Cilia-and flagella-associated protein 161

Overview
NameCilia-and flagella-associated protein 161
Smed IDSMED30035724
Length (bp)1032
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cilia-and flagella-associated protein 161 (SMED30035724) t-SNE clustered cells

Violin plots show distribution of expression levels for Cilia-and flagella-associated protein 161 (SMED30035724) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cilia-and flagella-associated protein 161 (SMED30035724) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cilia-and flagella-associated protein 161 (SMED30035724) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035724

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30035724SMESG000049902.1 SMESG000022627.1 SmedASXL_016458SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
testisSMED30035724SMESG000049898.1 SMESG000049902.1 PL06013A1G01_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
early male germ cellSMED30035724SMESG000049898.1 SMESG000049902.1 PL06013A1G01_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism asexual adult cDNA to DNA expression microarray evidence
testis primordiumSMED30035724SMESG000049898.1 SMESG000049902.1 PL06013A1G01_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
neoblastSMED30035724SMESG000049902.1 SMESG000049898.1 SMED_07810_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30035724SMESG000049902.1 SMESG000049898.1 SMED_07810_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30035724SMESG000049902.1 SMED_07810_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30035724SMESG000049902.1 SMED_07810_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cilia-and flagella-associated protein 161 vs. Ensembl Human
Match: CFAP161 (cilia and flagella associated protein 161 [Source:HGNC Symbol;Acc:HGNC:26782])

HSP 1 Score: 159.458 bits (402), Expect = 9.417e-46
Identity = 94/278 (33.81%), Postives = 151/278 (54.32%), Query Frame = 1
Query:   70 KNQYNSKVLIDSWFDNRILEEEIIKDFLAKRDSGQLMIQKMGSLLKKMSQAASPSTIADGFVRFGDQIQIINIGSDPNMVRLQRITSRPPSVLSIDAADEMLYFRNELPDPSTCTASFKLDPLSRNVFEIVSVDGDKTGKKATYGEPIAFKISSLLGPTM-YISSDNCAFVTTAKQSKHQEVCCIGGLSYLSHFNVQHADPRKRLQHEGCPIKASEKIVIKHGKSNQALAVESKFYEKTFFGYEHEVSAFTFLNDHRVEMDYNHWIFKGKLLTGGNVD 900
            +N Y   V I +W ++  LEEE++KDFL KRD G+L+IQ+   L + + +    S   DG++ +GD++ ++N   DP+      +  R    L +   +   + ++EL  P   +A     P+ RN F I+SV  D TG+   YG+     I+      M Y+SSD+   + ++K+S  QEV     +S+++ +     DP+ RL++EG P+ A+ KI+I H  +N+ LA     +  T+FG E EV A T+L+ HRVE   NHW+    L+TG   D
Sbjct:    3 QNVYGPGVRIGNWNEDVYLEEELMKDFLEKRDKGKLLIQRSRRLKQNLLRPMQLSVTEDGYIHYGDKVMLVN-PDDPDTE--ADVFLRGDLSLCMTPDEIQSHLKDELEVPCGLSAVQAKTPIGRNTFIILSVHRDATGQVLRYGQDFCLGITGGFDNKMLYLSSDHRTLLKSSKRSWLQEVYLTDEVSHVNCWQAAFPDPQLRLEYEGFPVPANAKILINHCHTNRGLAAHRHLFLSTYFGKEAEVVAHTYLDSHRVEKPRNHWM----LVTGNPRD 273          
BLAST of Cilia-and flagella-associated protein 161 vs. Ensembl Human
Match: CFAP161 (cilia and flagella associated protein 161 [Source:HGNC Symbol;Acc:HGNC:26782])

HSP 1 Score: 52.7582 bits (125), Expect = 2.699e-8
Identity = 34/113 (30.09%), Postives = 58/113 (51.33%), Query Frame = 1
Query:  139 IKDFLAKRDSGQLMIQKMGSLLKKMSQAASPSTIADGFVRFGDQIQIINIGSDPNMVRLQRITSRPPSVLSIDAADEMLYFRNELPDPSTCTASFKLDPLSRNVFEIVSVDGD 477
            +KDFL KRD G+L+IQ+   L + + +    S   DG++ +GD++ ++N   DP+      +  R    L +   +   + ++EL  P   +A     P+ RN F I+SV  D
Sbjct:    1 MKDFLEKRDKGKLLIQRSRRLKQNLLRPMQLSVTEDGYIHYGDKVMLVN-PDDPDTE--ADVFLRGDLSLCMTPDEIQSHLKDELEVPCGLSAVQAKTPIGRNTFIILSVHRD 110          
BLAST of Cilia-and flagella-associated protein 161 vs. Ensembl Human
Match: CFAP161 (cilia and flagella associated protein 161 [Source:HGNC Symbol;Acc:HGNC:26782])

HSP 1 Score: 48.9062 bits (115), Expect = 5.656e-7
Identity = 31/108 (28.70%), Postives = 55/108 (50.93%), Query Frame = 1
Query:  139 IKDFLAKRDSGQLMIQKMGSLLKKMSQAASPSTIADGFVRFGDQIQIINIGSDPNMVRLQRITSRPPSVLSIDAADEMLYFRNELPDPSTCTASFKLDPLSRNVFEIV 462
            +KDFL KRD G+L+IQ+   L + + +    S   DG++ +GD++ ++N   DP+      +  R    L +   +   + ++EL  P   +A     P+ RN F I+
Sbjct:    1 MKDFLEKRDKGKLLIQRSRRLKQNLLRPMQLSVTEDGYIHYGDKVMLVN-PDDPDTE--ADVFLRGDLSLCMTPDEIQSHLKDELEVPCGLSAVQAKTPIGRNTFIIL 105          
BLAST of Cilia-and flagella-associated protein 161 vs. Ensembl Fly
Match: CG34457 (gene:FBgn0085486 transcript:FBtr0345621)

HSP 1 Score: 79.7221 bits (195), Expect = 1.522e-16
Identity = 82/314 (26.11%), Postives = 137/314 (43.63%), Query Frame = 1
Query:   46 MSCEI---PQIKNQYNSKVLIDSWFDNRILEEEIIKDFLAKRDSGQLMIQKMGSLL----KKMSQAASPSTIADGFVRFGDQIQI----INIGSDPNMVRLQRITSRPPSVLSIDAADEMLYFRNELPDPSTCTASFKLDPLSRNVFEIVSVDG-DKTGKKATYGEPIAFK--------ISSLLGP----------TMYISSDNCAFVTTAKQSKHQEVCCIGG---LSYLSHFNVQHADPRKRLQHEGCPIKASEKIVIKHGKSNQALAVESKFYEKTFFGYEHEVSAFTFLNDHRVEMDYNHWIFKGKLLTG 888
            M C +     I  ++   V I +W +   LEE+ I +F  +RD G+L+++K  +L     K++  AA   TI      FG  +Q+    INI SD +   L        + LS+   ++++     + +    + +    P  RN F+IVS DG D+TG+   YG+    +        I    GP            Y+S  N             ++ C      ++Y + F  +H +P++R + EG  I ++  +VI H  +N+ LA E+   + T FG E  VS   + N +R E+  N W+      TG
Sbjct:    1 MPCRVGDMDSISARFQPSVRIGNWVEENCLEEDKIVNFKKQRDRGELLVEKARTLYDNFHKEIVLAAPKQTII-----FGAIVQLMPIHINI-SDMDTTDLN-------AALSVVINEKVVRKSQSINEDCELSVAPSKRPCVRNSFKIVSGDGRDRTGENIKYGQRFQLQCMASEHDPIVLYSGPKRCNLQQGVHATYLSHKNGELNLNLGLVHRSKLSCPDNDIPIAYTNWF-CRHVNPKQRFESEGEDIPSNSPLVIVHATTNRNLAAENVLIQ-TLFGPEFLVSVQNYRNIYRHEIWKNVWMISNGHQTG 299          
BLAST of Cilia-and flagella-associated protein 161 vs. Ensembl Fly
Match: CG34457 (gene:FBgn0085486 transcript:FBtr0112763)

