSYGRGVLILINDAVKSCESAEESNHLPLADNDELTANNICCFEPLDKLSKDIKVNSQVFCQQLKAGGKCKWMGLINGKGYVGIEFDEIHRRAERF-NELSRILKIEGRIRFIPLECV-ENAKLHFIFDKIVDTGKIFYVDCEEDRDYLGNFAAINLTTRDGKSKQFIGELKWIGKINNEKCVGLDMEDETEFGMDGIINQDNRFDCMEKHG-LITVLSNVNLYKYDNNVHLLPSGIINPDKYLR----CKETFGDECIKAQRIKKDGMVNVKLLNGQANLKGTLKWHGLMNNVPVCAVQLLQEHENG 1528
            PEFWSEGTEGTFGRYKLFTCSY +GVLI INDAVKSCESA+ESNHLPLADNDELTANNICCFEPLDKLSKDIKVNS+VFCQQLKAGGKC WMGLINGKGYVGIEFDEI        N +S ILKI+G+IR IP++ V      + +   ++  G I  +   +    +  + AI      GK+K F+ +L W GKINN  C+G ++ +    G +G   +   F C    G LI +   V   +  +  + LP  + + D+       C E         +++  D  VN ++   Q    G  KW GL+N      ++  + H   
Sbjct:  276 PEFWSEGTEGTFGRYKLFTCSYDKGVLIPINDAVKSCESADESNHLPLADNDELTANNICCFEPLDKLSKDIKVNSRVFCQQLKAGGKCNWMGLINGKGYVGIEFDEIIPDGNSTQNSISEILKIQGQIRMIPVQSVLPTIYCNKLGMDVIKPGAIDQIGKPKGAS-MNKYIAIQ-----GKTKSFV-KLFWKGKINNINCLGCELPEYWREGTEGTFGRHKLFTCSYSRGVLIPINDAVKSCESADESNDLP--LTDNDELTENNICCFEPL-------EKLSNDIEVNSRVFCQQLKAGGKCKWMGLINGKGYVGIEFDEIHRRA 586          

HSP 3 Score: 238.039 bits (606), Expect = 7.383e-63
Identity = 196/584 (33.56%), Postives = 297/584 (50.86%), Query Frame = 2
Query: 2693 GTNGTFGQDKLFACEDKHGILIPLAAVSECCEM---KGHKPIKWTRDGAIDENSICCTVEKNITKFQANCKL-KNIKSNRKAIWK---------WSGLVNDVEVIGVEMNESLEKGTDGNFCKIQLFRSVHKRGALFKSEEFIISKSELK--HVKEINLNVVDPFNVREI--ENGRQINKLTCY--KSKGAIKILNIKWRGIVNGELCVGCELSGPVEWGTDGTFGNKIVFKCPARRGVLIPTEELIDSCETTAHSKITTLPNSGWLWKGDTYFINPDCICCTESTESLQKHPDLRIKSRIKVPNKENKQIGGSCEWIGLINGQEALGITMDNDVKGTNGIFSYFRMFTCEGGKGVLMLAENIFHDKESEKPQFIADKIVDINKIYSISPCXXXXXXXXXXXXXXXLNSPNGRNRDFIGEVKWTGRINDEKCVXXXXXXXXXXXXXXXXXKSRIFQCMEKHGLVALLSDVELSENAENPQILDSGMIAPNKFIRFQEERSKKYLDDKNIKMNEFVIVKQGNPELKLKGKLRWIGWMNKLLVCVIELDQDHENGSNGTFWRRQIVNSRGKRVIATSVNHVYKYEP 4387
            GT GTFG+ KLF C    G+LIP+    + CE      H P+    +  +  N+ICC        F+   KL K+IK N +   +         W GL+N    +G+E +E +    DGN  +  +   +  +G +      I  +S L   +  ++ ++V+ P  + +I    G  +NK      K+K  +K+    W+G +N   C+GCEL      GT+GTFG   +F C   RGVLIP  + + SCE+   S    L ++  L + +        ICC E  E L    D+ + SR+     +  + GG C+W+GLING+  +GI  D   +         R+   EG    + L        E+ K  FI DKIVD  KI+ +     E+   +G    INL + +G+++ FIGE+KW G+IN+EKCVGLDME+EME  MDG+I +   F CMEKHGL+ +LS++ ++       I    +I P+K++R +E    + +  + IK +  V VK  N +  LKG L+W G MN + VC ++L Q+HENG+NG FWR ++   R K  IAT   ++    P
