nesprin-1-like

Overview
Namenesprin-1-like
Smed IDSMED30035723
Length (bp)19186
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of nesprin-1-like (SMED30035723) t-SNE clustered cells

Violin plots show distribution of expression levels for nesprin-1-like (SMED30035723) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of nesprin-1-like (SMED30035723) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for nesprin-1-like (SMED30035723) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035723

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 56

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30035723SMESG000023320.1 SmedASXL_000891SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30035723SMESG000023320.1 SmedASXL_003601SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30035723SMESG000023320.1 SmedASXL_017453SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30035723SMESG000023320.1 SmedASXL_019912SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30035723SMESG000023320.1 SmedASXL_007291SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30035723SMESG000023320.1 SmedASXL_017454SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30035723SMESG000023320.1 dd_Smed_v4_10282_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30035723SMESG000023320.1 dd_Smed_v4_10282_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035723SMESG000023320.1 dd_Smed_v4_10282_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035723SMESG000023320.1 dd_Smed_v4_10282_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30035723SMESG000023320.1 dd_Smed_v4_10282_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30035723SMESG000023320.1 dd_Smed_v4_10282_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30035723SMESG000023320.1 dd_Smed_v4_10282_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30035723SMESG000023320.1 dd_Smed_v4_10282_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30035723SMESG000023320.1 dd_Smed_v4_10282_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30035723SMESG000023320.1 dd_Smed_v4_20714_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035723SMESG000023320.1 dd_Smed_v4_20714_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30035723SMESG000023320.1 dd_Smed_v4_39583_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035723SMESG000023320.1 dd_Smed_v4_39583_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30035723SMESG000023320.1 dd_Smed_v4_44969_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035723SMESG000023320.1 dd_Smed_v4_44969_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30035723SMESG000023320.1 dd_Smed_v4_44969_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30035723SMESG000023320.1 dd_Smed_v4_51249_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035723SMESG000023320.1 dd_Smed_v4_51249_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30035723SMESG000023320.1 dd_Smed_v4_51249_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30035723SMESG000023320.1 dd_Smed_v4_64459_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035723SMESG000023320.1 dd_Smed_v4_64459_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30035723SMESG000023320.1 dd_Smed_v4_64459_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30035723SMESG000023320.1 dd_Smed_v4_47116_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30035723SMESG000023320.1 dd_Smed_v4_47116_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035723SMESG000023320.1 dd_Smed_v4_47116_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035723SMESG000023320.1 Contig15287uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035723SMESG000023320.1 Contig15287newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035723SMESG000023320.1 Contig30479uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035723SMESG000023320.1 Contig30479newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30035723SMESG000023320.1 dd_Smed_v6_10282_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
GABAergic neuronSMED30035723SMESG000023320.1 dd_Smed_v6_10282_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035723SMESG000023320.1 dd_Smed_v4_10282_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30035723SMESG000023320.1 dd_Smed_v4_20714_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30035723SMESG000023320.1 dd_Smed_v4_20344_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30035723SMESG000023320.1 dd_Smed_v4_20344_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035723SMESG000023320.1 dd_Smed_v4_20344_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30035723SMESG000023320.1 dd_Smed_v4_20344_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035723SMESG000023320.1 Contig44840uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035723SMESG000023320.1 Contig44840newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035723SMESG000023320.1 Contig38395uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035723SMESG000023320.1 Contig38395newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035723SMESG000030062.1 SMESG000023320.1 Contig45274uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035723SMESG000030062.1 SMESG000023320.1 Contig45274newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30035723SMESG000023320.1 dd_Smed_v4_26396_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035723SMESG000023320.1 dd_Smed_v4_26396_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30035723SMESG000023320.1 dd_Smed_v4_26396_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30035723SMESG000023320.1 dd_Smed_v4_43173_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035723SMESG000023320.1 dd_Smed_v4_43173_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30035723SMESG000023320.1 dd_Smed_v4_43173_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30035723SMESG000023320.1 dd_Smed_v4_39583_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of nesprin-1-like vs. Ensembl Human
Match: SYNE1 (spectrin repeat containing nuclear envelope protein 1 [Source:HGNC Symbol;Acc:HGNC:17089])

HSP 1 Score: 215.312 bits (547), Expect = 5.072e-59
Identity = 125/281 (44.48%), Postives = 189/281 (67.26%), Query Frame = 1
Query:  217 RQIRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFL--KDTMH----IKLINIHAADIVDGRPNIILGLVWQIILNFQIK--SENMFKL--------------IAQRDSNPTRRE--NLVKGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPDQDIHKNSA 987
            +++++E E +QK+TFTKWIN+ L+K+ P   + +L+ D+ DG++LL LL++L+ QKL  E+ + M+R+H +AN+ + + FL  + +MH    IKL+NI++ DI DGRP+I+LGL+W IIL FQI+  + N+ +L               ++  S P++R+    ++GN ++ALL W      +  GI + DF  SW+ G AF+++IH I P LVD + +K R++RENLE AF +AE  L IP+LL+PEDVDVD PDEKSIMTY++ FL +YP  DIH  S 
Sbjct:    2 QRLQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDGVKLLALLEVLSGQKLPCEQGRRMKRIHAVANIGTALKFLEGRKSMHRGSPIKLVNINSTDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSSSASSVDSIVSSETPSPPSKRKVTTKIQGNAKKALLKWVQYTAGKQTGIEVKDFGKSWRSGVAFHSVIHAIRPELVDLETVKGRSNRENLEDAFTIAETELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYP--DIHNAST 280          
BLAST of nesprin-1-like vs. Ensembl Human
Match: SYNE1 (spectrin repeat containing nuclear envelope protein 1 [Source:HGNC Symbol;Acc:HGNC:17089])

HSP 1 Score: 215.698 bits (548), Expect = 9.972e-58
Identity = 123/275 (44.73%), Postives = 186/275 (67.64%), Query Frame = 1
Query:  217 RQIRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIK--SENMFKL--------------IAQRDSNPTRRE--NLVKGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPDQDIHKNSA 987
            +++++E E +QK+TFTKWIN+ L+K+ P   + +L+ D+ DG++LL LL++L+ QKL  E+ + M+R+H +AN+ + + FL +   IKL+NI++ DI DGRP+I+LGL+W IIL FQI+  + N+ +L               ++  S P++R+    ++GN ++ALL W      +  GI + DF  SW+ G AF+++IH I P LVD + +K R++RENLE AF +AE  L IP+LL+PEDVDVD PDEKSIMTY++ FL +YP  DIH  S 
Sbjct:   19 QRLQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDGVKLLALLEVLSGQKLPCEQGRRMKRIHAVANIGTALKFL-EGRKIKLVNINSTDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSSSASSVDSIVSSETPSPPSKRKVTTKIQGNAKKALLKWVQYTAGKQTGIEVKDFGKSWRSGVAFHSVIHAIRPELVDLETVKGRSNRENLEDAFTIAETELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYP--DIHNAST 290          
BLAST of nesprin-1-like vs. Ensembl Human
Match: SYNE1 (spectrin repeat containing nuclear envelope protein 1 [Source:HGNC Symbol;Acc:HGNC:17089])

HSP 1 Score: 216.853 bits (551), Expect = 3.650e-57
Identity = 126/279 (45.16%), Postives = 187/279 (67.03%), Query Frame = 1
Query:  223 IRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFL--KDTMH----IKLINIHAADIVDGRPNIILGLVWQIILNFQIK--SENMFKL--------------IAQRDSNPTRRE--NLVKGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPDQDIHKNSA 987
            I++E E +QK+TFTKWIN+ L+K+ P   + +L+ D+ DG++LL LL++L+ QKL  E+ + M+R+H +AN+ + + FL  + +MH    IKL+NI++ DI DGRP+I+LGL+W IIL FQI+  + N+ +L               ++  S P++R+    ++GN ++ALL W      +  GI + DF  SW+ G AF+++IH I P LVD + +K R++RENLE AF +AE  L IP+LL+PEDVDVD PDEKSIMTY++ FL +YP  DIH  S 
Sbjct:   12 IKDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDGVKLLALLEVLSGQKLPCEQGRRMKRIHAVANIGTALKFLEGRKSMHRGSPIKLVNINSTDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSSSASSVDSIVSSETPSPPSKRKVTTKIQGNAKKALLKWVQYTAGKQTGIEVKDFGKSWRSGVAFHSVIHAIRPELVDLETVKGRSNRENLEDAFTIAETELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYP--DIHNAST 288          
BLAST of nesprin-1-like vs. Ensembl Human
Match: SYNE1 (spectrin repeat containing nuclear envelope protein 1 [Source:HGNC Symbol;Acc:HGNC:17089])

HSP 1 Score: 215.312 bits (547), Expect = 1.346e-56
Identity = 123/275 (44.73%), Postives = 186/275 (67.64%), Query Frame = 1
Query:  217 RQIRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIK--SENMFKL--------------IAQRDSNPTRRE--NLVKGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPDQDIHKNSA 987
            +++++E E +QK+TFTKWIN+ L+K+ P   + +L+ D+ DG++LL LL++L+ QKL  E+ + M+R+H +AN+ + + FL +   IKL+NI++ DI DGRP+I+LGL+W IIL FQI+  + N+ +L               ++  S P++R+    ++GN ++ALL W      +  GI + DF  SW+ G AF+++IH I P LVD + +K R++RENLE AF +AE  L IP+LL+PEDVDVD PDEKSIMTY++ FL +YP  DIH  S 
Sbjct:   19 QRLQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDGVKLLALLEVLSGQKLPCEQGRRMKRIHAVANIGTALKFL-EGRKIKLVNINSTDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSSSASSVDSIVSSETPSPPSKRKVTTKIQGNAKKALLKWVQYTAGKQTGIEVKDFGKSWRSGVAFHSVIHAIRPELVDLETVKGRSNRENLEDAFTIAETELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYP--DIHNAST 290          
BLAST of nesprin-1-like vs. Ensembl Human
Match: SYNE1 (spectrin repeat containing nuclear envelope protein 1 [Source:HGNC Symbol;Acc:HGNC:17089])

HSP 1 Score: 218.779 bits (556), Expect = 9.729e-56
Identity = 126/279 (45.16%), Postives = 187/279 (67.03%), Query Frame = 1
Query:  223 IRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFL--KDTMH----IKLINIHAADIVDGRPNIILGLVWQIILNFQIK--SENMFKL--------------IAQRDSNPTRRE--NLVKGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPDQDIHKNSA 987
            I++E E +QK+TFTKWIN+ L+K+ P   + +L+ D+ DG++LL LL++L+ QKL  E+ + M+R+H +AN+ + + FL  + +MH    IKL+NI++ DI DGRP+I+LGL+W IIL FQI+  + N+ +L               ++  S P++R+    ++GN ++ALL W      +  GI + DF  SW+ G AF+++IH I P LVD + +K R++RENLE AF +AE  L IP+LL+PEDVDVD PDEKSIMTY++ FL +YP  DIH  S 
Sbjct:   12 IKDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDGVKLLALLEVLSGQKLPCEQGRRMKRIHAVANIGTALKFLEGRKSMHRGSPIKLVNINSTDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSSSASSVDSIVSSETPSPPSKRKVTTKIQGNAKKALLKWVQYTAGKQTGIEVKDFGKSWRSGVAFHSVIHAIRPELVDLETVKGRSNRENLEDAFTIAETELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYP--DIHNAST 288          
BLAST of nesprin-1-like vs. Ensembl Celegans
Match: unc-70 (Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:E0AHA7])