HSP 1 Score: 79.7221 bits (195), Expect = 1.522e-16
Identity = 82/314 (26.11%), Postives = 137/314 (43.63%), Query Frame = 1
Query:   46 MSCEI---PQIKNQYNSKVLIDSWFDNRILEEEIIKDFLAKRDSGQLMIQKMGSLL----KKMSQAASPSTIADGFVRFGDQIQI----INIGSDPNMVRLQRITSRPPSVLSIDAADEMLYFRNELPDPSTCTASFKLDPLSRNVFEIVSVDG-DKTGKKATYGEPIAFK--------ISSLLGP----------TMYISSDNCAFVTTAKQSKHQEVCCIGG---LSYLSHFNVQHADPRKRLQHEGCPIKASEKIVIKHGKSNQALAVESKFYEKTFFGYEHEVSAFTFLNDHRVEMDYNHWIFKGKLLTG 888
            M C +     I  ++   V I +W +   LEE+ I +F  +RD G+L+++K  +L     K++  AA   TI      FG  +Q+    INI SD +   L        + LS+   ++++     + +    + +    P  RN F+IVS DG D+TG+   YG+    +        I    GP            Y+S  N             ++ C      ++Y + F  +H +P++R + EG  I ++  +VI H  +N+ LA E+   + T FG E  VS   + N +R E+  N W+      TG
Sbjct:    1 MPCRVGDMDSISARFQPSVRIGNWVEENCLEEDKIVNFKKQRDRGELLVEKARTLYDNFHKEIVLAAPKQTII-----FGAIVQLMPIHINI-SDMDTTDLN-------AALSVVINEKVVRKSQSINEDCELSVAPSKRPCVRNSFKIVSGDGRDRTGENIKYGQRFQLQCMASEHDPIVLYSGPKRCNLQQGVHATYLSHKNGELNLNLGLVHRSKLSCPDNDIPIAYTNWF-CRHVNPKQRFESEGEDIPSNSPLVIVHATTNRNLAAENVLIQ-TLFGPEFLVSVQNYRNIYRHEIWKNVWMISNGHQTG 299          
BLAST of Cilia-and flagella-associated protein 161 vs. Ensembl Fly
Match: CG15498 (gene:FBgn0038892 transcript:FBtr0084122)

HSP 1 Score: 76.6406 bits (187), Expect = 1.222e-15
Identity = 82/293 (27.99%), Postives = 121/293 (41.30%), Query Frame = 1
Query:   79 YNSKVLIDSWFDNRILEEEIIKDFLAKRDSGQLMIQKMGSLLKKMSQAASPSTIADGFVRFGDQIQI--INIGSDPNMVRLQRITSRPPSVLSIDAADEMLYFR----NELPDPSTCTASFKLDPLSRNVFEIVSV-DGDKTGKKATYGEPIAFKISSLLGPTMYISSD----------NCAFVTTAKQSKHQEVCCIGGL-------------SYLSHFNVQHADPRKRLQHEGCPIKASEKIVIKHGKSNQALAVESKFYEKTFFGYEHEVSAFTFLNDHRVEMDYNHWIF 867
            Y   V + +W +  + EE  + +   +R+SG L++ +  ++  +  Q        D  + FG  +QI  + IG     V  Q +      VLS+    E L+      NE+ D    T +    P  RN F IVS  + D+TG+   YGE    +        MY+ S             AF TT    K+ EV    GL             +  +HF   H DP  R + EG  I     +VI H  +N+ LAVE+     T FG E +VS  T+ N ++ E   N W F
Sbjct:    2 YGPGVKVGNWLETALSEEMRMSEMKKRRESGNLLLDRTRAVYDRFYQGTVLGPPQD-VLAFGVVVQIRPVKIGVCRQQVSDQNL------VLSVVITQEGLHRNCKTINEMCD---LTVAPSPRPALRNSFRIVSPNEDDRTGQYLAYGEKFRLQALEPADEPMYVFSGPKRLNLSLPVEKAFFTT----KNGEVTLPLGLVSHKNCGPSARVPTSHTHFFCAHKDPDLRFESEGKTIPVHNPLVIVHAVTNRNLAVEN-VLANTLFGPEFQVSVQTYKNVYKRETWKNLWKF 279          
BLAST of Cilia-and flagella-associated protein 161 vs. Ensembl Zebrafish
Match: cfap161 (cilia and flagella associated protein 161 [Source:NCBI gene;Acc:550471])

HSP 1 Score: 175.637 bits (444), Expect = 3.047e-52
Identity = 92/269 (34.20%), Postives = 151/269 (56.13%), Query Frame = 1
Query:   79 YNSKVLIDSWFDNRILEEEIIKDFLAKRDSGQLMIQKMGSLLKKMSQAASPSTIADGFVRFGDQIQIINIGSDPNMVRLQRITSRPPSVLSIDAADEMLYFRNE------LPDPSTCTASFKLDPLSRNVFEIVSVDGDKTGKKATYGEPIAFKISSLLGPTMYISSDNCAFVTTAKQSKHQEVCCIGGLSYLSHFNVQHADPRKRLQHEGCPIKASEKIVIKHGKSNQALAVESKFYEKTFFGYEHEVSAFTFLNDHRVEMDYNHWIF 867
            YN +V + +W ++  LEEE +K+F+ ++D G+L +QK G+L + + +  S S   DGF+ FGD + ++N G   +M        R P VLSI A    +   ++      L  P     +  +DP  RN F I+SVDG   G+   Y +  A K +      ++++SD+ +F   AK+S+ QE+  +    +L  + V + DP+ RL++EG P++ + K++I H K+NQ LA  S     + FG E+E++A TFL+ H+ E D NHW+F
Sbjct:    7 YNPRVRVGNWKEDVTLEEETLKEFILQKDRGELTVQKEGALKQSILKPVSLSVSQDGFLHFGDTVMLVNCGDGGHM-------QRSPCVLSIIADSSNVTSHSQTNTGPHLLGPLQVGGAHSMDPCVRNTFIIISVDGSSDGEVVRYDQSFALKTTGGFAGELFLASDHKSFQKCAKKSRLQELSLVEEFDFLCWWKVLYFDPQDRLENEGYPVQVNNKVLISHCKTNQCLAALSNHILWSQFGKEYELTAHTFLDSHKAEQDNNHWLF 268          
BLAST of Cilia-and flagella-associated protein 161 vs. Ensembl Xenopus
Match: med31 (mediator complex subunit 31 [Source:Xenbase;Acc:XB-GENE-951034])