Sbjct:  282 GTEGTFGRYKLFTCSYDKGVLIPINDAVKSCESADESNHLPL--ADNDELTANNICC--------FEPLDKLSKDIKVNSRVFCQQLKAGGKCNWMGLINGKGYVGIEFDEII---PDGNSTQNSISEILKIQGQI----RMIPVQSVLPTIYCNKLGMDVIKPGAIDQIGKPKGASMNKYIAIQGKTKSFVKLF---WKGKINNINCLGCELPEYWREGTEGTFGRHKLFTCSYSRGVLIPINDAVKSCESADESNDLPLTDNDELTENN--------ICCFEPLEKLSN--DIEVNSRVFC---QQLKAGGKCKWMGLINGKGYVGIEFDEIHRRAERFNELSRILKIEGRIRFIPL-----ECVENAKLHFIFDKIVDTGKIFYVD--CEEDRDYLGNFGAINLTTRDGKSKQFIGELKWIGKINNEKCVGLDMEDEMEFTMDGIINQDNRFDCMEKHGLITVLSNINMTIMF----ICYLWIINPDKYLRCKETFGDECIKAQRIKKDGMVNVKLLNGQANLKGTLKWYGLMNNVPVCAVQLLQEHENGTNGRFWRTRLFECRDKLAIATLTQNLSPSMP 821          

HSP 4 Score: 102.449 bits (254), Expect = 2.962e-21
Identity = 117/441 (26.53%), Postives = 185/441 (41.95%), Query Frame = 2
Query: 2516 GIPVIDPEFI-RIIEGVAVEPGKFIVFTCNNQRHSVQLKWKGLIDQKYCLGCVANFQCNFGTNGTFGQDKLFACEDKHGILIPL-AAVSECCEMKGHKPIKWTRDGAIDENSICC--TVEKNITKFQANCKL--KNIKSNRKAIWKWSGLVNDVEVIGVEMNESLEKGTDGNFCKIQLFRSVHKRGALFKSEEFIISKSELKHVKEINLNVVDPFNVREIENGRQIN-----KLTCYKSKGAIKILNIKWRGIVNGELCVGCELSGPVEWGTDGTFGNKIVFKCPARRGVLIPTEELIDSCETTAHSKIT-TLPNSGWLWKGDTYFINPDCICCTESTESLQKHPDLRIKS----RIKVPNKENKQIGGSCEWIGLINGQEALGITMDNDVK-GTNGIFSYFRMFTCEGGKGVLMLAENIFHDKESEKPQFIADKIVDINK 3787
            G+ VI P  I +I +       K+I       +  V+L WKG I+   CLGC        GT GTFG+ KLF C    G+LIP+  AV  C        +  T +  + EN+ICC   +EK     + N ++  + +K+  K   KW GL+N    +G+E +E   +    N    +L R +   G +       +  ++L  + +  ++    F V   E+   +       LT    K    I  +KW G +N E CVG ++   +E+  DG       F C  + G++            T  S I  T+    +LW      INPD     + T   +     RIK      +K+ N +   + G+ +W GL+N      + +  + + GTNG F   R+F C     +  L +N+     S    FI D  V+ N+
Sbjct:  422 GMDVIKPGAIDQIGKPKGASMNKYIAIQ-GKTKSFVKLFWKGKINNINCLGCELPEYWREGTEGTFGRHKLFTCSYSRGVLIPINDAVKSCESADESNDLPLTDNDELTENNICCFEPLEKLSNDIEVNSRVFCQQLKAGGKC--KWMGLINGKGYVGIEFDEIHRRAERFN----ELSRILKIEGRIRFIPLECVENAKLHFIFDKIVDTGKIFYVDCEEDRDYLGNFGAINLTTRDGKSKQFIGELKWIGKINNEKCVGLDMEDEMEFTMDGIINQDNRFDCMEKHGLI------------TVLSNINMTIMFICYLW-----IINPDKYLRCKETFGDECIKAQRIKKDGMVNVKLLNGQ-ANLKGTLKWYGLMNNVPVCAVQLLQEHENGTNGRFWRTRLFECRDKLAIATLTQNL---SPSMPIDFIKDIFVEKNQ 834          

HSP 5 Score: 52.373 bits (124), Expect = 5.427e-6
Identity = 64/236 (27.12%), Postives = 106/236 (44.92%), Query Frame = 2
Query: 3986 KSRIFQCMEKHGLVALLSDV----ELSENAENPQILDSGMIAPNKFIRFQEERSKKYLD--DKNIKMNEFVIVKQGNPELKLKGKLRWIGWMNKLLVCVIELDQDHENGSNGTFWRRQIVNSRGK-RVIATS--VNHVY--KYEPYVIKTIPEEIQIFKEIVINSAVKYYFLTATGYQDLFGTVKWTG-VDENDCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVA 4657