HSP 1 Score: 164.466 bits (415), Expect = 2.221e-39
Identity = 107/269 (39.78%), Postives = 158/269 (58.74%), Query Frame = 1
Query:  151 TSQSKVDKNCV*KLSMLIRTRGRQIRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIKSENMFKLIAQRDSNPTRRENLVKGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNY 957
            TS    D  C  K    +  R R +R+E E +QKKTFTKW+N+ L +     K+Q+LY+D+ DG  LL LL +L+ ++L       M R+HCL N+   + FL++  H+ L N+ + DIVDG   + LGL+W IIL FQI+           D++ TR       + +EALL W          +++ +F +SW+DG AFNA+IH   P+LVD+D +++ N+  NL+ AF  AE  L + K L+ EDV+VD PDEKSI+TY+  + H +
Sbjct:   79 TSAEVSDSVCGQKSINSVDLRFRGLRDERELVQKKTFTKWVNSHLVRVSC--KVQDLYMDMRDGKMLLRLLAVLSGERLPKPTPGKM-RIHCLENVEKGLQFLRN-QHVHLENLGSHDIVDGNSRLTLGLIWTIILRFQIQD----ITFEDADNHETR-------SAKEALLLWCQMKTAGYPNVNVKNFSTSWRDGLAFNALIHKHRPDLVDYDNLQKSNALYNLQSAFDTAENQLGLAKFLDAEDVNVDQPDEKSIITYVVTYYHYF 332          
BLAST of nesprin-1-like vs. Ensembl Celegans
Match: unc-70 (Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:E0AHA7])

HSP 1 Score: 163.31 bits (412), Expect = 4.319e-39
Identity = 109/275 (39.64%), Postives = 165/275 (60.00%), Query Frame = 1
Query:  136 NS*IFTSQSKVDKNCV*KLSMLIRTRGRQIRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIKSENMFKLIAQRDSNPTRRENLVKGNPREALLAWSDKVITENY-GISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNY 957
            NS  +T     D N   +L    R+R + + +E E +QKKTFTKW+N+ L +     K+Q+LY+D+ DG  LL LL +L+ ++L       M R+HCL N+   + FL++  H+ L N+ + DIVDG   + LGL+W IIL FQI+           D++ TR       + +EALL W  ++ T  Y  +++ +F +SW+DG AFNA+IH   P+LVD+D +++ N+  NL+ AF  AE  L + K L+ EDV+VD PDEKSI+TY+  + H +
Sbjct:    7 NSGAYTQDEDYDDNSSARL--FERSRIKALADERELVQKKTFTKWVNSHLVRVSC--KVQDLYMDMRDGKMLLRLLAVLSGERLPKPTPGKM-RIHCLENVEKGLQFLRN-QHVHLENLGSHDIVDGNSRLTLGLIWTIILRFQIQD----ITFEDADNHETR-------SAKEALLLWC-QMKTAGYPNVNVKNFSTSWRDGLAFNALIHKHRPDLVDYDNLQKSNALYNLQSAFDTAENQLGLAKFLDAEDVNVDQPDEKSIITYVVTYYHYF 263          
BLAST of nesprin-1-like vs. Ensembl Celegans
Match: unc-70 (Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:E0AHA7])

HSP 1 Score: 163.31 bits (412), Expect = 4.361e-39
Identity = 109/275 (39.64%), Postives = 165/275 (60.00%), Query Frame = 1
Query:  136 NS*IFTSQSKVDKNCV*KLSMLIRTRGRQIRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIKSENMFKLIAQRDSNPTRRENLVKGNPREALLAWSDKVITENY-GISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNY 957
            NS  +T     D N   +L    R+R + + +E E +QKKTFTKW+N+ L +     K+Q+LY+D+ DG  LL LL +L+ ++L       M R+HCL N+   + FL++  H+ L N+ + DIVDG   + LGL+W IIL FQI+           D++ TR       + +EALL W  ++ T  Y  +++ +F +SW+DG AFNA+IH   P+LVD+D +++ N+  NL+ AF  AE  L + K L+ EDV+VD PDEKSI+TY+  + H +
Sbjct:    7 NSGAYTQDEDYDDNSSARL--FERSRIKALADERELVQKKTFTKWVNSHLVRVSC--KVQDLYMDMRDGKMLLRLLAVLSGERLPKPTPGKM-RIHCLENVEKGLQFLRN-QHVHLENLGSHDIVDGNSRLTLGLIWTIILRFQIQD----ITFEDADNHETR-------SAKEALLLWC-QMKTAGYPNVNVKNFSTSWRDGLAFNALIHKHRPDLVDYDNLQKSNALYNLQSAFDTAENQLGLAKFLDAEDVNVDQPDEKSIITYVVTYYHYF 263          
BLAST of nesprin-1-like vs. Ensembl Celegans
Match: unc-70 (Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:E0AHA7])

HSP 1 Score: 163.31 bits (412), Expect = 5.054e-39
Identity = 107/274 (39.05%), Postives = 161/274 (58.76%), Query Frame = 1
Query:  136 NS*IFTSQSKVDKNCV*KLSMLIRTRGRQIRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIKSENMFKLIAQRDSNPTRRENLVKGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNY 957
            NS  +T     D N   +L    R+R + + +E E +QKKTFTKW+N+ L +     K+Q+LY+D+ DG  LL LL +L+ ++L       M R+HCL N+   + FL++  H+ L N+ + DIVDG   + LGL+W IIL FQI+           D++ TR       + +EALL W          +++ +F +SW+DG AFNA+IH   P+LVD+D +++ N+  NL+ AF  AE  L + K L+ EDV+VD PDEKSI+TY+  + H +
Sbjct:    7 NSGAYTQDEDYDDNSSARL--FERSRIKALADERELVQKKTFTKWVNSHLVRVSC--KVQDLYMDMRDGKMLLRLLAVLSGERLPKPTPGKM-RIHCLENVEKGLQFLRN-QHVHLENLGSHDIVDGNSRLTLGLIWTIILRFQIQD----ITFEDADNHETR-------SAKEALLLWCQMKTAGYPNVNVKNFSTSWRDGLAFNALIHKHRPDLVDYDNLQKSNALYNLQSAFDTAENQLGLAKFLDAEDVNVDQPDEKSIITYVVTYYHYF 263          
BLAST of nesprin-1-like vs. Ensembl Celegans
Match: sma-1 (SMAll [Source:UniProtKB/TrEMBL;Acc:G5EFW3])

HSP 1 Score: 159.844 bits (403), Expect = 7.056e-38
Identity = 106/263 (40.30%), Postives = 159/263 (60.46%), Query Frame = 1
Query:  205 RTRGRQIRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIKSENMFKLIAQRDSNPTRRENLVKGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPDQDIHKNSAPK 993
            R+R R +++E  HIQKKTFTKW N+ L++   E  I +L+ D+ DGI L++LL+I++  KL    R  M RV  + N+  ++ FLK    I+L NI A DI+D    +ILGL+W IIL FQI +     +I   +    R+      + ++ALL W  +       + I +F +SW++G AFNA+IH+  P+LVD++ +      +NL +AF +AEK L I +LL+ EDVDV  PDEKSI+TY+SL+ H++  Q      A +
Sbjct:  142 RSRIRTLQDERVHIQKKTFTKWCNSFLNRASLE--IVDLFEDVGDGIMLMKLLEIISGDKLGKPNRGRM-RVQKVENLNKVLDFLKKK-KIQLENIGAEDILDRNERLILGLIWTIILRFQIDT----IVIEDEEERGERK------HAKDALLLWCQRKTAGYPNVRIENFTTSWRNGLAFNALIHSHRPDLVDFNRLNPNEHVDNLNHAFDVAEKKLEIARLLDAEDVDVTRPDEKSIITYVSLYYHHFAKQKTEMTGARR 390          
BLAST of nesprin-1-like vs. Ensembl Fly
Match: Msp300 (gene:FBgn0261836 transcript:FBtr0303388)

HSP 1 Score: 191.815 bits (486), Expect = 2.173e-47
Identity = 113/262 (43.13%), Postives = 168/262 (64.12%), Query Frame = 1
Query:  220 QIRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIK--SENMFKL-------IAQRDSNPTRRENLVKG-----NPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPD 963
            Q++ E E +QKKTFT WIN+ L K+ P  +I +L  DL DG +L+ LL++L+ ++L +EK + ++R H L+N  + + FL  +  IKL+NI+ AD+VDGRP ++LGL+W IIL FQI+  S N+  L       ++  DS   ++   +K        R+ LL W    + ++ G+ + DF +SW+DG AF A+I  I  NLV+   +K+ ++R+ LE AF +AE  L I KLL+ EDVDV  PDEKSIMTY++ FLH YP+
Sbjct:  264 QLQEEQERVQKKTFTNWINSYLLKRVPPLRIDDLINDLRDGTKLIALLEVLSGERLPVEKGRVLRRPHFLSNANTALQFLA-SKRIKLVNINPADLVDGRPPVVLGLIWTIILYFQIEENSRNLEYLGHGIGGSVSSLDSVGNQKHGDLKAEKWKQGARKTLLNWVTNALPKDSGVEVKDFGASWRDGVAFLALIDAIKANLVNLAELKKTSNRQRLETAFDVAESKLGIAKLLDAEDVDVPKPDEKSIMTYVAQFLHKYPE 524          