HSP 1 Score: 174.096 bits (440), Expect = 1.613e-51
Identity = 97/277 (35.02%), Postives = 155/277 (55.96%), Query Frame = 1
Query:   91 VLIDSWFDNRILEEEIIKDFLAKRDSGQLMIQKMGSLLKKMSQAASPSTIADGFVRFGDQIQIINIGSDPNMVRLQRITSRPPS----VLSIDAADEMLYFRNELPDPSTCTASFKLDPLSRNVFEIVSVDGDKTGKKATYGEPIAFKISSLLGPTMYISSDNCAFVTTAKQSKHQEVCCIGGLSYLSHFNVQHADPRKRLQHEGCPIKASEKIVIKHGKSNQALAVESKFYEKTFFGYEHEVSAFTFLNDHRVEMDYNHWIFKGKLLTGGNVDLFD 909
            V + +W ++  LEE+I+KD+L K+D G+L+IQK  +L K + +    S   DG + FGD + ++N  +       Q +++  P+     LS++  +  +Y +  L  P   + S  L+P  RN F I SVDG   G+   YG+  A + +      ++++SD   F+ ++K+S  QEV     LSY + +N  + DP+ RL++EG P+ A+ K++I H K+NQ LAV  K    TFFG E E++A TFLN H+ E + NHWI      + G   +FD
Sbjct:   10 VRLGNWNEDVALEEDILKDYLEKKDKGELLIQKTSNLKKNILKKTELSISQDGCLHFGDVVMLLNPENSE-----QSLSNTSPTNGNYALSVNPNENAVYSKTHLEAPCGVSGSTNLEPTVRNAFIITSVDGSDVGEPVHYGQNFALRTTEGFMNHLHLTSDQKTFLKSSKKSYLQEVSLTDQLSYQNCWNFIYLDPQLRLENEGFPVPANTKLLIVHSKTNQCLAVLRKQVLWTFFGKECEITAHTFLNGHKAEENENHWIVVTGNPSNGLSTMFD 281          
BLAST of Cilia-and flagella-associated protein 161 vs. Ensembl Xenopus
Match: med31 (mediator complex subunit 31 [Source:Xenbase;Acc:XB-GENE-951034])

HSP 1 Score: 170.244 bits (430), Expect = 4.473e-50
Identity = 99/281 (35.23%), Postives = 155/281 (55.16%), Query Frame = 1
Query:   91 VLIDSWFDNRILEEEIIKDFLAKRDSGQLMIQKMGSLLKKMSQAASPSTIADGFVRFGDQIQIINIGSDPNMVRLQRITSRPPS----VLSIDAADEMLYFRNELPDPSTCTASFKLDPLSRNVFEIVSVDGDKTGKKATYGEPIAFKIS----SLLGPTMYISSDNCAFVTTAKQSKHQEVCCIGGLSYLSHFNVQHADPRKRLQHEGCPIKASEKIVIKHGKSNQALAVESKFYEKTFFGYEHEVSAFTFLNDHRVEMDYNHWIFKGKLLTGGNVDLFD 909
            V + +W ++  LEE+I+KD+L K+D G+L+IQK  +L K + +    S   DG + FGD + ++N  +       Q +++  P+     LS++  +  +Y +  L  P   + S  L+P  RN F I SVDG   G+   YG+  A + +    + +  T Y  SD   F+ ++K+S  QEV     LSY + +N  + DP+ RL++EG P+ A+ K++I H K+NQ LAV  K    TFFG E E++A TFLN H+ E + NHWI      + G   +FD
Sbjct:   10 VRLGNWNEDVALEEDILKDYLEKKDKGELLIQKTSNLKKNILKKTELSISQDGCLHFGDVVMLLNPENSE-----QSLSNTSPTNGNYALSVNPNENAVYSKTHLEAPCGVSGSTNLEPTVRNAFIITSVDGSDVGEPVHYGQNFALRTTEGFMNHVSNTFYNISDQKTFLKSSKKSYLQEVSLTDQLSYQNCWNFIYLDPQLRLENEGFPVPANTKLLIVHSKTNQCLAVLRKQVLWTFFGKECEITAHTFLNGHKAEENENHWIVVTGNPSNGLSTMFD 285          
BLAST of Cilia-and flagella-associated protein 161 vs. Ensembl Mouse
Match: Cfap161 (cilia and flagella associated protein 161 [Source:MGI Symbol;Acc:MGI:1922806])

HSP 1 Score: 146.362 bits (368), Expect = 6.017e-41
Identity = 90/279 (32.26%), Postives = 153/279 (54.84%), Query Frame = 1
Query:   70 KNQYNSKVLIDSWFDNRILEEEIIKDFLAKRDSGQLMIQKMGSLLKKMSQAASPSTIADGFVRFGDQIQIINIGSDPNMVRLQRITS--RPPSVLSIDAADEMLYFRNELPDPSTCTASFKLDPLSRNVFEIVSVDGDKT---GKKATYGEPIAFKISS-LLGPTMYISSDNCAFVTTAKQSKHQEVCCIGGLSYLSHFNVQHADPRKRLQHEGCPIKASEKIVIKHGKSNQALAVESKFYEKTFFGYEHEVSAFTFLNDHRVEMDYNHWIFKGKLLTG 888
            +N Y   V + +W ++  LEEE ++ FL KR+ G+L+IQ+   + K + +    S   DG+V +GD++ I+N    P+ V  +      R    L +   +      ++L  P   +A   + P+ RN F I+S DG  +   G+   YG+     I++ L G  +Y++SD+   + ++ +S  QEV     +++L+ +     DP+ RL++EG P++A+EKIVI H  +N+ALAV    + +T+FG E EV A T+L+ H+VE   N W+    L+TG
Sbjct:    3 QNVYGPGVRMGNWNEDVYLEEERMRHFLEKREKGELLIQRNRRVKKNILRPMQLSVSEDGYVHYGDKVIIVN----PDQVLGEEAGKFMRGDLSLCMSPDEVKAQLSDDLEIPCGVSAVQTIAPMGRNTFTILS-DGANSCEMGQVVVYGQNFCLGIAAGLEGKMLYLTSDHRTLLKSSLKSGLQEVTLTDEVTHLNCWQAAFLDPQLRLEYEGFPVRANEKIVIYHRHTNRALAVHRNLFLRTYFGKEMEVVAHTYLDSHKVEKPKNQWM----LVTG 272          
BLAST of Cilia-and flagella-associated protein 161 vs. Ensembl Mouse
Match: Cfap161 (cilia and flagella associated protein 161 [Source:MGI Symbol;Acc:MGI:1922806])

HSP 1 Score: 115.546 bits (288), Expect = 8.109e-30
Identity = 73/241 (30.29%), Postives = 129/241 (53.53%), Query Frame = 1
Query:   70 KNQYNSKVLIDSWFDNRILEEEIIKDFLAKRDSGQLMIQKMGSLLKKMSQAASPSTIADGFVRFGDQIQIINIGSDPNMVRLQRITS--RPPSVLSIDAADEMLYFRNELPDPSTCTASFKLDPLSRNVFEIVSVDGDKT---GKKATYGEPIAFKISS-LLGPTMYISSDNCAFVTTAKQSKHQEVCCIGGLSYLSHFNVQHADPRKRLQHEGCPIKASEKIVIKHGKSNQALAVESKFY 774
            +N Y   V + +W ++  LEEE ++ FL KR+ G+L+IQ+   + K + +    S   DG+V +GD++ I+N    P+ V  +      R    L +   +      ++L  P   +A   + P+ RN F I+S DG  +   G+   YG+     I++ L G  +Y++SD+   + ++ +S  QEV     +++L+ +     DP+ RL++EG P++A+EKIVI H  +N+ALAV    +
Sbjct:    3 QNVYGPGVRMGNWNEDVYLEEERMRHFLEKREKGELLIQRNRRVKKNILRPMQLSVSEDGYVHYGDKVIIVN----PDQVLGEEAGKFMRGDLSLCMSPDEVKAQLSDDLEIPCGVSAVQTIAPMGRNTFTILS-DGANSCEMGQVVVYGQNFCLGIAAGLEGKMLYLTSDHRTLLKSSLKSGLQEVTLTDEVTHLNCWQAAFLDPQLRLEYEGFPVRANEKIVIYHRHTNRALAVHRNLF 238          
BLAST of Cilia-and flagella-associated protein 161 vs. Ensembl Mouse
Match: Cfap161 (cilia and flagella associated protein 161 [Source:MGI Symbol;Acc:MGI:1922806])