            + ++F C    G++  ++D     E ++ + +  + D+  +  N    F+       LD   K+IK+N  V  +Q    LK  GK  W+G +N      IE D+   +G++      +I+  +G+ R+I     +  +Y  K    VIK  P  I    +    S  KY  +   G    F  + W G ++  +C   G EL +    GT+GTFG  +LFTC    GVL P+N+  
Sbjct:  289 RYKLFTCSYDKGVLIPINDAVKSCESADESNHLPLADNDELTANNICCFEP------LDKLSKDIKVNSRVFCQQ----LKAGGKCNWMGLINGKGYVGIEFDEIIPDGNSTQNSISEILKIQGQIRMIPVQSVLPTIYCNKLGMDVIK--PGAIDQIGKPKGASMNKY--IAIQGKTKSFVKLFWKGKINNINC--LGCELPEYWREGTEGTFGRHKLFTCSYSRGVLIPINDAV 508          
The following BLAST results are available for this feature:
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CYLD8.840e-4027.47CYLD lysine 63 deubiquitinase [Source:HGNC Symbol;... [more]
CYLD8.840e-4027.47CYLD lysine 63 deubiquitinase [Source:HGNC Symbol;... [more]
CYLD9.541e-4027.47CYLD lysine 63 deubiquitinase [Source:HGNC Symbol;... [more]
CYLD9.541e-4027.47CYLD lysine 63 deubiquitinase [Source:HGNC Symbol;... [more]
CYLD9.541e-4027.47CYLD lysine 63 deubiquitinase [Source:HGNC Symbol;... [more]
back to top
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cyld-11.832e-3026.78CYLinDromatosis (Human disease gene) homolog [Sou... [more]
cyld-12.207e-3026.78CYLinDromatosis (Human disease gene) homolog [Sou... [more]
cyld-13.705e-3026.78CYLinDromatosis (Human disease gene) homolog [Sou... [more]
back to top
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CYLD1.291e-4727.73gene:FBgn0032210 transcript:FBtr0080070[more]
CYLD1.291e-4727.73gene:FBgn0032210 transcript:FBtr0080071[more]
CYLD6.432e-4628.57gene:FBgn0032210 transcript:FBtr0080072[more]
back to top
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cylda7.533e-4227.44cylindromatosis (turban tumor syndrome), a [Source... [more]
cylda9.359e-4227.44cylindromatosis (turban tumor syndrome), a [Source... [more]
cylda9.359e-4227.44cylindromatosis (turban tumor syndrome), a [Source... [more]
cyldb1.251e-4127.40cylindromatosis (turban tumor syndrome), b [Source... [more]
cyldb5.651e-3928.57cylindromatosis (turban tumor syndrome), b [Source... [more]
back to top
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tril2.296e-3826.91TLR4 interactor with leucine-rich repeats [Source:... [more]
tril3.407e-3826.91TLR4 interactor with leucine-rich repeats [Source:... [more]
tril3.557e-3826.91TLR4 interactor with leucine-rich repeats [Source:... [more]
tril1.600e-3027.37TLR4 interactor with leucine-rich repeats [Source:... [more]