HSP 2 Score: 74.3294 bits (181), Expect = 5.058e-12
Identity = 152/735 (20.68%), Postives = 310/735 (42.18%), Query Frame = 1
Query: 15007 RFEEYESKFKEFLNWLVSYENL---YNTKVSSSSLEDKQTSLAQFQSNLQNIFEHKSNLNELIEKG------------AKFPLNFSIKYNTKDIQIRYPILLKSAQNRIE-YLAKSVENHEIYEKDKSTFQTFCQKFNYELKSLKEEKMEIGNLKEIFAKLTAMDIEIRKMEQSRSALEVGFNV----------VLVETSEIGKKELSSQHLGLLKSFEKFLIDYDEFKSLISKEKKTENNFIKQLEHFSIGLESLIQTMLNLNPS---SQIHISSLQNCHEGLEKFSEELKRRSSSFDQLITNYDINKSEIVSDLITTIDTELKSASNSLAEK------------RAHVNLLLET-------NQAYQEYFDRLSNWLSNTYSRIQESSDLYGPQSVISQRSDNLNRIQLSIQTEGETLLKAVIERADELNRIILDRTNKEKLSDQVSKCQGEFYNVSNKLENIKTKVND----LETQWKNFDTNIKLLNKVNKVFANRKERF------RNMKYSYFLNINAEIEKILDLVKDIEEEKSNLEIFSNQI-------QSLIDVSQEAQLDTIYQDLIDQIDGHEIDCKSLLDMMRQMGNEKSAFDQQVQNTQLMIDAMKAQLLPIDQLHNIASFNDYQKIFREFQL---LESKLIDGDRMVDECFQMFYKLSVLF--DSEKALNDMISLLKKNWDG----HKEKFDEVKTRMNRLLNLWSNLENLRIPIEEWIQTTE 16989
            ++ +Y+ ++ E L WL   E L   YN      SL  K+  L QFQ +LQ +F+ +  L++L  K             +   +  + KYN          L K    R+E +  +  ++H +YE+        CQ +      +++ + ++   ++I   L  + I++  ++  R   E G N           V++ T + G  ++      L + F+K L+D ++ +  ++       N + QLE      + LI+ + ++ PS   S   ++ L      LEKF              +   DIN     +D++  I+  LK   NSL  K            +  VN ++E+       ++ Y++ ++ L +WL  T   +++ +D +G +  +  R + L  IQ S   EG    KA++E  +EL++ ++  +  E   D V++   E  +++++ E ++T   D    LE+    + T ++  NK+N       +R        N      +N    +E++L    ++E+   N E+   Q        Q++   +   +L T  Q L+ +I+ +  D    L+  ++M       D  ++  Q ++D             + ++  D   I ++      L S+L +G  ++      + K S +   D ++ L ++++ ++++WD      K+K  ++K   NR    W++    +  +E+W+  TE
Sbjct: 5326 KWSDYQDQYTEALEWLSKTEALVQSYNK--LQDSLIQKKVVLEQFQGHLQTLFDWQKTLDDLNMKAQVLLETCSDTRISNAIMQLTTKYNA------LLTLAKEVMRRLEMHYQEHQQHHSLYEE--------CQSW------IEKTREKLSECEQIPGTLNEVQIKLNTVKNLRQGFETGQNKLRYLLELKEKVIMNTEQNGAAKIQEDTEALKQDFDKLLVDLNDVRQKLA-------NRLAQLEEIFKLYKILIEWLEDVEPSVKTSDEFLNDLSEKRAALEKFR-------------VIQRDINGH---NDIVEKINQRLKE-DNSLDLKDFQPGLTKFDDLQTQVNKIIESLENQVNSHEKYKQAYNELQDWLRRTRIEVEQCADCHGEKDQVESRLNRLGDIQ-SSSLEG----KALLEACEELSQAVIATSGSEG-QDNVAQ---EIKHLTSEWETLQTISRDARSSLESCLAAWQTFLQKFNKINLWIETMNKRVTKSQEGENKTPEDLVNAKKLLEEVLAEKDNVEDLNDNCELLMEQSACTRIRDQTIETQANYTKLLTSAQGLVAKIEKNLSDHTEFLNYKKEM-------DAWIEKAQQVLD-------------DCSTDGDAAIIAQKLDTVNSLASRLPEGQHLLALVQDAYSKASNITPEDKQEKLRELMTKVREDWDALGLAVKQKLSDLKQAQNR----WNDFAANKDKLEKWLNETE 5981          
BLAST of nesprin-1-like vs. Ensembl Fly
Match: Msp300 (gene:FBgn0261836 transcript:FBtr0332404)

HSP 1 Score: 191.815 bits (486), Expect = 2.209e-47
Identity = 113/262 (43.13%), Postives = 168/262 (64.12%), Query Frame = 1
Query:  220 QIRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIK--SENMFKL-------IAQRDSNPTRRENLVKG-----NPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPD 963
            Q++ E E +QKKTFT WIN+ L K+ P  +I +L  DL DG +L+ LL++L+ ++L +EK + ++R H L+N  + + FL  +  IKL+NI+ AD+VDGRP ++LGL+W IIL FQI+  S N+  L       ++  DS   ++   +K        R+ LL W    + ++ G+ + DF +SW+DG AF A+I  I  NLV+   +K+ ++R+ LE AF +AE  L I KLL+ EDVDV  PDEKSIMTY++ FLH YP+
Sbjct:  264 QLQEEQERVQKKTFTNWINSYLLKRVPPLRIDDLINDLRDGTKLIALLEVLSGERLPVEKGRVLRRPHFLSNANTALQFLA-SKRIKLVNINPADLVDGRPPVVLGLIWTIILYFQIEENSRNLEYLGHGIGGSVSSLDSVGNQKHGDLKAEKWKQGARKTLLNWVTNALPKDSGVEVKDFGASWRDGVAFLALIDAIKANLVNLAELKKTSNRQRLETAFDVAESKLGIAKLLDAEDVDVPKPDEKSIMTYVAQFLHKYPE 524          

HSP 2 Score: 74.3294 bits (181), Expect = 5.879e-12
Identity = 152/735 (20.68%), Postives = 310/735 (42.18%), Query Frame = 1
Query: 15007 RFEEYESKFKEFLNWLVSYENL---YNTKVSSSSLEDKQTSLAQFQSNLQNIFEHKSNLNELIEKG------------AKFPLNFSIKYNTKDIQIRYPILLKSAQNRIE-YLAKSVENHEIYEKDKSTFQTFCQKFNYELKSLKEEKMEIGNLKEIFAKLTAMDIEIRKMEQSRSALEVGFNV----------VLVETSEIGKKELSSQHLGLLKSFEKFLIDYDEFKSLISKEKKTENNFIKQLEHFSIGLESLIQTMLNLNPS---SQIHISSLQNCHEGLEKFSEELKRRSSSFDQLITNYDINKSEIVSDLITTIDTELKSASNSLAEK------------RAHVNLLLET-------NQAYQEYFDRLSNWLSNTYSRIQESSDLYGPQSVISQRSDNLNRIQLSIQTEGETLLKAVIERADELNRIILDRTNKEKLSDQVSKCQGEFYNVSNKLENIKTKVND----LETQWKNFDTNIKLLNKVNKVFANRKERF------RNMKYSYFLNINAEIEKILDLVKDIEEEKSNLEIFSNQI-------QSLIDVSQEAQLDTIYQDLIDQIDGHEIDCKSLLDMMRQMGNEKSAFDQQVQNTQLMIDAMKAQLLPIDQLHNIASFNDYQKIFREFQL---LESKLIDGDRMVDECFQMFYKLSVLF--DSEKALNDMISLLKKNWDG----HKEKFDEVKTRMNRLLNLWSNLENLRIPIEEWIQTTE 16989
            ++ +Y+ ++ E L WL   E L   YN      SL  K+  L QFQ +LQ +F+ +  L++L  K             +   +  + KYN          L K    R+E +  +  ++H +YE+        CQ +      +++ + ++   ++I   L  + I++  ++  R   E G N           V++ T + G  ++      L + F+K L+D ++ +  ++       N + QLE      + LI+ + ++ PS   S   ++ L      LEKF              +   DIN     +D++  I+  LK   NSL  K            +  VN ++E+       ++ Y++ ++ L +WL  T   +++ +D +G +  +  R + L  IQ S   EG    KA++E  +EL++ ++  +  E   D V++   E  +++++ E ++T   D    LE+    + T ++  NK+N       +R        N      +N    +E++L    ++E+   N E+   Q        Q++   +   +L T  Q L+ +I+ +  D    L+  ++M       D  ++  Q ++D             + ++  D   I ++      L S+L +G  ++      + K S +   D ++ L ++++ ++++WD      K+K  ++K   NR    W++    +  +E+W+  TE
Sbjct: 5326 KWSDYQDQYTEALEWLSKTEALVQSYNK--LQDSLIQKKVVLEQFQGHLQTLFDWQKTLDDLNMKAQVLLETCSDTRISNAIMQLTTKYNA------LLTLAKEVMRRLEMHYQEHQQHHSLYEE--------CQSW------IEKTREKLSECEQIPGTLNEVQIKLNTVKNLRQGFETGQNKLRYLLELKEKVIMNTEQNGAAKIQEDTEALKQDFDKLLVDLNDVRQKLA-------NRLAQLEEIFKLYKILIEWLEDVEPSVKTSDEFLNDLSEKRAALEKFR-------------VIQRDINGH---NDIVEKINQRLKE-DNSLDLKDFQPGLTKFDDLQTQVNKIIESLENQVNSHEKYKQAYNELQDWLRRTRIEVEQCADCHGEKDQVESRLNRLGDIQ-SSSLEG----KALLEACEELSQAVIATSGSEG-QDNVAQ---EIKHLTSEWETLQTISRDARSSLESCLAAWQTFLQKFNKINLWIETMNKRVTKSQEGENKTPEDLVNAKKLLEEVLAEKDNVEDLNDNCELLMEQSACTRIRDQTIETQANYTKLLTSAQGLVAKIEKNLSDHTEFLNYKKEM-------DAWIEKAQQVLD-------------DCSTDGDAAIIAQKLDTVNSLASRLPEGQHLLALVQDAYSKASNITPEDKQEKLRELMTKVREDWDALGLAVKQKLSDLKQAQNR----WNDFAANKDKLEKWLNETE 5981          
BLAST of nesprin-1-like vs. Ensembl Fly
Match: Msp300 (gene:FBgn0261836 transcript:FBtr0303389)

HSP 1 Score: 191.815 bits (486), Expect = 2.363e-47
Identity = 113/262 (43.13%), Postives = 168/262 (64.12%), Query Frame = 1
Query:  220 QIRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIK--SENMFKL-------IAQRDSNPTRRENLVKG-----NPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPD 963
            Q++ E E +QKKTFT WIN+ L K+ P  +I +L  DL DG +L+ LL++L+ ++L +EK + ++R H L+N  + + FL  +  IKL+NI+ AD+VDGRP ++LGL+W IIL FQI+  S N+  L       ++  DS   ++   +K        R+ LL W    + ++ G+ + DF +SW+DG AF A+I  I  NLV+   +K+ ++R+ LE AF +AE  L I KLL+ EDVDV  PDEKSIMTY++ FLH YP+
Sbjct:  264 QLQEEQERVQKKTFTNWINSYLLKRVPPLRIDDLINDLRDGTKLIALLEVLSGERLPVEKGRVLRRPHFLSNANTALQFLA-SKRIKLVNINPADLVDGRPPVVLGLIWTIILYFQIEENSRNLEYLGHGIGGSVSSLDSVGNQKHGDLKAEKWKQGARKTLLNWVTNALPKDSGVEVKDFGASWRDGVAFLALIDAIKANLVNLAELKKTSNRQRLETAFDVAESKLGIAKLLDAEDVDVPKPDEKSIMTYVAQFLHKYPE 524          