HSP 1 Score: 58.9214 bits (141), Expect = 3.990e-10
Identity = 44/163 (26.99%), Postives = 81/163 (49.69%), Query Frame = 1
Query:  139 IKDFLAKRDSGQLMIQKMGSLLKKMSQAASPSTIADGFVRFGDQIQIINIGSDPNMVRLQRITS--RPPSVLSIDAADEMLYFRNELPDPSTCTASFKLDPLSRNVFEIVSVDGDKT---GKKATYGEPIAFKISS-LLGPTMYISSDNCAFVTTAKQSKHQE 609
            ++ FL KR+ G+L+IQ+   + K + +    S   DG+V +GD++ I+N    P+ V  +      R    L +   +      ++L  P   +A   + P+ RN F I+S DG  +   G+   YG+     I++ L G  +Y++SD+   + ++ +S  QE
Sbjct:    1 MRHFLEKREKGELLIQRNRRVKKNILRPMQLSVSEDGYVHYGDKVIIVN----PDQVLGEEAGKFMRGDLSLCMSPDEVKAQLSDDLEIPCGVSAVQTIAPMGRNTFTILS-DGANSCEMGQVVVYGQNFCLGIAAGLEGKMLYLTSDHRTLLKSSLKSGLQE 158          
BLAST of Cilia-and flagella-associated protein 161 vs. UniProt/SwissProt
Match: sp|Q568D2|CF161_DANRE (Cilia- and flagella-associated protein 161 OS=Danio rerio OX=7955 GN=cfap161 PE=2 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 1.325e-50
Identity = 92/269 (34.20%), Postives = 150/269 (55.76%), Query Frame = 1
Query:   79 YNSKVLIDSWFDNRILEEEIIKDFLAKRDSGQLMIQKMGSLLKKMSQAASPSTIADGFVRFGDQIQIINIGSDPNMVRLQRITSRPPSVLSIDAADEMLYFRNE------LPDPSTCTASFKLDPLSRNVFEIVSVDGDKTGKKATYGEPIAFKISSLLGPTMYISSDNCAFVTTAKQSKHQEVCCIGGLSYLSHFNVQHADPRKRLQHEGCPIKASEKIVIKHGKSNQALAVESKFYEKTFFGYEHEVSAFTFLNDHRVEMDYNHWIF 867
            YN +V + +W ++  LEEE  K+F+ ++D G+L +QK G+L + + +  S S   DGF+ FGD + ++N G   +M        R P VLSI A    +   ++      L  P     +  +DP  RN F I+SVDG   G+   Y +  A K +      ++++SD+ +F   AK+S+ QE+  +    +L  + V + DP+ RL++EG P++ + K++I H K+NQ LA  S     + FG E+E++A TFL+ H+ E D NHW+F
Sbjct:    7 YNPRVRVGNWKEDVTLEEETSKEFILQKDRGELTVQKEGALKQSILKPVSLSVSQDGFLHFGDTVMLVNCGDGGHM-------QRSPCVLSIIADSSNVTSHSQTNTGPHLLGPLQVGGAHSMDPCVRNTFIIISVDGSSDGEVVRYDQSFALKTTGGFAGELFLASDHKSFQKCAKKSRLQELSLVEEFDFLCWWKVLYFDPQDRLENEGYPVQVNNKVLISHCKTNQCLAALSNHILWSQFGKEYELTAHTFLDSHKAEQDNNHWLF 268          
BLAST of Cilia-and flagella-associated protein 161 vs. UniProt/SwissProt
Match: sp|Q6P656|CF161_HUMAN (Cilia- and flagella-associated protein 161 OS=Homo sapiens OX=9606 GN=CFAP161 PE=1 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 4.522e-45
Identity = 94/278 (33.81%), Postives = 151/278 (54.32%), Query Frame = 1
Query:   70 KNQYNSKVLIDSWFDNRILEEEIIKDFLAKRDSGQLMIQKMGSLLKKMSQAASPSTIADGFVRFGDQIQIINIGSDPNMVRLQRITSRPPSVLSIDAADEMLYFRNELPDPSTCTASFKLDPLSRNVFEIVSVDGDKTGKKATYGEPIAFKISSLLGPTM-YISSDNCAFVTTAKQSKHQEVCCIGGLSYLSHFNVQHADPRKRLQHEGCPIKASEKIVIKHGKSNQALAVESKFYEKTFFGYEHEVSAFTFLNDHRVEMDYNHWIFKGKLLTGGNVD 900
            +N Y   V I +W ++  LEEE++KDFL KRD G+L+IQ+   L + + +    S   DG++ +GD++ ++N   DP+      +  R    L +   +   + ++EL  P   +A     P+ RN F I+SV  D TG+   YG+     I+      M Y+SSD+   + ++K+S  QEV     +S+++ +     DP+ RL++EG P+ A+ KI+I H  +N+ LA     +  T+FG E EV A T+L+ HRVE   NHW+    L+TG   D
Sbjct:    3 QNVYGPGVRIGNWNEDVYLEEELMKDFLEKRDKGKLLIQRSRRLKQNLLRPMQLSVTEDGYIHYGDKVMLVN-PDDPDTE--ADVFLRGDLSLCMTPDEIQSHLKDELEVPCGLSAVQAKTPIGRNTFIILSVHRDATGQVLRYGQDFCLGITGGFDNKMLYLSSDHRTLLKSSKRSWLQEVYLTDEVSHVNCWQAAFPDPQLRLEYEGFPVPANAKILINHCHTNRGLAAHRHLFLSTYFGKEAEVVAHTYLDSHRVEKPRNHWM----LVTGNPRD 273          
BLAST of Cilia-and flagella-associated protein 161 vs. UniProt/SwissProt
Match: sp|Q6P8Y0|CF161_MOUSE (Cilia- and flagella-associated protein 161 OS=Mus musculus OX=10090 GN=Cfap161 PE=1 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 4.209e-40
Identity = 90/279 (32.26%), Postives = 153/279 (54.84%), Query Frame = 1
Query:   70 KNQYNSKVLIDSWFDNRILEEEIIKDFLAKRDSGQLMIQKMGSLLKKMSQAASPSTIADGFVRFGDQIQIINIGSDPNMVRLQRITS--RPPSVLSIDAADEMLYFRNELPDPSTCTASFKLDPLSRNVFEIVSVDGDKT---GKKATYGEPIAFKISS-LLGPTMYISSDNCAFVTTAKQSKHQEVCCIGGLSYLSHFNVQHADPRKRLQHEGCPIKASEKIVIKHGKSNQALAVESKFYEKTFFGYEHEVSAFTFLNDHRVEMDYNHWIFKGKLLTG 888
            +N Y   V + +W ++  LEEE ++ FL KR+ G+L+IQ+   + K + +    S   DG+V +GD++ I+N    P+ V  +      R    L +   +      ++L  P   +A   + P+ RN F I+S DG  +   G+   YG+     I++ L G  +Y++SD+   + ++ +S  QEV     +++L+ +     DP+ RL++EG P++A+EKIVI H  +N+ALAV    + +T+FG E EV A T+L+ H+VE   N W+    L+TG
Sbjct:    3 QNVYGPGVRMGNWNEDVYLEEERMRHFLEKREKGELLIQRNRRVKKNILRPMQLSVSEDGYVHYGDKVIIVN----PDQVLGEEAGKFMRGDLSLCMSPDEVKAQLSDDLEIPCGVSAVQTIAPMGRNTFTILS-DGANSCEMGQVVVYGQNFCLGIAAGLEGKMLYLTSDHRTLLKSSLKSGLQEVTLTDEVTHLNCWQAAFLDPQLRLEYEGFPVRANEKIVIYHRHTNRALAVHRNLFLRTYFGKEMEVVAHTYLDSHKVEKPKNQWM----LVTG 272          
BLAST of Cilia-and flagella-associated protein 161 vs. TrEMBL
Match: A0A1I8GTE2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012001g1 PE=4 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 1.948e-64
Identity = 110/280 (39.29%), Postives = 163/280 (58.21%), Query Frame = 1
Query:   79 YNSKVLIDSWFDNRILEEEIIKDFLAKRDSGQLMIQKMGSLLKKMSQ---------AASPSTIADGFVRFGDQIQIINIGSDPNMVRLQRITSRPPSVLSIDAADEMLYF-RNELPDPSTCTASFKLDPLSRNVFEIVSVDGDKTGKKATYGEPIAFKISSLLGPTMYISSDNCAFVTTAKQSKHQEVCCIGGLSYLSHFNVQHADPRKRLQHEGCPIKASEKIVIKHGKSNQALAVESKFYEKTFFGYEHEVSAFTFLNDHRVEMDYNHWIFKGKLLTG 888
            YN  V + +WF++  LEE+ IK+FL K++ G+L+ QK+G+L K ++           A+ ST  DG + FGD++Q+ N G+D  +VRL R   R PSVLS+   +E+L      LPDPS  +A+     + RNVF IVSVDG   GK  T+ +P      S LG  M++SSD   F  T ++   Q V      S+L+H+  ++ +P+ R+++EG PI   E +++KH K+NQ LAVE KF  +   G E +VS+ T+  DH+ E D NHW+F      G
Sbjct:    7 YNPSVRVGNWFEDCQLEEDTIKNFLEKKERGELLSQKVGNLYKSVASNSSSTSADSGAALSTSQDGLLHFGDRVQLRNPGADAALVRLGRCQPRCPSVLSVSIGEEVLSSPAGALPDPSPASAAQSCQAMGRNVFTIVSVDGTPEGKPVTFNQPFQLATHSSLGKPMFLSSDRVKFGDTPRKHGKQAVQFTAESSFLTHWRAEYFNPQLRMEYEGAPIPVGEPLILKHAKTNQGLAVEDKFVIRGLMGTEFDVSSQTYFTDHKAETDANHWVFAANCPPG 286          
BLAST of Cilia-and flagella-associated protein 161 vs. TrEMBL
Match: A0A1I8FZ29 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 3.116e-64
Identity = 110/280 (39.29%), Postives = 163/280 (58.21%), Query Frame = 1
Query:   79 YNSKVLIDSWFDNRILEEEIIKDFLAKRDSGQLMIQKMGSLLKKMSQ---------AASPSTIADGFVRFGDQIQIINIGSDPNMVRLQRITSRPPSVLSIDAADEMLYF-RNELPDPSTCTASFKLDPLSRNVFEIVSVDGDKTGKKATYGEPIAFKISSLLGPTMYISSDNCAFVTTAKQSKHQEVCCIGGLSYLSHFNVQHADPRKRLQHEGCPIKASEKIVIKHGKSNQALAVESKFYEKTFFGYEHEVSAFTFLNDHRVEMDYNHWIFKGKLLTG 888
            YN  V + +WF++  LEE+ IK+FL K++ G+L+ QK+G+L K ++           A+ ST  DG + FGD++Q+ N G+D  +VRL R   R PSVLS+   +E+L      LPDPS  +A+     + RNVF IVSVDG   GK  T+ +P      S LG  M++SSD   F  T ++   Q V      S+L+H+  ++ +P+ R+++EG PI   E +++KH K+NQ LAVE KF  +   G E +VS+ T+  DH+ E D NHW+F      G
Sbjct:    7 YNPSVRVGNWFEDCQLEEDTIKNFLEKKERGELLSQKVGNLYKSVASNSSSTSADSGAALSTSQDGLLHFGDRVQLRNPGADAALVRLGRCQPRCPSVLSVSIGEEVLSSPAGALPDPSPASAAQSCQAMGRNVFTIVSVDGTPEGKPVTFNQPFQLATHSSLGKPMFLSSDRVKFGDTPRKHGKQAVQFTAESSFLTHWRAEYFNPQLRMEYEGAPIPVGEPLILKHAKTNQGLAVEDKFVIRGLMGTEFDVSSQTYFTDHKAETDANHWVFAANCPPG 286          
BLAST of Cilia-and flagella-associated protein 161 vs. TrEMBL
Match: A0A401PDG1 (Uncharacterized protein OS=Scyliorhinus torazame OX=75743 GN=scyTo_0005866 PE=4 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 3.299e-52
Identity = 101/268 (37.69%), Postives = 157/268 (58.58%), Query Frame = 1
Query:   79 YNSKVLIDSWFDNRILEEEIIKDFLAKRDSGQLMIQKMGS----LLKKMSQAASPSTIADGFVRFGDQIQIINIGS-DPNMVRLQRITSRPPSVLSIDAADEMLYFRNELPDPSTCTASFKLDPLSRNVFEIVSVDGDKTGKKATYGEPIAFKISSLLGPTMYISSDNCAFVTTAKQSKHQEVCCIGGLSYLSHFNVQHADPRKRLQHEGCPIKASEKIVIKHGKSNQALAVESKFYEKTFFGYEHEVSAFTFLNDHRVEMDYNHWIF 867
            Y+S VL+ +WF++  L++++IKDF+AK++ G+L IQKMGS    LL K   A S     DG+V FGD++ +IN G+ D     +  I  R P  L+++          ++  P   +AS +L P  RN F I S+DG   G    YG+  A +    +   +Y++SD   F+  AK+S+ Q V  +  LS+LS + V + DP+ RL+++G P++A+ K++I H ++NQALA   K+   T FG EHE++  TF + HR E D NHW+ 
Sbjct:    6 YSSSVLLHNWFEDLALDQDVIKDFIAKKERGELTIQKMGSYKEILLDKTELAKS----RDGYVHFGDEVLLINPGTVDKYAANVHPI--RRPMSLTMNVDQSRFLTSTKVDSPCELSASLELSPTIRNTFVITSIDGSCVGDPLRYGQSFALRTLEGVAGQLYLTSDIKLFLKFAKKSRLQLVNLLDELSFLSCWQVLYLDPQMRLEYDGYPVQANIKVLINHTRTNQALAALQKYSFWTAFGREHEITTNTFYDSHRAEEDLNHWVI 267          
BLAST of Cilia-and flagella-associated protein 161 vs. TrEMBL
Match: A0A1S3HAD9 (cilia- and flagella-associated protein 161 OS=Lingula unguis OX=7574 GN=LOC106153573 PE=4 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 6.963e-52
Identity = 96/260 (36.92%), Postives = 147/260 (56.54%), Query Frame = 1
Query:   79 YNSKVLIDSWFDNRILEEEIIKDFLAKRDSGQLMIQKMGSLLKKMSQAASPSTIADGFVRFGDQIQIINIGSDPNMVRLQRITSRPPSVLSIDAADEMLYFRNELPDPSTCTASFKLDPLSRNVFEIVSVDGDKTGKKATYGEPIAFKISSLLGPTMYISSDNCAFVTTAKQSKHQEVCCIGGLSYLSHFNVQHADPRKRLQHEGCPIKASEKIVIKHGKSNQALAVESKFYEKTFFGYEHEVSAFTFLNDHRVEMDYNH 858
            YN  V + +W ++  LEE+ +KDFL KR  G+L+IQK   L + + +    S   DGFV FGD + I+N G++        +  R  S +  + ++  +Y  N++  P   + S  L+P  RN F I S+DG        Y +P   K +   G  + + SD   F  +AK+S+HQEVC +   SYL+ + V   +P+ R+++E  P+ A+EK+VI H K+N AL VES F  KT FG E+E+++FT L+ H+ E D NH
Sbjct:    6 YNPSVRVGNWNEDIQLEEDTLKDFLEKRAKGELLIQKTHRLYENILKKVDLSISRDGFVHFGDVVMIMNKGAEDKTKYSSGVDPRGDSAICANMSESKMYEANKIEGPCGVSGSRMLEPCVRNAFVITSIDGTPNETPLMYNQPFHLKTTPDKGGDLLLFSDRATFQNSAKRSRHQEVCLVPEASYLTQWMVLPFNPQLRMEYELAPVPANEKVVIVHCKTNNALCVESDFLLKTPFGREYEITSFTSLDSHKAEKDINH 265          
BLAST of Cilia-and flagella-associated protein 161 vs. TrEMBL
Match: A0A1W3JP62 (cilia- and flagella-associated protein 161-like isoform X2 OS=Ciona intestinalis OX=7719 GN=LOC100183783 PE=4 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 1.069e-51
Identity = 96/264 (36.36%), Postives = 154/264 (58.33%), Query Frame = 1
Query:   79 YNSKVLIDSWFDNRILEEEIIKDFLAKRDSGQLMIQKMGSLLKKMSQAASPSTIADGFVRFGDQIQIINIGSDPNMVRLQRI-TSRPPSVLSIDAADEMLYFRNELPDPSTCTASFKLDPLSRNVFEIVSVDGDKTGKKATYGEPIAFKISSLLGPTMYISSDNCAFVTTAKQSKHQEVCCIGGLSYLSHFNVQHADPRKRLQHEGCPIKASEKIVIKHGKSNQALAVESKFYEKTFFGYEHEVSAFTFLNDHRVEMDYNHWIF 867
            YN  V + +W ++  LEE+++KDFL K++ G+L+IQK  +L+  + + +  +   DGFV FGD + ++N G +   + LQ+I   RP + LSI+  +  ++   ++  P   +AS  L+P +RN F I SVDG + G    +G+P A   +      + + SD+  F  +AK+S+ Q V  +  ++YLS + V    P+ RL+ EG P+  + KIV+ H K+ QAL+   +   KT FG E EVSA T L+ H+ E D NHW+F
Sbjct:    6 YNPSVRVGNWNEDICLEEDLLKDFLGKKEKGELLIQKSHNLMHNILKKSELTVTTDGFVHFGDVVMLVNPGQETVPLSLQQIEPPRPATSLSINIDEHKMHTACQVEGPCNVSASKMLNPSARNSFVITSVDGSENGSPLKFGQPFAISTTGGYAGNLKLFSDHARFNLSAKKSRQQIVQLVDEVNYLSTWQVLAYHPQHRLEFEGRPVPGNCKIVVSHNKTGQALSTPDECGLKTPFGREFEVSAHTVLDTHKAEKDNNHWVF 269          
BLAST of Cilia-and flagella-associated protein 161 vs. Ensembl Cavefish
Match: cfap161 (cilia and flagella associated protein 161 [Source:NCBI gene;Acc:103028325])