tril2.067e-3026.05TLR4 interactor with leucine-rich repeats [Source:... [more]
back to top
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cyld9.716e-4027.22CYLD lysine 63 deubiquitinase [Source:MGI Symbol;A... [more]
Cyld9.716e-4027.22CYLD lysine 63 deubiquitinase [Source:MGI Symbol;A... [more]
Cyld9.716e-4027.22CYLD lysine 63 deubiquitinase [Source:MGI Symbol;A... [more]
Cyld1.089e-3927.22CYLD lysine 63 deubiquitinase [Source:MGI Symbol;A... [more]
Cyld1.387e-3927.22CYLD lysine 63 deubiquitinase [Source:MGI Symbol;A... [more]
back to top
BLAST of Cylindromatosis (turban tumor syndrome), b vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q1RMU2|CYLD_BOVIN1.189e-3927.68Ubiquitin carboxyl-terminal hydrolase CYLD OS=Bos ... [more]
sp|Q9NQC7|CYLD_HUMAN4.245e-3927.47Ubiquitin carboxyl-terminal hydrolase CYLD OS=Homo... [more]
sp|Q5RED8|CYLD_PONAB4.433e-3927.47Ubiquitin carboxyl-terminal hydrolase CYLD OS=Pong... [more]
sp|Q80TQ2|CYLD_MOUSE6.797e-3927.22Ubiquitin carboxyl-terminal hydrolase CYLD OS=Mus ... [more]
sp|Q66H62|CYLD_RAT1.033e-3827.47Ubiquitin carboxyl-terminal hydrolase CYLD OS=Ratt... [more]
back to top
BLAST of Cylindromatosis (turban tumor syndrome), b vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7NIT47.155e-4828.13Uncharacterized protein OS=Pomacea canaliculata OX... [more]
H3A9I51.548e-4628.49Uncharacterized protein OS=Latimeria chalumnae OX=... [more]
A0A1S3P2U83.999e-4627.77ubiquitin carboxyl-terminal hydrolase CYLD-like is... [more]
A0A1S3P2Y04.913e-4627.77ubiquitin carboxyl-terminal hydrolase CYLD-like is... [more]
A0A1S3P3389.363e-4627.80ubiquitin carboxyl-terminal hydrolase CYLD-like is... [more]
back to top
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cylda1.985e-4026.83CYLD lysine 63 deubiquitinase [Source:NCBI gene;Ac... [more]
cylda2.129e-4026.83CYLD lysine 63 deubiquitinase [Source:NCBI gene;Ac... [more]
cylda2.129e-4026.83CYLD lysine 63 deubiquitinase [Source:NCBI gene;Ac... [more]
cyldl1.814e-3726.67cylindromatosis (turban tumor syndrome), like [Sou... [more]
ENSAMXT00000022455.23.433e-3525.96pep primary_assembly:Astyanax_mexicanus-2.0:21:172... [more]
back to top
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000000692.11.265e-1931.05pep scaffold:Pmarinus_7.0:GL491130:1075:4385:-1 ge... [more]
back to top