HSP 2 Score: 74.3294 bits (181), Expect = 5.546e-12
Identity = 152/735 (20.68%), Postives = 310/735 (42.18%), Query Frame = 1
Query: 15007 RFEEYESKFKEFLNWLVSYENL---YNTKVSSSSLEDKQTSLAQFQSNLQNIFEHKSNLNELIEKG------------AKFPLNFSIKYNTKDIQIRYPILLKSAQNRIE-YLAKSVENHEIYEKDKSTFQTFCQKFNYELKSLKEEKMEIGNLKEIFAKLTAMDIEIRKMEQSRSALEVGFNV----------VLVETSEIGKKELSSQHLGLLKSFEKFLIDYDEFKSLISKEKKTENNFIKQLEHFSIGLESLIQTMLNLNPS---SQIHISSLQNCHEGLEKFSEELKRRSSSFDQLITNYDINKSEIVSDLITTIDTELKSASNSLAEK------------RAHVNLLLET-------NQAYQEYFDRLSNWLSNTYSRIQESSDLYGPQSVISQRSDNLNRIQLSIQTEGETLLKAVIERADELNRIILDRTNKEKLSDQVSKCQGEFYNVSNKLENIKTKVND----LETQWKNFDTNIKLLNKVNKVFANRKERF------RNMKYSYFLNINAEIEKILDLVKDIEEEKSNLEIFSNQI-------QSLIDVSQEAQLDTIYQDLIDQIDGHEIDCKSLLDMMRQMGNEKSAFDQQVQNTQLMIDAMKAQLLPIDQLHNIASFNDYQKIFREFQL---LESKLIDGDRMVDECFQMFYKLSVLF--DSEKALNDMISLLKKNWDG----HKEKFDEVKTRMNRLLNLWSNLENLRIPIEEWIQTTE 16989
            ++ +Y+ ++ E L WL   E L   YN      SL  K+  L QFQ +LQ +F+ +  L++L  K             +   +  + KYN          L K    R+E +  +  ++H +YE+        CQ +      +++ + ++   ++I   L  + I++  ++  R   E G N           V++ T + G  ++      L + F+K L+D ++ +  ++       N + QLE      + LI+ + ++ PS   S   ++ L      LEKF              +   DIN     +D++  I+  LK   NSL  K            +  VN ++E+       ++ Y++ ++ L +WL  T   +++ +D +G +  +  R + L  IQ S   EG    KA++E  +EL++ ++  +  E   D V++   E  +++++ E ++T   D    LE+    + T ++  NK+N       +R        N      +N    +E++L    ++E+   N E+   Q        Q++   +   +L T  Q L+ +I+ +  D    L+  ++M       D  ++  Q ++D             + ++  D   I ++      L S+L +G  ++      + K S +   D ++ L ++++ ++++WD      K+K  ++K   NR    W++    +  +E+W+  TE
Sbjct: 5326 KWSDYQDQYTEALEWLSKTEALVQSYNK--LQDSLIQKKVVLEQFQGHLQTLFDWQKTLDDLNMKAQVLLETCSDTRISNAIMQLTTKYNA------LLTLAKEVMRRLEMHYQEHQQHHSLYEE--------CQSW------IEKTREKLSECEQIPGTLNEVQIKLNTVKNLRQGFETGQNKLRYLLELKEKVIMNTEQNGAAKIQEDTEALKQDFDKLLVDLNDVRQKLA-------NRLAQLEEIFKLYKILIEWLEDVEPSVKTSDEFLNDLSEKRAALEKFR-------------VIQRDINGH---NDIVEKINQRLKE-DNSLDLKDFQPGLTKFDDLQTQVNKIIESLENQVNSHEKYKQAYNELQDWLRRTRIEVEQCADCHGEKDQVESRLNRLGDIQ-SSSLEG----KALLEACEELSQAVIATSGSEG-QDNVAQ---EIKHLTSEWETLQTISRDARSSLESCLAAWQTFLQKFNKINLWIETMNKRVTKSQEGENKTPEDLVNAKKLLEEVLAEKDNVEDLNDNCELLMEQSACTRIRDQTIETQANYTKLLTSAQGLVAKIEKNLSDHTEFLNYKKEM-------DAWIEKAQQVLD-------------DCSTDGDAAIIAQKLDTVNSLASRLPEGQHLLALVQDAYSKASNITPEDKQEKLRELMTKVREDWDALGLAVKQKLSDLKQAQNR----WNDFAANKDKLEKWLNETE 5981          
BLAST of nesprin-1-like vs. Ensembl Fly
Match: Msp300 (gene:FBgn0261836 transcript:FBtr0303385)

HSP 1 Score: 191.43 bits (485), Expect = 2.532e-47
Identity = 113/260 (43.46%), Postives = 166/260 (63.85%), Query Frame = 1
Query:  226 RNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIK--SENMFKL-------IAQRDSNPTRRENLVKG-----NPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPD 963
            R E E +QKKTFT WIN+ L K+ P  +I +L  DL DG +L+ LL++L+ ++L +EK + ++R H L+N  + + FL  +  IKL+NI+ AD+VDGRP ++LGL+W IIL FQI+  S N+  L       ++  DS   ++   +K        R+ LL W    + ++ G+ + DF +SW+DG AF A+I  I  NLV+   +K+ ++R+ LE AF +AE  L I KLL+ EDVDV  PDEKSIMTY++ FLH YP+
Sbjct:  625 REEQERVQKKTFTNWINSYLLKRVPPLRIDDLINDLRDGTKLIALLEVLSGERLPVEKGRVLRRPHFLSNANTALQFLA-SKRIKLVNINPADLVDGRPPVVLGLIWTIILYFQIEENSRNLEYLGHGIGGSVSSLDSVGNQKHGDLKAEKWKQGARKTLLNWVTNALPKDSGVEVKDFGASWRDGVAFLALIDAIKANLVNLAELKKTSNRQRLETAFDVAESKLGIAKLLDAEDVDVPKPDEKSIMTYVAQFLHKYPE 883          

HSP 2 Score: 73.9442 bits (180), Expect = 7.498e-12
Identity = 152/735 (20.68%), Postives = 310/735 (42.18%), Query Frame = 1
Query: 15007 RFEEYESKFKEFLNWLVSYENL---YNTKVSSSSLEDKQTSLAQFQSNLQNIFEHKSNLNELIEKG------------AKFPLNFSIKYNTKDIQIRYPILLKSAQNRIE-YLAKSVENHEIYEKDKSTFQTFCQKFNYELKSLKEEKMEIGNLKEIFAKLTAMDIEIRKMEQSRSALEVGFNV----------VLVETSEIGKKELSSQHLGLLKSFEKFLIDYDEFKSLISKEKKTENNFIKQLEHFSIGLESLIQTMLNLNPS---SQIHISSLQNCHEGLEKFSEELKRRSSSFDQLITNYDINKSEIVSDLITTIDTELKSASNSLAEK------------RAHVNLLLET-------NQAYQEYFDRLSNWLSNTYSRIQESSDLYGPQSVISQRSDNLNRIQLSIQTEGETLLKAVIERADELNRIILDRTNKEKLSDQVSKCQGEFYNVSNKLENIKTKVND----LETQWKNFDTNIKLLNKVNKVFANRKERF------RNMKYSYFLNINAEIEKILDLVKDIEEEKSNLEIFSNQI-------QSLIDVSQEAQLDTIYQDLIDQIDGHEIDCKSLLDMMRQMGNEKSAFDQQVQNTQLMIDAMKAQLLPIDQLHNIASFNDYQKIFREFQL---LESKLIDGDRMVDECFQMFYKLSVLF--DSEKALNDMISLLKKNWDG----HKEKFDEVKTRMNRLLNLWSNLENLRIPIEEWIQTTE 16989
            ++ +Y+ ++ E L WL   E L   YN      SL  K+  L QFQ +LQ +F+ +  L++L  K             +   +  + KYN          L K    R+E +  +  ++H +YE+        CQ +      +++ + ++   ++I   L  + I++  ++  R   E G N           V++ T + G  ++      L + F+K L+D ++ +  ++       N + QLE      + LI+ + ++ PS   S   ++ L      LEKF              +   DIN     +D++  I+  LK   NSL  K            +  VN ++E+       ++ Y++ ++ L +WL  T   +++ +D +G +  +  R + L  IQ S   EG    KA++E  +EL++ ++  +  E   D V++   E  +++++ E ++T   D    LE+    + T ++  NK+N       +R        N      +N    +E++L    ++E+   N E+   Q        Q++   +   +L T  Q L+ +I+ +  D    L+  ++M       D  ++  Q ++D             + ++  D   I ++      L S+L +G  ++      + K S +   D ++ L ++++ ++++WD      K+K  ++K   NR    W++    +  +E+W+  TE
Sbjct: 5685 KWSDYQDQYTEALEWLSKTEALVQSYNK--LQDSLIQKKVVLEQFQGHLQTLFDWQKTLDDLNMKAQVLLETCSDTRISNAIMQLTTKYNA------LLTLAKEVMRRLEMHYQEHQQHHSLYEE--------CQSW------IEKTREKLSECEQIPGTLNEVQIKLNTVKNLRQGFETGQNKLRYLLELKEKVIMNTEQNGAAKIQEDTEALKQDFDKLLVDLNDVRQKLA-------NRLAQLEEIFKLYKILIEWLEDVEPSVKTSDEFLNDLSEKRAALEKFR-------------VIQRDINGH---NDIVEKINQRLKE-DNSLDLKDFQPGLTKFDDLQTQVNKIIESLENQVNSHEKYKQAYNELQDWLRRTRIEVEQCADCHGEKDQVESRLNRLGDIQ-SSSLEG----KALLEACEELSQAVIATSGSEG-QDNVAQ---EIKHLTSEWETLQTISRDARSSLESCLAAWQTFLQKFNKINLWIETMNKRVTKSQEGENKTPEDLVNAKKLLEEVLAEKDNVEDLNDNCELLMEQSACTRIRDQTIETQANYTKLLTSAQGLVAKIEKNLSDHTEFLNYKKEM-------DAWIEKAQQVLD-------------DCSTDGDAAIIAQKLDTVNSLASRLPEGQHLLALVQDAYSKASNITPEDKQEKLRELMTKVREDWDALGLAVKQKLSDLKQAQNR----WNDFAANKDKLEKWLNETE 6340          
BLAST of nesprin-1-like vs. Ensembl Fly
Match: Msp300 (gene:FBgn0261836 transcript:FBtr0332405)

HSP 1 Score: 191.43 bits (485), Expect = 2.639e-47
Identity = 113/260 (43.46%), Postives = 166/260 (63.85%), Query Frame = 1
Query:  226 RNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIK--SENMFKL-------IAQRDSNPTRRENLVKG-----NPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPD 963
            R E E +QKKTFT WIN+ L K+ P  +I +L  DL DG +L+ LL++L+ ++L +EK + ++R H L+N  + + FL  +  IKL+NI+ AD+VDGRP ++LGL+W IIL FQI+  S N+  L       ++  DS   ++   +K        R+ LL W    + ++ G+ + DF +SW+DG AF A+I  I  NLV+   +K+ ++R+ LE AF +AE  L I KLL+ EDVDV  PDEKSIMTY++ FLH YP+
Sbjct:  625 REEQERVQKKTFTNWINSYLLKRVPPLRIDDLINDLRDGTKLIALLEVLSGERLPVEKGRVLRRPHFLSNANTALQFLA-SKRIKLVNINPADLVDGRPPVVLGLIWTIILYFQIEENSRNLEYLGHGIGGSVSSLDSVGNQKHGDLKAEKWKQGARKTLLNWVTNALPKDSGVEVKDFGASWRDGVAFLALIDAIKANLVNLAELKKTSNRQRLETAFDVAESKLGIAKLLDAEDVDVPKPDEKSIMTYVAQFLHKYPE 883          