HSP 1 Score: 159.458 bits (402), Expect = 5.659e-46
Identity = 90/273 (32.97%), Postives = 145/273 (53.11%), Query Frame = 1
Query:   79 YNSKVLIDSWFDNRILEEEIIKDFLAKRDSGQLMIQKMGSLLKKMSQAASPSTIADGFVRFGDQIQIINIGS------DPN----MVRLQRITSRPPSVLSIDAADEMLYFRNELPDPSTCTASFKLDPLSRNVFEIVSVDGDKTGKKATYGEPIAFKISSLLGPTMYISSDNCAFVTTAKQSKHQEVCCIGGLSYLSHFNVQHADPRKRLQHEGCPIKASEKIVIKHGKSNQALAVESKFYEKTFFGYEHEVSAFTFLNDHRVEMDYNHWIF 867
            Y + V + +W ++  LE++ +KDFL +RD G+L +QK   L + + +  S S   DGF+RFGD + ++N G       DP     +  L  + S P +     +++  LY       P     +  L P  RN   I SVDG   G+   Y +  A + ++     +Y++SD+  F   AK S+ QEV  +    +L  + V + DP++RL+HEG P++ + K++I H K+NQ LA  +     T FG E+E+ A TFL+ H+ E + NHW+F
Sbjct:    7 YRASVRVGNWMEDVTLEKDSLKDFLYRRDRGELTVQKTDLLKQTLLKPVSLSVSRDGFLRFGDTVMLVNSGGTDHDPCDPCSLSIVADLSNMKSHPQT-----SSNTGLY------GPFQVGGASGLTPCVRNALIITSVDGTAEGEVLRYEQSFALRTTAAFSGELYMASDHRTFQKCAKSSRLQEVSLVEQADFLCWWRVVYFDPQERLEHEGYPVQGNTKVLITHCKTNQCLAALANHEVWTPFGKEYELVAHTFLDSHKAEQNSNHWLF 268          
BLAST of Cilia-and flagella-associated protein 161 vs. Ensembl Nematostella
Match: EDO42146 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2G6])