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO472957.088e-4027.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyldb6.068e-4127.46ubiquitin carboxyl-terminal hydrolase CYLD [Source... [more]
ENSORLT00000011257.23.592e-4027.10ubiquitin carboxyl-terminal hydrolase CYLD [Source... [more]
ENSORLT00000045278.13.743e-4027.10ubiquitin carboxyl-terminal hydrolase CYLD [Source... [more]
ENSORLT00000041324.13.743e-4027.10ubiquitin carboxyl-terminal hydrolase CYLD [Source... [more]
cylda5.585e-4026.42CYLD lysine 63 deubiquitinase [Source:NCBI gene;Ac... [more]
back to top
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000007087.10.000e+097.10SMESG000007087.1[more]
SMESG000056847.17.807e-6791.35SMESG000056847.1[more]
SMESG000056847.13.979e-5494.22SMESG000056847.1[more]
SMESG000056847.15.910e-6793.98SMESG000056847.1[more]
SMESG000056845.18.947e-6994.42SMESG000056845.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035733 ID=SMED30035733|Name=Cylindromatosis (turban tumor syndrome), b|organism=Schmidtea mediterranea sexual|type=transcript|length=5967bp
CACCAATTCACTATAAAATCCAAATTCTGTTAATTTTTATAAAAATCCAC
ATATTAAAGGGAAATAAAATTGCAATTTATGAATTGTCGCATTGAATCTG
CAAAATGATTGGATGATAAAATTCATTTGAACGCTTTTTGAAAGCGAATA
GCCAATTGAATTCATATTTGGTGTAATAAATTTATTTCTGTCAGTTTTAA
TTTTATATAATCTAAATATTTGCTTTTAAATATAATATATTACCATTATT
ATAATTATATTTATGCATTCAGATAAATCCGAAGATAACAGCATTAAAGC
GGTTTCAAATATCGACAGACAAAACAGCGCCACTAGTAGAACATCAAACG
ATTCCAGAGATTACATGGCCAATAAATCGGTTTTGCCGACAATTTATTGT
AATAAACTCGGAATGGATGTTATAAAACCAGGCGCAATTGATCAGATTGG
GAAACCGAAAGGTGCTTCAATGAATAAATATATTGCAATTCAAGGGAAAA
CAAAATCATTTGTCAAATTGTTCTGGAAAGGTAAAATCAACAATATAAAT
TGCCTCGGATGCGAGCTGCCTGAATTCTGGTCAGAGGGAACTGAAGGAAC
TTTCGGAAGGTACAAATTGTTTACTTGTTCATACGGTAGAGGCGTTCTGA
TTCTGATTAATGATGCGGTAAAATCATGCGAATCAGCTGAGGAATCAAAT
CATTTGCCATTGGCTGATAATGATGAGTTGACAGCGAATAATATCTGTTG
CTTTGAACCCTTGGACAAGTTATCTAAGGATATTAAAGTGAATAGTCAGG
TATTTTGTCAGCAATTAAAAGCCGGAGGGAAATGCAAATGGATGGGATTA
ATCAATGGGAAAGGTTATGTTGGGATAGAATTTGATGAAATTCATCGTAG
AGCCGAGAGATTCAATGAGTTATCAAGAATATTAAAGATAGAAGGCCGAA
TCCGGTTTATTCCACTCGAATGTGTTGAAAATGCAAAGCTGCATTTTATA
TTTGACAAAATTGTGGACACTGGCAAAATATTTTATGTTGATTGTGAAGA
AGATAGAGACTATCTAGGAAATTTTGCGGCAATTAATTTGACTACGAGGG
ATGGCAAATCCAAGCAATTTATCGGGGAATTGAAATGGATTGGAAAGATA
AATAATGAGAAATGCGTTGGCCTTGATATGGAAGATGAAACGGAGTTTGG
AATGGACGGGATTATTAATCAGGATAACCGATTTGACTGCATGGAGAAAC
ACGGATTGATCACAGTTTTGTCTAATGTCAATTTATATAAATATGACAAT
AATGTTCATTTGTTGCCCTCTGGAATCATAAATCCGGATAAATATTTGAG
ATGCAAAGAGACATTCGGTGATGAATGCATAAAAGCGCAACGAATAAAGA