HSP 2 Score: 73.9442 bits (180), Expect = 7.753e-12
Identity = 152/735 (20.68%), Postives = 310/735 (42.18%), Query Frame = 1
Query: 15007 RFEEYESKFKEFLNWLVSYENL---YNTKVSSSSLEDKQTSLAQFQSNLQNIFEHKSNLNELIEKG------------AKFPLNFSIKYNTKDIQIRYPILLKSAQNRIE-YLAKSVENHEIYEKDKSTFQTFCQKFNYELKSLKEEKMEIGNLKEIFAKLTAMDIEIRKMEQSRSALEVGFNV----------VLVETSEIGKKELSSQHLGLLKSFEKFLIDYDEFKSLISKEKKTENNFIKQLEHFSIGLESLIQTMLNLNPS---SQIHISSLQNCHEGLEKFSEELKRRSSSFDQLITNYDINKSEIVSDLITTIDTELKSASNSLAEK------------RAHVNLLLET-------NQAYQEYFDRLSNWLSNTYSRIQESSDLYGPQSVISQRSDNLNRIQLSIQTEGETLLKAVIERADELNRIILDRTNKEKLSDQVSKCQGEFYNVSNKLENIKTKVND----LETQWKNFDTNIKLLNKVNKVFANRKERF------RNMKYSYFLNINAEIEKILDLVKDIEEEKSNLEIFSNQI-------QSLIDVSQEAQLDTIYQDLIDQIDGHEIDCKSLLDMMRQMGNEKSAFDQQVQNTQLMIDAMKAQLLPIDQLHNIASFNDYQKIFREFQL---LESKLIDGDRMVDECFQMFYKLSVLF--DSEKALNDMISLLKKNWDG----HKEKFDEVKTRMNRLLNLWSNLENLRIPIEEWIQTTE 16989
            ++ +Y+ ++ E L WL   E L   YN      SL  K+  L QFQ +LQ +F+ +  L++L  K             +   +  + KYN          L K    R+E +  +  ++H +YE+        CQ +      +++ + ++   ++I   L  + I++  ++  R   E G N           V++ T + G  ++      L + F+K L+D ++ +  ++       N + QLE      + LI+ + ++ PS   S   ++ L      LEKF              +   DIN     +D++  I+  LK   NSL  K            +  VN ++E+       ++ Y++ ++ L +WL  T   +++ +D +G +  +  R + L  IQ S   EG    KA++E  +EL++ ++  +  E   D V++   E  +++++ E ++T   D    LE+    + T ++  NK+N       +R        N      +N    +E++L    ++E+   N E+   Q        Q++   +   +L T  Q L+ +I+ +  D    L+  ++M       D  ++  Q ++D             + ++  D   I ++      L S+L +G  ++      + K S +   D ++ L ++++ ++++WD      K+K  ++K   NR    W++    +  +E+W+  TE
Sbjct: 5685 KWSDYQDQYTEALEWLSKTEALVQSYNK--LQDSLIQKKVVLEQFQGHLQTLFDWQKTLDDLNMKAQVLLETCSDTRISNAIMQLTTKYNA------LLTLAKEVMRRLEMHYQEHQQHHSLYEE--------CQSW------IEKTREKLSECEQIPGTLNEVQIKLNTVKNLRQGFETGQNKLRYLLELKEKVIMNTEQNGAAKIQEDTEALKQDFDKLLVDLNDVRQKLA-------NRLAQLEEIFKLYKILIEWLEDVEPSVKTSDEFLNDLSEKRAALEKFR-------------VIQRDINGH---NDIVEKINQRLKE-DNSLDLKDFQPGLTKFDDLQTQVNKIIESLENQVNSHEKYKQAYNELQDWLRRTRIEVEQCADCHGEKDQVESRLNRLGDIQ-SSSLEG----KALLEACEELSQAVIATSGSEG-QDNVAQ---EIKHLTSEWETLQTISRDARSSLESCLAAWQTFLQKFNKINLWIETMNKRVTKSQEGENKTPEDLVNAKKLLEEVLAEKDNVEDLNDNCELLMEQSACTRIRDQTIETQANYTKLLTSAQGLVAKIEKNLSDHTEFLNYKKEM-------DAWIEKAQQVLD-------------DCSTDGDAAIIAQKLDTVNSLASRLPEGQHLLALVQDAYSKASNITPEDKQEKLRELMTKVREDWDALGLAVKQKLSDLKQAQNR----WNDFAANKDKLEKWLNETE 6340          
BLAST of nesprin-1-like vs. Ensembl Zebrafish
Match: syne1b (spectrin repeat containing, nuclear envelope 1b [Source:ZFIN;Acc:ZDB-GENE-071218-4])

HSP 1 Score: 219.935 bits (559), Expect = 8.172e-56
Identity = 120/267 (44.94%), Postives = 184/267 (68.91%), Query Frame = 1
Query:  217 RQIRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIK--SENMFKL--------------IAQRDSNPTRRENLVK--GNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPD 963
            +++++E E +QK+TFTKWIN+ L+K  P  ++ +L+ D+ DG++LL LL++L+ Q+L  E+ + ++R+H ++N+ + + FL +   IKL+NI+A DI DGRP+I+LGL+W IIL FQI+  + N+  L               ++  S P +R+ + K  GN + ALL W     T+  GI + DF +SW+ G AF+++IH I P LVD D++++R++RENLE AF +AE  L IP+LL+PEDVDVD PDEKSIMTY++ FL +YPD
Sbjct:   19 QKLQDEQESVQKRTFTKWINSHLAKHKPPFEVNDLFEDIKDGVKLLALLEVLSGQRLPCEQGRQLKRIHWVSNIGTALKFL-EGRKIKLVNINATDIADGRPSIVLGLMWTIILYFQIEELTSNLPALQALSSSASSVDSMASSETGSPPMKRKVVTKFQGNAKRALLRWVQNTATKRLGIEVKDFGASWRSGVAFHSVIHAIRPELVDMDVVRKRSNRENLEEAFSVAENELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYPD 284          
BLAST of nesprin-1-like vs. Ensembl Zebrafish
Match: syne1b (spectrin repeat containing, nuclear envelope 1b [Source:ZFIN;Acc:ZDB-GENE-071218-4])

HSP 1 Score: 219.935 bits (559), Expect = 8.172e-56
Identity = 120/267 (44.94%), Postives = 184/267 (68.91%), Query Frame = 1
Query:  217 RQIRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIK--SENMFKL--------------IAQRDSNPTRRENLVK--GNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPD 963
            +++++E E +QK+TFTKWIN+ L+K  P  ++ +L+ D+ DG++LL LL++L+ Q+L  E+ + ++R+H ++N+ + + FL +   IKL+NI+A DI DGRP+I+LGL+W IIL FQI+  + N+  L               ++  S P +R+ + K  GN + ALL W     T+  GI + DF +SW+ G AF+++IH I P LVD D++++R++RENLE AF +AE  L IP+LL+PEDVDVD PDEKSIMTY++ FL +YPD
Sbjct:   19 QKLQDEQESVQKRTFTKWINSHLAKHKPPFEVNDLFEDIKDGVKLLALLEVLSGQRLPCEQGRQLKRIHWVSNIGTALKFL-EGRKIKLVNINATDIADGRPSIVLGLMWTIILYFQIEELTSNLPALQALSSSASSVDSMASSETGSPPMKRKVVTKFQGNAKRALLRWVQNTATKRLGIEVKDFGASWRSGVAFHSVIHAIRPELVDMDVVRKRSNRENLEEAFSVAENELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYPD 284          
BLAST of nesprin-1-like vs. Ensembl Zebrafish
Match: syne1a (spectrin repeat containing, nuclear envelope 1a [Source:ZFIN;Acc:ZDB-GENE-030131-4172])

HSP 1 Score: 199.134 bits (505), Expect = 1.676e-49
Identity = 118/279 (42.29%), Postives = 180/279 (64.52%), Query Frame = 1
Query:  199 LIRTRGRQIRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTM------HIKLINIHAADIVDGRPNIILGLVWQIILNFQIK--SENMFKLIAQRDSN--------------PTRRENLV--KGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPD 963
            L++   + +R+E E +QK+TFTKWIN+ L+K++P   + +L+ D+ DG+ LL LL++L+  KL  E+ + ++R+H +AN+   + FL+          IKL+NI+  D+VDGRP+I+LGL+W IIL FQI+  + ++  L  Q  SN              P +R+  +  +G  + ALL W     T+  G+ + DF  SW+ G AF+A+I  + P+LV+ + + RR +RENLE AF LAE+ L IP+LL+PEDVDVD PDEKSIMTY++ FL ++PD
Sbjct:   26 LVQGVSQHLRDEQEAVQKRTFTKWINSHLAKRNPPLVVSDLFEDVKDGVMLLALLEVLSGHKLPCEQGRKLRRIHWVANVGRALKFLEGRRVRQSIPTIKLVNINTTDVVDGRPSIVLGLIWTIILYFQIEELTSHLPALQPQSSSNSSVESSNSTETSSPPVKRKPRLSFQGGAKRALLKWVQNTATKRMGLDVKDFGPSWRTGVAFHAVIFALRPHLVNMERVWRRGNRENLEEAFSLAERELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHHPD 304          
BLAST of nesprin-1-like vs. Ensembl Zebrafish
Match: syne1a (spectrin repeat containing, nuclear envelope 1a [Source:ZFIN;Acc:ZDB-GENE-030131-4172])

HSP 1 Score: 199.134 bits (505), Expect = 1.791e-49
Identity = 118/279 (42.29%), Postives = 180/279 (64.52%), Query Frame = 1
Query:  199 LIRTRGRQIRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTM------HIKLINIHAADIVDGRPNIILGLVWQIILNFQIK--SENMFKLIAQRDSN--------------PTRRENLV--KGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPD 963
            L++   + +R+E E +QK+TFTKWIN+ L+K++P   + +L+ D+ DG+ LL LL++L+  KL  E+ + ++R+H +AN+   + FL+          IKL+NI+  D+VDGRP+I+LGL+W IIL FQI+  + ++  L  Q  SN              P +R+  +  +G  + ALL W     T+  G+ + DF  SW+ G AF+A+I  + P+LV+ + + RR +RENLE AF LAE+ L IP+LL+PEDVDVD PDEKSIMTY++ FL ++PD
Sbjct:   26 LVQGVSQHLRDEQEAVQKRTFTKWINSHLAKRNPPLVVSDLFEDVKDGVMLLALLEVLSGHKLPCEQGRKLRRIHWVANVGRALKFLEGRRVRQSIPTIKLVNINTTDVVDGRPSIVLGLIWTIILYFQIEELTSHLPALQPQSSSNSSVESSNSTETSSPPVKRKPRLSFQGGAKRALLKWVQNTATKRMGLDVKDFGPSWRTGVAFHAVIFALRPHLVNMERVWRRGNRENLEEAFSLAERELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHHPD 304          
BLAST of nesprin-1-like vs. Ensembl Zebrafish
Match: syne2b (spectrin repeat containing, nuclear envelope 2b [Source:ZFIN;Acc:ZDB-GENE-071218-5])

HSP 1 Score: 162.54 bits (410), Expect = 2.947e-43
Identity = 106/272 (38.97%), Postives = 162/272 (59.56%), Query Frame = 1
Query:  232 EHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQII-----------LNFQIKSENMFKLIA--QRDSNPTRRENLV--KGNP---------REALLAW-SDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPDQDI 972
            E E IQK+TFT WIN  LSK+ P   + +L+ +  DG RLL+LL++++ Q++  ++R   Q     +N+   + FLK    IKL+NI+ +DI+DG+P+IILGLVW II           L+F  +  ++  L +   R +N + R + V  +G+P         ++ALL W  ++       +++ DF  SW+ G  F AI+H + PN+VD    + R +R+NLE AF +AE+ L+IP+LL+P DVDV  PDEKSIMTY++ FL    D  +
Sbjct:    2 EQEQIQKRTFTNWINAQLSKRSPPVTVVDLFNEFRDGSRLLDLLEVMSGQRIVKKRRGTFQH---RSNIEKALAFLKKK-SIKLVNINVSDIMDGKPSIILGLVWTIIMHIHIEELASTLSFSSRQSSLESLASLDTRSTNSSARSSPVPPRGSPLHARFRVSAKKALLLWVREQCQRAGCTLNVKDFKVSWRSGVVFLAILHALRPNIVDLTRARTRTNRQNLEEAFHIAERELHIPRLLDPADVDVRDPDEKSIMTYVAQFLQYSKDASV 269          
BLAST of nesprin-1-like vs. Ensembl Xenopus
Match: SYNE1 (spectrin repeat containing, nuclear envelope 1 [Source:NCBI gene;Acc:100145637])