HSP 1 Score: 139.813 bits (351), Expect = 3.690e-39
Identity = 82/263 (31.18%), Postives = 131/263 (49.81%), Query Frame = 1
Query:   79 YNSKVLIDSWFDNRILEEEIIKDFLAKRDSGQLMIQKMGSLLKKMSQAASPSTIADGFVRFGDQIQIINIGSDPNMVRLQRITSRPPSVLSIDAADEMLYFRNELPDPSTCTASFKLDPLSRNVFEIVSVDGDKTGKKATYGEPIAFKISSLLGPTMYISSDNCAFVTTAKQSKHQEVCCIGGLSYLSHFNVQHADPRKRLQHEGCPIKASEKIVIKHGKSNQALAVESKFYEKTFFGYEHEVSAFTFLNDHRVEMDYNHWIF 867
            YN  VLI +W ++  LEE+ +KDFL K++ G+L+IQK  +LL  + +    S +                                  +L+ + ++  +     L  P   +AS  L P  RN F IVS +  + G+   YG+P        +G ++ + SD   F   AK+S+ QE       S+ +H+N    DP++RL+++G P+ A+++I+  H K+NQ LA  S+F  +T FG E EV+A T L+ HR E   NHW+ 
Sbjct:    6 YNPSVLIGNWNEDICLEEDKLKDFLDKKEKGELLIQKASNLLGNILKKNPASEV----------------------------------LLTANMSESKMRDAQSLGGPCDISASKSLQPCVRNTFMIVSPELYQEGQVLRYGQPFMLSTLPGVGGSLRMHSDRVTFNKAAKKSRKQECLLTDNSSFTAHWNCLCFDPQQRLENDGMPVPANQRILFNHCKTNQNLACMSEFSFRTPFGREMEVAAHTSLDSHRAETPANHWVI 234          
BLAST of Cilia-and flagella-associated protein 161 vs. Ensembl Nematostella
Match: EDO26000 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TD55])