AAGATGGAATGGTAAATGTGAAACTGTTAAATGGACAAGCAAATCTGAAA
GGGACATTAAAATGGCACGGCTTAATGAATAATGTCCCAGTCTGTGCTGT
GCAATTGTTGCAAGAGCATGAAAATGGAACAAATGGCCGATTTTGGAGGA
CGCGATTGTTTGAATGCAGGGATAAACTGGCAATTGCCACTCTGACAAAG
AATTTATCTCCAAGCATGCCAATTGATTTCATTAAGGATATATTTGTGGA
GAAAAATCAGAAAGAATTCTCTAGAGGTTCTGTTCGAACTGATGACATTT
ATCATGTCGGCCAATTTGTCAAAATTTTGCCTTTTGACCTATTTGGCCAG
ATTGAATGTTTTCACGTCGTATACGAGGAAATGTTTGTGCAAATTCAGTT
AACCAAGGATCAAATCAAAAGATTGCCATTTCATCAGAGAATTGACCGAG
CGGCTGGCAATGCAATTTATTCGACAGTTATTTTACTAAAAGATTCCATT
GCCAAATGCTCAGAAAATCTCGAATTCTTCAATGAATCTTCACTAATAAA
CAAGGAATGCATCGAATATCGGATTCCACGTCCAATGGAAACGTTTCGAA
CGGGAGATCTCATTAAAGCGGGAAAAACTGGAAATGTGAAATATTTCATT
GTTAACAACCGTTTCATCATAAACGGAATTTCCTGTTTATCTGTTATGGA
GTCCATTCTGGGGGAGGCCGAGGAATATTTACCGGAATCGGAGGCAATGA
AAGTTGATAATTCAGAATTGGAAATGAAATATTTTCAAGGAGTTTTTATT
GACCCGAAATCGATTCGGTCATTTGAAAAGTGTGAAATTAATGATTTCTG
CATTGGAAATCGTGTTGAATTCATGTCGATGGACCGCAAATCCTCCTACA
ATGGGAGAATCAAAAGCACTGGAATAGCCAATAAAACGATCCCTTCTTGT
GTTGTTCAAATGCCCCCCTCAGAGCCAATAGTTAATAGAAGCTTATTGCA
ATATACACTAAATGAGAATTTAGAGTTTAAAATTTTATCCGGCACAGCAA
ATGATTTTTTATTTTTGATTCGGGCAAATTTATTAAGGAAATCGGAGCTG
CCTGAAACAGTGAATGGCATTCCAGTAATCGACCCAGAATTTATCAGAAT
CATAGAAGGAGTAGCGGTGGAGCCAGGCAAATTTATAGTTTTCACGTGCA
ACAATCAAAGGCATTCTGTCCAATTGAAATGGAAAGGCCTGATTGATCAG
AAATATTGCTTGGGCTGTGTAGCTAACTTTCAATGCAATTTCGGAACAAA
TGGAACATTTGGGCAAGATAAATTATTTGCCTGTGAGGATAAGCATGGAA
TCCTGATACCATTGGCTGCAGTGAGCGAATGCTGTGAAATGAAAGGACAT
AAACCTATCAAATGGACAAGAGATGGCGCAATAGATGAAAATAGTATTTG
TTGTACAGTGGAGAAGAACATCACAAAGTTTCAAGCTAATTGCAAATTAA
AGAACATTAAATCCAACAGAAAAGCCATTTGGAAATGGAGCGGCCTTGTT
AATGATGTCGAAGTTATTGGAGTTGAAATGAACGAGTCTTTAGAAAAAGG
AACAGATGGGAATTTCTGTAAAATACAATTATTCCGATCTGTGCATAAGC
GTGGAGCATTATTTAAATCGGAAGAATTCATAATTTCTAAATCTGAATTG
AAACACGTCAAAGAAATTAATTTAAATGTTGTTGATCCCTTTAATGTTCG
GGAGATAGAAAATGGACGCCAGATTAATAAATTGACTTGCTATAAAAGCA
AAGGTGCCATTAAAATATTAAATATTAAATGGAGGGGCATCGTTAATGGA
GAATTATGCGTTGGCTGTGAATTGTCAGGTCCAGTCGAATGGGGAACTGA
TGGAACGTTTGGAAATAAAATTGTGTTCAAGTGCCCTGCCAGGAGAGGCG
TTCTTATCCCTACTGAGGAGTTGATAGATTCATGCGAAACAACCGCCCAT
TCGAAGATCACCACTCTTCCAAACAGCGGTTGGTTGTGGAAAGGAGACAC
ATATTTTATAAATCCTGATTGCATCTGCTGCACTGAATCAACGGAATCAC
TTCAAAAGCATCCAGATTTACGCATCAAAAGTAGAATAAAAGTCCCCAAC
AAGGAGAATAAGCAAATTGGGGGATCATGTGAATGGATTGGGTTGATAAA
TGGCCAGGAAGCACTCGGGATTACAATGGATAATGATGTTAAAGGAACTA
ACGGAATCTTCAGTTATTTTCGTATGTTTACATGTGAAGGTGGGAAAGGA
GTTCTGATGCTCGCGGAGAATATTTTTCACGATAAAGAAAGTGAAAAGCC
ACAATTTATTGCGGATAAAATCGTGGACATAAATAAAATATATAGCATTT