HSP 1 Score: 211.075 bits (536), Expect = 5.205e-53
Identity = 122/272 (44.85%), Postives = 181/272 (66.54%), Query Frame = 1
Query:  229 NEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKD-------TMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIK--SENMFKLIA--------------QRDSNPTRRE--NLVKGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDL--IKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPD 963
            +E E +QK+TFTKWIN+ L+K+HP   I  L+ D+ DG +L+ LL++L+ QKL  E+ + ++R+H +AN+ + + FL+           IKL+NI++ DI DGRP+I+LGL+W IIL FQI+  + N+ +L A              +  S P +R+  N ++G+ ++ALL W      +  GI + DF  SW++G AF+++I+ I P+LVD D+  +KRR +RENLE AF +AE  L IP+LL+PEDVDVD PDEKSIMTY++ FL +YPD
Sbjct:   31 DEQEAVQKRTFTKWINSHLAKRHPPMVINELFEDIKDGTKLIALLEVLSGQKLPCEQGRQLKRIHWVANIGAALKFLEGRRVMTFLIFQIKLVNINSTDIADGRPSIVLGLIWTIILYFQIEELTSNLPQLHAMSSSTSSVDSVVSSEAASPPIKRKIVNKIQGSAKKALLRWVQYTAAKRLGIEVKDFGPSWRNGIAFHSVIYAIRPDLVDMDIEKLKRRTNRENLEEAFSIAENELGIPRLLDPEDVDVDKPDEKSIMTYIAQFLKHYPD 302          
BLAST of nesprin-1-like vs. Ensembl Xenopus
Match: SYNE1 (spectrin repeat containing, nuclear envelope 1 [Source:NCBI gene;Acc:100145637])

HSP 1 Score: 186.422 bits (472), Expect = 1.604e-45
Identity = 111/257 (43.19%), Postives = 171/257 (66.54%), Query Frame = 1
Query:  253 KTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIK--SENMFKLIA--------------QRDSNPTRRE--NLVKGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDL--IKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPD 963
            +T  +++ + L ++HP   I  L+ D+ DG +L+ LL++L+ QKL  E+ + ++R+H +AN+ + + FL +   IKL+NI++ DI DGRP+I+LGL+W IIL FQI+  + N+ +L A              +  S P +R+  N ++G+ ++ALL W      +  GI + DF  SW++G AF+++I+ I P+LVD D+  +KRR +RENLE AF +AE  L IP+LL+PEDVDVD PDEKSIMTY++ FL +YPD
Sbjct:    7 ETLNQYVISFL-QRHPPMVINELFEDIKDGTKLIALLEVLSGQKLPCEQGRQLKRIHWVANIGAALKFL-EGRRIKLVNINSTDIADGRPSIVLGLIWTIILYFQIEELTSNLPQLHAMSSSTSSVDSVVSSEAASPPIKRKIVNKIQGSAKKALLRWVQYTAAKRLGIEVKDFGPSWRNGIAFHSVIYAIRPDLVDMDIEKLKRRTNRENLEEAFSIAENELGIPRLLDPEDVDVDKPDEKSIMTYIAQFLKHYPD 261          
BLAST of nesprin-1-like vs. Ensembl Xenopus
Match: SYNE1 (spectrin repeat containing, nuclear envelope 1 [Source:NCBI gene;Acc:100145637])

HSP 1 Score: 186.422 bits (472), Expect = 1.645e-45
Identity = 111/257 (43.19%), Postives = 171/257 (66.54%), Query Frame = 1
Query:  253 KTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIK--SENMFKLIA--------------QRDSNPTRRE--NLVKGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDL--IKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPD 963
            +T  +++ + L ++HP   I  L+ D+ DG +L+ LL++L+ QKL  E+ + ++R+H +AN+ + + FL +   IKL+NI++ DI DGRP+I+LGL+W IIL FQI+  + N+ +L A              +  S P +R+  N ++G+ ++ALL W      +  GI + DF  SW++G AF+++I+ I P+LVD D+  +KRR +RENLE AF +AE  L IP+LL+PEDVDVD PDEKSIMTY++ FL +YPD
Sbjct:    7 ETLNQYVISFL-QRHPPMVINELFEDIKDGTKLIALLEVLSGQKLPCEQGRQLKRIHWVANIGAALKFL-EGRRIKLVNINSTDIADGRPSIVLGLIWTIILYFQIEELTSNLPQLHAMSSSTSSVDSVVSSEAASPPIKRKIVNKIQGSAKKALLRWVQYTAAKRLGIEVKDFGPSWRNGIAFHSVIYAIRPDLVDMDIEKLKRRTNRENLEEAFSIAENELGIPRLLDPEDVDVDKPDEKSIMTYIAQFLKHYPD 261          
BLAST of nesprin-1-like vs. Ensembl Xenopus
Match: SYNE1 (spectrin repeat containing, nuclear envelope 1 [Source:NCBI gene;Acc:100145637])

HSP 1 Score: 186.422 bits (472), Expect = 1.677e-45
Identity = 111/257 (43.19%), Postives = 171/257 (66.54%), Query Frame = 1
Query:  253 KTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIK--SENMFKLIA--------------QRDSNPTRRE--NLVKGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDL--IKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPD 963
            +T  +++ + L ++HP   I  L+ D+ DG +L+ LL++L+ QKL  E+ + ++R+H +AN+ + + FL +   IKL+NI++ DI DGRP+I+LGL+W IIL FQI+  + N+ +L A              +  S P +R+  N ++G+ ++ALL W      +  GI + DF  SW++G AF+++I+ I P+LVD D+  +KRR +RENLE AF +AE  L IP+LL+PEDVDVD PDEKSIMTY++ FL +YPD
Sbjct:    7 ETLNQYVISFL-QRHPPMVINELFEDIKDGTKLIALLEVLSGQKLPCEQGRQLKRIHWVANIGAALKFL-EGRRIKLVNINSTDIADGRPSIVLGLIWTIILYFQIEELTSNLPQLHAMSSSTSSVDSVVSSEAASPPIKRKIVNKIQGSAKKALLRWVQYTAAKRLGIEVKDFGPSWRNGIAFHSVIYAIRPDLVDMDIEKLKRRTNRENLEEAFSIAENELGIPRLLDPEDVDVDKPDEKSIMTYIAQFLKHYPD 261          
BLAST of nesprin-1-like vs. Ensembl Xenopus
Match: SYNE1 (spectrin repeat containing, nuclear envelope 1 [Source:NCBI gene;Acc:100145637])

HSP 1 Score: 186.422 bits (472), Expect = 1.717e-45
Identity = 111/256 (43.36%), Postives = 170/256 (66.41%), Query Frame = 1
Query:  256 TFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIK--SENMFKLIA--------------QRDSNPTRRE--NLVKGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDL--IKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPD 963
            T  +++ + L ++HP   I  L+ D+ DG +L+ LL++L+ QKL  E+ + ++R+H +AN+ + + FL +   IKL+NI++ DI DGRP+I+LGL+W IIL FQI+  + N+ +L A              +  S P +R+  N ++G+ ++ALL W      +  GI + DF  SW++G AF+++I+ I P+LVD D+  +KRR +RENLE AF +AE  L IP+LL+PEDVDVD PDEKSIMTY++ FL +YPD
Sbjct:   29 TLNQYVISFL-QRHPPMVINELFEDIKDGTKLIALLEVLSGQKLPCEQGRQLKRIHWVANIGAALKFL-EGRRIKLVNINSTDIADGRPSIVLGLIWTIILYFQIEELTSNLPQLHAMSSSTSSVDSVVSSEAASPPIKRKIVNKIQGSAKKALLRWVQYTAAKRLGIEVKDFGPSWRNGIAFHSVIYAIRPDLVDMDIEKLKRRTNRENLEEAFSIAENELGIPRLLDPEDVDVDKPDEKSIMTYIAQFLKHYPD 282          
BLAST of nesprin-1-like vs. Ensembl Mouse
Match: Syne1 (spectrin repeat containing, nuclear envelope 1 [Source:MGI Symbol;Acc:MGI:1927152])

HSP 1 Score: 211.846 bits (538), Expect = 1.423e-56
Identity = 121/267 (45.32%), Postives = 178/267 (66.67%), Query Frame = 1
Query:  217 RQIRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIK--SENMFKL--------------IAQRDSNPTRRENLVK--GNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPD 963
            +++++E E +QK+TFTKWIN+ L+K+ P   + +L+ D+ DGI+LL LL++L+ QKL  E+   ++R+H +AN+ + + FL +   IKL+NI+A DI DGRP+I+LGL+W IIL FQI+  + N+ +L                +  S P++R+   K  GN ++ LL W      +  GI + DF  SW+ G AF+++IH I P LVD + +K R++RENLE AF +AE  L IP+LL+PEDVDVD PDEKSIMTY++ FL  YPD
Sbjct:   19 QRLQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDGIKLLALLEVLSGQKLPCEQGHRVKRIHAVANIGTALKFL-EGRKIKLVNINATDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSSSASSVDSMVSTETASPPSKRKVAAKIQGNAKKTLLKWVQHTAGKQMGIEVKDFGKSWRTGLAFHSVIHAIQPELVDLEKVKTRSNRENLEDAFTIAETQLGIPRLLDPEDVDVDKPDEKSIMTYVAQFLTQYPD 284          
BLAST of nesprin-1-like vs. Ensembl Mouse
Match: Syne1 (spectrin repeat containing, nuclear envelope 1 [Source:MGI Symbol;Acc:MGI:1927152])

HSP 1 Score: 211.075 bits (536), Expect = 1.475e-53
Identity = 122/273 (44.69%), Postives = 181/273 (66.30%), Query Frame = 1
Query:  217 RQIRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFL--KDTMH----IKLINIHAADIVDGRPNIILGLVWQIILNFQIK--SENMFKL--------------IAQRDSNPTRRENLVK--GNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPD 963
            +++++E E +QK+TFTKWIN+ L+K+ P   + +L+ D+ DGI+LL LL++L+ QKL  E+   ++R+H +AN+ + + FL  + +M+    IKL+NI+A DI DGRP+I+LGL+W IIL FQI+  + N+ +L                +  S P++R+   K  GN ++ LL W      +  GI + DF  SW+ G AF+++IH I P LVD + +K R++RENLE AF +AE  L IP+LL+PEDVDVD PDEKSIMTY++ FL  YPD
Sbjct:   19 QRLQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDGIKLLALLEVLSGQKLPCEQGHRVKRIHAVANIGTALKFLEGRKSMYRGSPIKLVNINATDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSSSASSVDSMVSTETASPPSKRKVAAKIQGNAKKTLLKWVQHTAGKQMGIEVKDFGKSWRTGLAFHSVIHAIQPELVDLEKVKTRSNRENLEDAFTIAETQLGIPRLLDPEDVDVDKPDEKSIMTYVAQFLTQYPD 291          
BLAST of nesprin-1-like vs. Ensembl Mouse
Match: Syne1 (spectrin repeat containing, nuclear envelope 1 [Source:MGI Symbol;Acc:MGI:1927152])