HSP 1 Score: 70.4774 bits (171), Expect = 2.143e-14
Identity = 56/211 (26.54%), Postives = 98/211 (46.45%), Query Frame = 1
Query:  139 IKDFLAKRDSGQLMIQKMGSLLKKMSQAASPSTIADGFVRFGDQIQIINIGSDPNMVRLQRITSRPPSVLSIDAADEMLYFRNELPDPSTCTASFKLDPLSRNVFEIVSVDGDKTGKKATYGEPIAFKISSLLGPTMYISSDNCAFVTTAKQSKHQEVCCIGGLSYLSHFNVQHADPRKRLQHEGCPIKASEKIVIKHGKSNQALAVESKF 771
            +KDFL K++ G+L+IQK  +LL  + +    S   DG++ FGD + + N  S+               +L+ + ++  +     L  P   +AS  L P  RN F IV        +     E     ++ L    +  S    +F    K+ ++  V  +   S +   N    DP++RL+++G P+ A+++I+  H K+NQ LA  S+F
Sbjct:    4 LKDFLDKKEKGELLIQKASNLLGNILKKTELSVSHDGYLHFGDIVCVYNPASE--------------VLLTANMSESKMRDAQSLGGPCDISASKSLQPCVRNTFMIVRFVRQSLLQGFKDFEGRGGSLTHLADDFILGSLHTSSF----KKRQNLVVANLFLCSLIVFRNCLCFDPQQRLENDGMPVPANQRILFNHCKTNQNLACMSEF 196          
BLAST of Cilia-and flagella-associated protein 161 vs. Ensembl Medaka
Match: cfap161 (cilia and flagella associated protein 161 [Source:NCBI gene;Acc:101173542])

HSP 1 Score: 160.999 bits (406), Expect = 7.538e-47
Identity = 90/265 (33.96%), Postives = 147/265 (55.47%), Query Frame = 1
Query:   79 YNSKVLIDSWFDNRILEEEIIKDFLAKRDSGQLMIQKMGSLLKKMSQAASPSTIADGFVRFGDQIQIINIGSDPNMVRLQRITSRPPSVLSIDAADEMLYFRNELPDPSTC--TASFKLDPLSRNVFEIVSVDGDKTGKKATYGEPIAFKISSLLGPTMYISSDNCAFVTTAKQSKHQEVCCIGGLSYLSHFNVQHADPRKRLQHEGCPIKASEKIVIKHGKSNQALAVESKFYEKTFFGYEHEVSAFTFLNDHRVEMDYNHWIF 867
            Y SKV + +W ++ +L+++ +K++L K++ G+L +QK+  L + M +  + S   DG + FGD + ++N+G+           +R  S +SIDA    L        P +C  TA   + P +R  F + SVDG+  G    + +  A +  S     +Y++SD  +F   AK+S  QEV       +LS + + H DP +RL+HEG P+ A+ K++I H K+NQALAV       T FG E+EV+  TFL+ H++E + NHW+ 
Sbjct:    7 YRSKVKVGNWTEDELLQKDAMKEYLEKKEKGELYVQKIDLLRQNMLKPVNLSVTNDGDLHFGDVVMLVNVGAG----------NRDRSAVSIDADVNSLMTVPSPSIPVSCGVTAGRTIQPCTRTAFIVTSVDGNPEGSVLHFEQHFALRTLSGFAKGLYLTSDMRSFQKCAKKSHLQEVYLDESKCFLSCWKIVHLDPLERLEHEGLPVPANVKVLILHCKTNQALAVLGDQALWTTFGEEYEVTTHTFLDCHKLEQENNHWVL 261          
BLAST of Cilia-and flagella-associated protein 161 vs. Planmine SMEST
Match: SMESG000049898.1 (SMESG000049898.1)

HSP 1 Score: 288.115 bits (736), Expect = 1.450e-98
Identity = 139/139 (100.00%), Postives = 139/139 (100.00%), Query Frame = 1
Query:   46 MSCEIPQIKNQYNSKVLIDSWFDNRILEEEIIKDFLAKRDSGQLMIQKMGSLLKKMSQAASPSTIADGFVRFGDQIQIINIGSDPNMVRLQRITSRPPSVLSIDAADEMLYFRNELPDPSTCTASFKLDPLSRNVFEIV 462
            MSCEIPQIKNQYNSKVLIDSWFDNRILEEEIIKDFLAKRDSGQLMIQKMGSLLKKMSQAASPSTIADGFVRFGDQIQIINIGSDPNMVRLQRITSRPPSVLSIDAADEMLYFRNELPDPSTCTASFKLDPLSRNVFEIV
Sbjct:    1 MSCEIPQIKNQYNSKVLIDSWFDNRILEEEIIKDFLAKRDSGQLMIQKMGSLLKKMSQAASPSTIADGFVRFGDQIQIINIGSDPNMVRLQRITSRPPSVLSIDAADEMLYFRNELPDPSTCTASFKLDPLSRNVFEIV 139          
BLAST of Cilia-and flagella-associated protein 161 vs. Planmine SMEST
Match: SMESG000049902.1 (SMESG000049902.1)

HSP 1 Score: 279.641 bits (714), Expect = 2.545e-95
Identity = 134/134 (100.00%), Postives = 134/134 (100.00%), Query Frame = 1
Query:  547 MYISSDNCAFVTTAKQSKHQEVCCIGGLSYLSHFNVQHADPRKRLQHEGCPIKASEKIVIKHGKSNQALAVESKFYEKTFFGYEHEVSAFTFLNDHRVEMDYNHWIFKGKLLTGGNVDLFDTTKCHXXXXPIRV 948
            MYISSDNCAFVTTAKQSKHQEVCCIGGLSYLSHFNVQHADPRKRLQHEGCPIKASEKIVIKHGKSNQALAVESKFYEKTFFGYEHEVSAFTFLNDHRVEMDYNHWIFKGKLLTGGNVDLFDTTKCHEEEEPIRV
Sbjct:    1 MYISSDNCAFVTTAKQSKHQEVCCIGGLSYLSHFNVQHADPRKRLQHEGCPIKASEKIVIKHGKSNQALAVESKFYEKTFFGYEHEVSAFTFLNDHRVEMDYNHWIFKGKLLTGGNVDLFDTTKCHEEEEPIRV 134          
BLAST of Cilia-and flagella-associated protein 161 vs. Planmine SMEST
Match: SMESG000028972.1 (SMESG000028972.1)