CTCCTTGTGAGGGTGAAAACGGAATTGGCATTGGAAAACCAATCAAAATT
AATTTAAATTCTCCAAATGGCCGAAACCGAGATTTTATTGGTGAAGTGAA
ATGGACAGGAAGGATTAATGATGAGAAATGCGTTGGGCTTGATATGGAAG
AGGAAATGGAGCATGGAATGGATGGAATGATTGGAAAATCTCGGATATTT
CAATGTATGGAAAAACACGGCCTAGTCGCATTGTTGTCTGATGTTGAATT
AAGTGAAAATGCTGAAAATCCACAAATTTTAGACAGCGGAATGATTGCAC
CAAATAAGTTTATTCGGTTCCAGGAGGAGCGTTCGAAGAAATATTTAGAT
GACAAGAATATCAAAATGAATGAATTTGTAATTGTGAAACAAGGAAATCC
GGAATTGAAACTGAAAGGGAAATTGCGATGGATTGGATGGATGAATAAAT
TGTTAGTTTGTGTAATTGAATTGGATCAAGATCATGAAAATGGATCAAAC
GGCACATTCTGGAGGCGTCAGATTGTAAACAGCCGCGGGAAACGGGTGAT
CGCTACTAGCGTAAATCATGTTTATAAATATGAGCCCTATGTCATTAAAA
CCATTCCCGAAGAAATTCAAATATTTAAAGAAATTGTCATCAATTCTGCC
GTTAAATATTATTTCTTGACTGCAACTGGATATCAGGACTTATTTGGCAC
AGTTAAATGGACTGGTGTAGACGAGAATGATTGTTATTTTTTTGGTTTAG
AACTAGATGATAGGATAAATATTGGTACTGATGGGACGTTTGGAGGACAG
CGGTTATTTACATGTCAGAATGGCCATGGGGTATTGGCACCATTGAATAA
TGTTGCTAGTGATACCCGATTTACGGCAAAAGTTGTTTCACCAGAAAATG
TCAAAAAGAGTGAAACTAGTGATCAAATTGTTTGCGGATTAAATTCTAGT
GTAATTGCGGGGGATAATAAAGGCATTCAGGGCAATGCAAACTCTTGCTA
TTTTGATTCAGCATTATTTGCATTATTTGTCAAATCAGATGTTCTCGATT
ATTTAATTTCACCAATCATTAATGAGCAAGAAGCGGATCCAATCACGAAA
GAATTTAGAGAGATTATAGCTTGGAGAATAGTTTATCCATTAAGGAAAAA
TGGATTTGTCAGTTTTCATCACACTCAAGAAATGAGAAATGTCATTCAGA
AATATGGAGCTAAGTTTGCTGAAATGATGAAGCAAGAAACTGATATGGAA
AATGTGTCTACCTTGCTGTCTAAATTATGTCCAAAAGAACAATTATTAAG
CATAATTCCACATAATGGTTGCAAAACAAATTCTATGTTTATGCAATTAT
TTCTGACAGTTGACAAAAAAGTGCCCTTCATGACCAGTGAGGAAATGCTC
AAGATATCAATGGTACAGAATGATATCATGTTCAATGAGTTGCCGACATG
TTTAATAATGCAAGCTCCAAGAGATGCCAAAGGAACGAATTCCTATAAAT
ATGCTTTGCCTTTGAATGAAATTGAAATTTCTCAAATTTGCTCCAACTAT
TTAAAAAATTGCTCCATATGTAATGGCGAAGCCGAATTTCAATGTAAAAC
GTGCTTGGGAGATGAATTAGATATAACTTGCACCTTCCTATGTTCACAAC
ATAAATGCCAACATCCTGCATGCACCAAACTTCTTCCAGACACGGTGAAA
TCCAAATCAAAAGTTTTCATGGAATTGCAGGCTATAATTTGCATTGAAAA
ATGTCATTTTGTATCCTTTGTAAAGCAAGTTGAAAGGTTAACGAATGAGC
AGGTTGAAAAGCTAAGAGCAAAGCAAATGGATATAAAAAATGAAATTAAT
TGGTTTTTCTTTGATAGTATGAGTTCTCAGTCAATATCCAGTAGCTATGC
TATTCCAAGGGTTTCACGGTGTGAATGTGTATCAAAATTCCTTAGCCTAT
CCGAAGACCAAATGAAACAATACATCGGCTCCAATGATCTGAAAGAATTA
AAAATGATTTTAGAAGATTCGTGCGTTTATATTTATCACAATAAGTCTAA
AACTTGTTACTGATTATCCGTGTCACAGGATATTTTATAAATCTTTGGTA
ATGAACTATTTAATTTGTATTTGTTTTAATTCCAAAGGTATTATTAAACA
AATATTTTTAACCAGGC
back to top

protein sequence of SMED30035733-orf-1

>SMED30035733-orf-1 ID=SMED30035733-orf-1|Name=SMED30035733-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1867bp