HSP 1 Score: 212.231 bits (539), Expect = 2.240e-53
Identity = 122/273 (44.69%), Postives = 181/273 (66.30%), Query Frame = 1
Query:  217 RQIRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFL--KDTMH----IKLINIHAADIVDGRPNIILGLVWQIILNFQIK--SENMFKL--------------IAQRDSNPTRRENLVK--GNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPD 963
            +++++E E +QK+TFTKWIN+ L+K+ P   + +L+ D+ DGI+LL LL++L+ QKL  E+   ++R+H +AN+ + + FL  + +M+    IKL+NI+A DI DGRP+I+LGL+W IIL FQI+  + N+ +L                +  S P++R+   K  GN ++ LL W      +  GI + DF  SW+ G AF+++IH I P LVD + +K R++RENLE AF +AE  L IP+LL+PEDVDVD PDEKSIMTY++ FL  YPD
Sbjct:   19 QRLQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDGIKLLALLEVLSGQKLPCEQGHRVKRIHAVANIGTALKFLEGRKSMYRGSPIKLVNINATDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSSSASSVDSMVSTETASPPSKRKVAAKIQGNAKKTLLKWVQHTAGKQMGIEVKDFGKSWRTGLAFHSVIHAIQPELVDLEKVKTRSNRENLEDAFTIAETQLGIPRLLDPEDVDVDKPDEKSIMTYVAQFLTQYPD 291          
BLAST of nesprin-1-like vs. Ensembl Mouse
Match: Syne2 (spectrin repeat containing, nuclear envelope 2 [Source:MGI Symbol;Acc:MGI:2449316])

HSP 1 Score: 173.711 bits (439), Expect = 1.621e-44
Identity = 111/263 (42.21%), Postives = 163/263 (61.98%), Query Frame = 1
Query:  223 IRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIK-------------SENMFKLIAQR--DSNPTRRENLVKGNPR------EALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFL 948
            ++ E E  QKKTFT WIN+ L+K  P   + +L+ D+  G  LL+LL++L+ Q+L  +K  +     C  N+   + FLK+   IKLINIH ADIV+G P+IILGL+W IIL+F I+             S  +  + A     S PT++ +  +   R      +ALL W+ +    +  +++ DF SSW++G AF A+IH + P+L+D D ++ R++++NL+ AFR+AE  L IPKLLEPEDVDV  PDEKSIMTY++ FL
Sbjct:   25 LQAEQEDTQKKTFTCWINSQLAKHTPPSVVSDLFADIKKGHVLLDLLEVLSGQQLPRDKGSNT--FQCRINIEHALTFLKNR-SIKLINIHVADIVEGNPSIILGLIWTIILHFHIEKLAQTLSCDYNQPSPEVVSVAASSPTSSPPTKKCSKAQAQARWQWSAKKALLQWAQEQCARSESVNVTDFKSSWRNGMAFLAVIHALRPDLIDMDSMRHRSNKDNLKEAFRIAEHELKIPKLLEPEDVDVVNPDEKSIMTYVAQFL 284          
BLAST of nesprin-1-like vs. Ensembl Mouse
Match: Syne2 (spectrin repeat containing, nuclear envelope 2 [Source:MGI Symbol;Acc:MGI:2449316])

HSP 1 Score: 176.407 bits (446), Expect = 1.264e-42
Identity = 112/268 (41.79%), Postives = 164/268 (61.19%), Query Frame = 1
Query:  223 IRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIK-------------SENMFKLIAQR--DSNPTRRENLVKGNPR------EALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPD 963
            ++ E E  QKKTFT WIN+ L+K  P   + +L+ D+  G  LL+LL++L+ Q+L  +K  +     C  N+   + FLK+   IKLINIH ADIV+G P+IILGL+W IIL+F I+             S  +  + A     S PT++ +  +   R      +ALL W+ +    +  +++ DF SSW++G AF A+IH + P+L+D D ++ R++++NL+ AFR+AE  L IPKLLEPEDVDV  PDEKSIMTY++ FL    D
Sbjct:   25 LQAEQEDTQKKTFTCWINSQLAKHTPPSVVSDLFADIKKGHVLLDLLEVLSGQQLPRDKGSNT--FQCRINIEHALTFLKNR-SIKLINIHVADIVEGNPSIILGLIWTIILHFHIEKLAQTLSCDYNQPSPEVVSVAASSPTSSPPTKKCSKAQAQARWQWSAKKALLQWAQEQCARSESVNVTDFKSSWRNGMAFLAVIHALRPDLIDMDSMRHRSNKDNLKEAFRIAEHELKIPKLLEPEDVDVVNPDEKSIMTYVAQFLKYSKD 289          
BLAST of nesprin-1-like vs. UniProt/SwissProt
Match: sp|Q8NF91|SYNE1_HUMAN (Nesprin-1 OS=Homo sapiens OX=9606 GN=SYNE1 PE=1 SV=4)

HSP 1 Score: 217.238 bits (552), Expect = 4.753e-54
Identity = 123/274 (44.89%), Postives = 186/274 (67.88%), Query Frame = 1
Query:  217 RQIRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIK--SENMFKL--------------IAQRDSNPTRRE--NLVKGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPDQDIHKNS 984
            +++++E E +QK+TFTKWIN+ L+K+ P   + +L+ D+ DG++LL LL++L+ QKL  E+ + M+R+H +AN+ + + FL +   IKL+NI++ DI DGRP+I+LGL+W IIL FQI+  + N+ +L               ++  S P++R+    ++GN ++ALL W      +  GI + DF  SW+ G AF+++IH I P LVD + +K R++RENLE AF +AE  L IP+LL+PEDVDVD PDEKSIMTY++ FL +YP  DIH  S
Sbjct:   19 QRLQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDGVKLLALLEVLSGQKLPCEQGRRMKRIHAVANIGTALKFL-EGRKIKLVNINSTDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSSSASSVDSIVSSETPSPPSKRKVTTKIQGNAKKALLKWVQYTAGKQTGIEVKDFGKSWRSGVAFHSVIHAIRPELVDLETVKGRSNRENLEDAFTIAETELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYP--DIHNAS 289          
BLAST of nesprin-1-like vs. UniProt/SwissProt
Match: sp|Q6ZWR6|SYNE1_MOUSE (Nesprin-1 OS=Mus musculus OX=10090 GN=Syne1 PE=1 SV=2)

HSP 1 Score: 213.772 bits (543), Expect = 5.025e-53
Identity = 121/267 (45.32%), Postives = 178/267 (66.67%), Query Frame = 1
Query:  217 RQIRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIK--SENMFKL--------------IAQRDSNPTRRENLVK--GNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPD 963
            +++++E E +QK+TFTKWIN+ L+K+ P   + +L+ D+ DGI+LL LL++L+ QKL  E+   ++R+H +AN+ + + FL +   IKL+NI+A DI DGRP+I+LGL+W IIL FQI+  + N+ +L                +  S P++R+   K  GN ++ LL W      +  GI + DF  SW+ G AF+++IH I P LVD + +K R++RENLE AF +AE  L IP+LL+PEDVDVD PDEKSIMTY++ FL  YPD
Sbjct:   19 QRLQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDGIKLLALLEVLSGQKLPCEQGHRVKRIHAVANIGTALKFL-EGRKIKLVNINATDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSSSASSVDSMVSTETASPPSKRKVAAKIQGNAKKTLLKWVQHTAGKQMGIEVKDFGKSWRTGLAFHSVIHAIQPELVDLEKVKTRSNRENLEDAFTIAETQLGIPRLLDPEDVDVDKPDEKSIMTYVAQFLTQYPD 284          
BLAST of nesprin-1-like vs. UniProt/SwissProt
Match: sp|Q6ZWQ0|SYNE2_MOUSE (Nesprin-2 OS=Mus musculus OX=10090 GN=Syne2 PE=1 SV=2)

HSP 1 Score: 176.407 bits (446), Expect = 9.531e-42
Identity = 112/268 (41.79%), Postives = 164/268 (61.19%), Query Frame = 1
Query:  223 IRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIK-------------SENMFKLIAQR--DSNPTRRENLVKGNPR------EALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPD 963
            ++ E E  QKKTFT WIN+ L+K  P   + +L+ D+  G  LL+LL++L+ Q+L  +K  +     C  N+   + FLK+   IKLINIH ADIV+G P+IILGL+W IIL+F I+             S  +  + A     S PT++ +  +   R      +ALL W+ +    +  +++ DF SSW++G AF A+IH + P+L+D D ++ R++++NL+ AFR+AE  L IPKLLEPEDVDV  PDEKSIMTY++ FL    D
Sbjct:   25 LQAEQEDTQKKTFTCWINSQLAKHTPPSVVSDLFADIKKGHVLLDLLEVLSGQQLPRDKGSNT--FQCRINIEHALTFLKNR-SIKLINIHVADIVEGNPSIILGLIWTIILHFHIEKLAQTLSCDYNQPSPEVVSVAASSPTSSPPTKKCSKAQAQARWQWSAKKALLQWAQEQCARSESVNVTDFKSSWRNGMAFLAVIHALRPDLIDMDSMRHRSNKDNLKEAFRIAEHELKIPKLLEPEDVDVVNPDEKSIMTYVAQFLKYSKD 289          
BLAST of nesprin-1-like vs. UniProt/SwissProt
Match: sp|Q96JQ2|CLMN_HUMAN (Calmin OS=Homo sapiens OX=9606 GN=CLMN PE=1 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 2.501e-40
Identity = 112/276 (40.58%), Postives = 172/276 (62.32%), Query Frame = 1
Query:  202 IRTRGRQIRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIK-----------SENMFKLIAQRDSN------PTRRENL---VKGNPR--EALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPD 963
            IR +  Q+  E E++QK+TFT+WIN  L K +P  ++++L+VD+ DG  L+ LL++L+ + L  E +    R+  L N+   + FL+D+ ++KL++I AA+I DG P+++LGL+W IIL FQIK           S ++       DS+      PT   ++   VK   +  +ALLAW  +  T  YG+++ DF  SW+ G AF A+I  I+P+LVD       ++RENLE AF +A+  L+IP+LLEPED+ VD PDE+SIMTY++ FL  +P+
Sbjct:   21 IRVQNLQV--ERENVQKRTFTRWINLHLEKCNPPLEVKDLFVDIQDGKILMALLEVLSGRNLLHEYKSSSHRIFRLNNIAKALKFLEDS-NVKLVSIDAAEIADGNPSLVLGLIWNIILFFQIKELTGNLSRNSPSSSLSPGSGGTDSDSSFPPTPTAERSVAISVKDQRKAIKALLAWVQRK-TRKYGVAVQDFAGSWRSGLAFLAVIKAIDPSLVDMKQALENSTRENLEKAFSIAQDALHIPRLLEPEDIMVDTPDEQSIMTYVAQFLERFPE 292          
BLAST of nesprin-1-like vs. UniProt/SwissProt
Match: sp|Q01082|SPTB2_HUMAN (Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2)