HSP 1 Score: 187.963 bits (476), Expect = 2.385e-57
Identity = 99/284 (34.86%), Postives = 158/284 (55.63%), Query Frame = 1
Query:   70 KNQYNSKVLIDSWFDNRILEEEIIKDFLAKRDSGQLMIQKMGSLLKKMSQAASPSTIADGFVRFGDQIQIINIGSDPNMVRLQRITSRPPSVLSIDAADEMLYFRNELPDPSTCTASFKLDPLSRNVFEIVSVDGDKTGKKATYGEPIAFKISSLLGPTMYISSDNCAFVTTAKQSKHQEVCCIGGLSYLSHFNVQHADPRKRLQHEGCPIKASEKIVIKHGKSNQALAVESKFYEKTFFGYEHEVSAFTFLNDHRVEMDYNHWIFKGKLLTGGNVDLFDTTKC 921
            K  YNS VL+ +WF++  L++E+ KDFL +++ G L+ Q++  +L         S  + G ++FGD+IQ++N GSDP  ++L +   R P+V++I     +   +++  +    TAS  L P SRN+F+I SVDG   G+   YG+P  F+I S      Y+  D      T  +S+H +V       + +H+  +   P+ RL++E   I   + ++++H K+N ALA+E  F   T FG E+E+S  T+LNDH+ EMD N+WIF       G  D  D  KC
Sbjct:    5 KRTYNSSVLVGNWFEDVALKDELTKDFLDRKEKGLLLTQQLKKILGGTDSDVHLSPCSSGHLKFGDRIQLLNAGSDPIAIQLNKAVPRKPTVVNISVPPNVFQKKDDTSNIINVTASQNLKPNSRNIFQIFSVDGTPNGQPVVYGQP--FQICSCNEEKYYLCCDTIQLSETKHKSRHFQVVMSLFDHFNTHWKAEFYHPQMRLENEFTEIPVGKVVILRHLKTNHALALEKDFASLTLFGNEYEISTQTYLNDHKAEMDVNYWIF-------GASDQTDIEKC 279          
The following BLAST results are available for this feature:
BLAST of Cilia-and flagella-associated protein 161 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CFAP1619.417e-4633.81cilia and flagella associated protein 161 [Source:... [more]
CFAP1612.699e-830.09cilia and flagella associated protein 161 [Source:... [more]
CFAP1615.656e-728.70cilia and flagella associated protein 161 [Source:... [more]
back to top
BLAST of Cilia-and flagella-associated protein 161 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cilia-and flagella-associated protein 161 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG344571.522e-1626.11gene:FBgn0085486 transcript:FBtr0345621[more]
CG344571.522e-1626.11gene:FBgn0085486 transcript:FBtr0112763[more]
CG154981.222e-1527.99gene:FBgn0038892 transcript:FBtr0084122[more]
back to top
BLAST of Cilia-and flagella-associated protein 161 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cfap1613.047e-5234.20cilia and flagella associated protein 161 [Source:... [more]
back to top
BLAST of Cilia-and flagella-associated protein 161 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
med311.613e-5135.02mediator complex subunit 31 [Source:Xenbase;Acc:XB... [more]
med314.473e-5035.23mediator complex subunit 31 [Source:Xenbase;Acc:XB... [more]
back to top
BLAST of Cilia-and flagella-associated protein 161 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Cfap1616.017e-4132.26cilia and flagella associated protein 161 [Source:... [more]
Cfap1618.109e-3030.29cilia and flagella associated protein 161 [Source:... [more]
Cfap1613.990e-1026.99cilia and flagella associated protein 161 [Source:... [more]
back to top
BLAST of Cilia-and flagella-associated protein 161 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q568D2|CF161_DANRE1.325e-5034.20Cilia- and flagella-associated protein 161 OS=Dani... [more]
sp|Q6P656|CF161_HUMAN4.522e-4533.81Cilia- and flagella-associated protein 161 OS=Homo... [more]
sp|Q6P8Y0|CF161_MOUSE4.209e-4032.26Cilia- and flagella-associated protein 161 OS=Mus ... [more]
back to top
BLAST of Cilia-and flagella-associated protein 161 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8GTE21.948e-6439.29Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8FZ293.116e-6439.29Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A401PDG13.299e-5237.69Uncharacterized protein OS=Scyliorhinus torazame O... [more]
A0A1S3HAD96.963e-5236.92cilia- and flagella-associated protein 161 OS=Ling... [more]
A0A1W3JP621.069e-5136.36cilia- and flagella-associated protein 161-like is... [more]
back to top
BLAST of Cilia-and flagella-associated protein 161 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cfap1615.659e-4632.97cilia and flagella associated protein 161 [Source:... [more]
back to top
BLAST of Cilia-and flagella-associated protein 161 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cilia-and flagella-associated protein 161 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cilia-and flagella-associated protein 161 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO421463.690e-3931.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO260002.143e-1426.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cilia-and flagella-associated protein 161 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cfap1617.538e-4733.96cilia and flagella associated protein 161 [Source:... [more]
back to top
BLAST of Cilia-and flagella-associated protein 161 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000049898.11.450e-98100.00SMESG000049898.1[more]
SMESG000049902.12.545e-95100.00SMESG000049902.1[more]
SMESG000028972.12.385e-5734.86SMESG000028972.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035724 ID=SMED30035724|Name=Cilia-and flagella-associated protein 161|organism=Schmidtea mediterranea sexual|type=transcript|length=1032bp
AATTTAAAAATTTAAAAATAACTTAATTATATAACATAAAATAAAATGTC
CTGCGAAATTCCTCAGATCAAAAATCAGTACAACTCCAAGGTGCTCATTG
ACAGCTGGTTTGACAATCGGATCTTGGAAGAGGAAATAATCAAAGATTTT
CTGGCCAAGCGAGACAGCGGACAGCTGATGATTCAAAAGATGGGGTCGCT
TTTGAAAAAAATGTCTCAGGCGGCTTCTCCGAGTACCATTGCTGATGGAT
TTGTTCGTTTTGGAGATCAAATTCAAATAATAAACATTGGGTCAGATCCA
AATATGGTGAGATTACAAAGAATTACTTCGAGACCACCATCTGTGCTGAG
TATCGATGCTGCCGATGAGATGTTGTATTTTCGAAACGAACTGCCGGATC
CGAGTACCTGCACCGCTTCTTTTAAGCTTGATCCGTTGTCCAGAAATGTT
TTTGAAATCGTAAGCGTTGACGGCGATAAAACCGGAAAGAAAGCAACTTA
CGGAGAGCCCATTGCATTCAAGATATCGTCACTTTTAGGGCCCACTATGT
ACATATCCAGTGACAACTGTGCCTTTGTTACAACGGCAAAACAATCTAAA
CATCAAGAAGTATGTTGCATCGGTGGACTTAGCTATTTGAGTCATTTCAA
TGTCCAGCATGCCGACCCGAGAAAAAGGCTTCAACACGAAGGGTGTCCTA
TTAAGGCGAGTGAGAAAATCGTCATAAAGCATGGGAAAAGCAATCAAGCT
CTGGCCGTTGAGAGCAAGTTTTATGAAAAGACTTTTTTCGGCTATGAGCA
CGAAGTGTCGGCTTTCACCTTTCTTAATGATCACAGAGTGGAGATGGACT
ACAATCACTGGATATTCAAAGGAAAACTTCTGACCGGCGGTAATGTTGAT
TTGTTTGATACGACCAAGTGCCACGAAGAAGAGGAACCAATTCGTGTTTA
AATATAAATTTGACGTTGGATAAAGTGATTGATGCGTAGGTGATTAATAT
GGATGTCGCAATTTATTAAATATAGCTATTCG
back to top

protein sequence of SMED30035724-orf-1

>SMED30035724-orf-1 ID=SMED30035724-orf-1|Name=SMED30035724-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=302bp
MSCEIPQIKNQYNSKVLIDSWFDNRILEEEIIKDFLAKRDSGQLMIQKMG
SLLKKMSQAASPSTIADGFVRFGDQIQIINIGSDPNMVRLQRITSRPPSV
LSIDAADEMLYFRNELPDPSTCTASFKLDPLSRNVFEIVSVDGDKTGKKA
TYGEPIAFKISSLLGPTMYISSDNCAFVTTAKQSKHQEVCCIGGLSYLSH
FNVQHADPRKRLQHEGCPIKASEKIVIKHGKSNQALAVESKFYEKTFFGY
EHEVSAFTFLNDHRVEMDYNHWIFKGKLLTGGNVDLFDTTKCHEEEEPIR
V*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
PLANA:0000429neoblast
PLANA:0002030early male germ cell
PLANA:0002109X1 cell
PLANA:0003304testis primordium
Vocabulary: cellular component
TermDefinition
GO:0031514motile cilium
Vocabulary: biological process
TermDefinition
GO:0060271cilium morphogenesis
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:2.80.10.50coord: 137..294
e-value: 1.8E-6
score: 29.5
NoneNo IPR availablePANTHERPTHR24274:SF1CILIA- AND FLAGELLA-ASSOCIATED PROTEIN 161coord: 10..278
NoneNo IPR availablePANTHERPTHR24274FAMILY NOT NAMEDcoord: 10..278