MHSDKSEDNSIKAVSNIDRQNSATSRTSNDSRDYMANKSVLPTIYCNKLG
MDVIKPGAIDQIGKPKGASMNKYIAIQGKTKSFVKLFWKGKINNINCLGC
ELPEFWSEGTEGTFGRYKLFTCSYGRGVLILINDAVKSCESAEESNHLPL
ADNDELTANNICCFEPLDKLSKDIKVNSQVFCQQLKAGGKCKWMGLINGK
GYVGIEFDEIHRRAERFNELSRILKIEGRIRFIPLECVENAKLHFIFDKI
VDTGKIFYVDCEEDRDYLGNFAAINLTTRDGKSKQFIGELKWIGKINNEK
CVGLDMEDETEFGMDGIINQDNRFDCMEKHGLITVLSNVNLYKYDNNVHL
LPSGIINPDKYLRCKETFGDECIKAQRIKKDGMVNVKLLNGQANLKGTLK
WHGLMNNVPVCAVQLLQEHENGTNGRFWRTRLFECRDKLAIATLTKNLSP
SMPIDFIKDIFVEKNQKEFSRGSVRTDDIYHVGQFVKILPFDLFGQIECF
HVVYEEMFVQIQLTKDQIKRLPFHQRIDRAAGNAIYSTVILLKDSIAKCS
ENLEFFNESSLINKECIEYRIPRPMETFRTGDLIKAGKTGNVKYFIVNNR
FIINGISCLSVMESILGEAEEYLPESEAMKVDNSELEMKYFQGVFIDPKS
IRSFEKCEINDFCIGNRVEFMSMDRKSSYNGRIKSTGIANKTIPSCVVQM
PPSEPIVNRSLLQYTLNENLEFKILSGTANDFLFLIRANLLRKSELPETV
NGIPVIDPEFIRIIEGVAVEPGKFIVFTCNNQRHSVQLKWKGLIDQKYCL
GCVANFQCNFGTNGTFGQDKLFACEDKHGILIPLAAVSECCEMKGHKPIK
WTRDGAIDENSICCTVEKNITKFQANCKLKNIKSNRKAIWKWSGLVNDVE
VIGVEMNESLEKGTDGNFCKIQLFRSVHKRGALFKSEEFIISKSELKHVK
EINLNVVDPFNVREIENGRQINKLTCYKSKGAIKILNIKWRGIVNGELCV
GCELSGPVEWGTDGTFGNKIVFKCPARRGVLIPTEELIDSCETTAHSKIT
TLPNSGWLWKGDTYFINPDCICCTESTESLQKHPDLRIKSRIKVPNKENK
QIGGSCEWIGLINGQEALGITMDNDVKGTNGIFSYFRMFTCEGGKGVLML
AENIFHDKESEKPQFIADKIVDINKIYSISPCEGENGIGIGKPIKINLNS
PNGRNRDFIGEVKWTGRINDEKCVGLDMEEEMEHGMDGMIGKSRIFQCME
KHGLVALLSDVELSENAENPQILDSGMIAPNKFIRFQEERSKKYLDDKNI
KMNEFVIVKQGNPELKLKGKLRWIGWMNKLLVCVIELDQDHENGSNGTFW
RRQIVNSRGKRVIATSVNHVYKYEPYVIKTIPEEIQIFKEIVINSAVKYY
FLTATGYQDLFGTVKWTGVDENDCYFFGLELDDRINIGTDGTFGGQRLFT
CQNGHGVLAPLNNVASDTRFTAKVVSPENVKKSETSDQIVCGLNSSVIAG
DNKGIQGNANSCYFDSALFALFVKSDVLDYLISPIINEQEADPITKEFRE
IIAWRIVYPLRKNGFVSFHHTQEMRNVIQKYGAKFAEMMKQETDMENVST
LLSKLCPKEQLLSIIPHNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISM
VQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNC
SICNGEAEFQCKTCLGDELDITCTFLCSQHKCQHPACTKLLPDTVKSKSK
VFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFF
DSMSSQSISSSYAIPRVSRCECVSKFLSLSEDQMKQYIGSNDLKELKMIL
EDSCVYIYHNKSKTCY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000463cholinergic neuron
PLANA:0000464GABAergic neuron
PLANA:0000484secretory system
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000938CAP-Gly_domain
IPR018200USP_CS
Vocabulary: biological process
TermDefinition
GO:0006511ubiquitin-dependent protein catabolic process
GO:0016579protein deubiquitination
Vocabulary: molecular function
TermDefinition
GO:0036459thiol-dependent ubiquitinyl hydrolase activity
GO:0016787hydrolase activity