HSP 1 Score: 169.088 bits (427), Expect = 1.009e-39
Identity = 102/251 (40.64%), Postives = 160/251 (63.75%), Query Frame = 1
Query:  205 RTRGRQIRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIKSENMFKLIAQRDSNPTRRENLVKGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNY 957
            R+R + + +E E +QKKTFTKW+N+ L++     +I +LY DL DG  L++LL++L+ ++L    +  M R+HCL N+   + FLK+   + L N+ + DIVDG   + LGL+W IIL FQI+           D +    +N  K + ++ALL W          ++I++F +SW+DG AFNA+IH   P+L+D+D +K+ N+  NL+ AF LAE++L + KLL+PED+ VD+PDEKSI+TY+  + H +
Sbjct:   42 RSRIKALADEREAVQKKTFTKWVNSHLARVSC--RITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRM-RIHCLENVDKALQFLKE-QRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQ-----------DISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYF 277          
BLAST of nesprin-1-like vs. TrEMBL
Match: A0A0S7K543 (SYNE1 (Fragment) OS=Poeciliopsis prolifica OX=188132 GN=SYNE1 PE=4 SV=1)

HSP 1 Score: 223.787 bits (569), Expect = 8.635e-61
Identity = 123/265 (46.42%), Postives = 183/265 (69.06%), Query Frame = 1
Query:  223 IRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIK--SENMFKLIAQRDSN--------------PTRRENLVK--GNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPD 963
            +R+E E +QK+TFTKWIN+ L+K  P  ++ +L+ D+ DG++LL LL++L+ Q+L  E+ + ++R+H ++N+ + + FL +   IKL+NIHA DI DGRP+I+LGL+W IIL FQI+  + N+  L A  +SN              P +R+   K  GN ++ALL W      +++GI + DF  SW+ G AF A++H I P+LVD +++++RN+RENLE AF LAE  L IP+LL+PEDVDVD PDEKSIMTY++ FL +YP+
Sbjct:   24 LRDEQEAVQKRTFTKWINSHLAKHKPPLEVNDLFEDIKDGVKLLALLEVLSGQRLPCEQGRQLKRIHWVSNIGTALKFL-EGRKIKLVNIHATDIADGRPSIVLGLIWTIILYFQIEELTSNLPALQALSNSNSSVDSTASCETGSPPMKRKVTTKFQGNAKKALLRWVQCTAAKDFGIEVKDFGPSWRSGVAFQAVVHAIRPDLVDMEVVRQRNNRENLEEAFALAENELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYPN 287          
BLAST of nesprin-1-like vs. TrEMBL
Match: A0A3P9C6D2 (Uncharacterized protein OS=Maylandia zebra OX=106582 PE=4 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 1.909e-59
Identity = 125/271 (46.13%), Postives = 186/271 (68.63%), Query Frame = 1
Query:  223 IRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKD------TMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIK--SENMFKLIAQRDSN--------------PTRRE--NLVKGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPD 963
            +R+E E +QK+TFTKWIN+ L+K  P  ++ +L+ D+ DG++LL LL++L+ Q+L  E+ + ++R+H ++N+ + + FL+          IKL+NIHA DI DGRP+I+LGL+W IIL FQI+  + N+  L A  +SN              P +R+  N  KGN ++ALL W      +N+GI + DF  SW+DG AF++++H I P+LVD ++++RR++RENLE AF LAE  L IP+LL+PEDVDVD PDEKSIMTY++ FL +YP+
Sbjct:    4 LRDEQEAVQKRTFTKWINSHLAKHKPPLEVNDLFEDIKDGVKLLALLEVLSGQRLPREQGRQLKRIHWVSNIGTALKFLEGRKSVYRGSPIKLVNIHATDIADGRPSIVLGLIWTIILYFQIEELTSNLPALQALSNSNSSVESITSSGTGSPPMKRKVVNKFKGNAKKALLQWVQCTAAKNFGIEVKDFGPSWRDGVAFHSVVHAIRPDLVDMEVVRRRSNRENLEEAFSLAENELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYPN 274          
BLAST of nesprin-1-like vs. TrEMBL
Match: A0A3P8NQC6 (Uncharacterized protein OS=Astatotilapia calliptera OX=8154 PE=4 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 2.120e-59
Identity = 125/271 (46.13%), Postives = 185/271 (68.27%), Query Frame = 1
Query:  223 IRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKD------TMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIK--SENMFKLIAQRDSN--------------PTRRE--NLVKGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPD 963
            +R+E E +QK+TFTKWIN+ L+K  P  ++ +L+ D+ DG++LL LL++L+ Q+L  E+ + ++R+H ++N+ + + FL+          IKL+NIHA DI DGRP+I+LGL+W IIL FQI+  + N+  L A  +SN              P +R+  N  KGN ++ALL W      +N+GI + DF  SW+DG AF +++H I P+LVD ++++RR++RENLE AF LAE  L IP+LL+PEDVDVD PDEKSIMTY++ FL +YP+
Sbjct:    4 LRDEQEAVQKRTFTKWINSHLAKHKPPLEVNDLFEDIKDGVKLLALLEVLSGQRLPREQGRQLKRIHWVSNIGTALKFLEGRKSVYRGSPIKLVNIHATDIADGRPSIVLGLIWTIILYFQIEELTSNLPALQALSNSNSSVESITSSGTGSPPMKRKVVNKFKGNAKKALLQWVQCTAAKNFGIEVKDFGPSWRDGVAFQSVVHAIRPDLVDMEVVRRRSNRENLEEAFSLAENELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYPN 274          
BLAST of nesprin-1-like vs. TrEMBL
Match: A0A3Q3K894 (Uncharacterized protein OS=Monopterus albus OX=43700 PE=4 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 4.934e-59
Identity = 124/267 (46.44%), Postives = 184/267 (68.91%), Query Frame = 1
Query:  217 RQIRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIK--SENMFKLIAQRDSN--------------PTRRE--NLVKGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPD 963
            R+ +NE E +QK+TFTKWIN+ L+K  P  ++ +L+ D+ DG++LL LL++L+ Q+L  E+ + ++R+H ++N+ + + FL +   IKL+NIHA DI DGRP+I+LGL+W +IL FQI+  + N+  L A  +SN              P +R+  N  +GN ++ALL W      + YGI + DF  SW+DG AF +++H I P+LVD + ++RR++RENLE AF LAE  L IP+LL+PEDVDVD PDEKSIMTY++ FL +YP+
Sbjct:    3 RESQNEQEAVQKRTFTKWINSHLAKHKPPLEVNDLFEDIKDGVKLLALLEVLSGQRLPCEQGRQLKRIHWVSNIGAALKFL-EGRKIKLVNIHATDIADGRPSIVLGLIWTVILYFQIEELTSNLPALQALSNSNSSVESIANSETGSPPMKRKVVNKFQGNAKKALLRWVQCTAAKQYGIEVKDFGPSWRDGVAFQSVVHAIRPDLVDMEAVRRRSNRENLEEAFALAENELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYPN 268          
BLAST of nesprin-1-like vs. TrEMBL
Match: A0A1I8GMD0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 6.184e-59
Identity = 126/249 (50.60%), Postives = 176/249 (70.68%), Query Frame = 1
Query:  217 RQIRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIKSENMFKLIAQRDSNPTRRENLVKGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPD 963
            + +R+E E +QKKTFT WIN  L    P  KI +L+ ++ DG RLL LL++L+  KL  E R +MQRVHCL+N+ + + FL ++  IKL+NI+ ADIVDG+P I+LGL+W IIL FQI+ +      +   +    R  L KG+ ++ALLAW+   + + Y + + DF SSW+DG AFNA++HNI+P+LVD D ++ R++RENLE AF+ AE  LNIP+LL+ EDVDVD PDEKSIMTY++ FL  YP+
Sbjct:   11 KSLRDEQERVQKKTFTNWINTYLITCQPPCKISDLFTEIKDGTRLLLLLEVLSGNKLQKENRGNMQRVHCLSNVRTALSFL-ESKQIKLVNINPADIVDGKPTIVLGLMWTIILYFQIEEQEDMIRKSLEGTELAERGELFKGSAKKALLAWAQNNLGDKYDVDLKDFGSSWRDGAAFNAMVHNIDPSLVDMDALRSRSNRENLEAAFQAAENGLNIPRLLDAEDVDVDKPDEKSIMTYIAQFLKAYPE 258          

HSP 2 Score: 65.855 bits (159), Expect = 4.543e-6
Identity = 65/334 (19.46%), Postives = 151/334 (45.21%), Query Frame = 2
Query: 1625 PPSRVPRIYVDSIKSRIN-IISDKCPELSAYFELFGLFRAATDKHLELQNKIKFLKSGFESFQILVDKYEELKSLV-HGEDTESLKVHLKQISESSSKIVKGFISKDISRQMILNQTNQKINDVVKSTLKEIEDILSNQNSLLNKWKKYNEKKDDLIKWISQAKSALKLDKSKRDEFFAANFKLNYQSFVEEKNHFSSSDPDCI-----RFIENEFEMINESWNSIVKEIELKRQFENIFTLKKEYNERIERIENWMSKSETIADRKTTCERAELEENLDILEAAAKNFETVKIDLQKAAKIGESMFKSNLMESDTEEILGKLQIHKDRFVIVR 2605
            PP+ V    + ++ +R+  +I+D+ P++    E     R       + + K+          Q + D + +  + V  G+  + ++  L  + + +  + K   S        L+ T ++ + V +    +++         ++ WK Y+    +   W+  A+ AL+    +RD FFA   K   +S + E N  +S    C        I  + + I   W ++ ++ +   + +++   +++Y++   R+ +W+ +SET+AD +  C R +++E+LD ++      E ++ + +  +K  + M K  L ++  +E+L  L+  ++R   VR
Sbjct:  430 PPAGVSDAQIANMDTRLGRVIADE-PDVRRRLEFLEPKRRLLASLAQCERKLPLWTGKCGKQQEVEDLFSDYNAFVIDGKLVDGVEQALDSLRKQAEPMRKRDPSGSREADRFLSDTRKRWDKVKR----DVQGAGGPLEKAISCWKTYSRLSVEFNDWLPDAEQALRSTPDERDRFFADIRK--RESDMRELNEAASYLTGCCVEPVASEIRTQQQTIGRRWKALFEDFKKTEKLDSLERNRRDYHDGSGRLRDWLDRSETLADAEVACSREKVKESLDQIQELVDQQEAMEGEFKTLSKAAQDMAK-ELPKASLDEMLASLKEARERLQKVR 755          
BLAST of nesprin-1-like vs. Ensembl Cavefish
Match: ENSAMXT00000036923.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:24166584:24185412:1 gene:ENSAMXG00000043596.1 transcript:ENSAMXT00000036923.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 218.009 bits (554), Expect = 3.633e-60
Identity = 125/269 (46.47%), Postives = 183/269 (68.03%), Query Frame = 1
Query:  229 NEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMH------IKLINIHAADIVDGRPNIILGLVWQIILNFQIK--SENMFKLIA--------------QRDSNPTRRENLVK--GNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPD 963
            NE E +QK+TFTKWIN+ L+K++P  +I +L+ D+ DG++LL LL++L+ Q+L  E+ + ++R+H ++N+ + + FL+          IKL+NI+A DI DGRP+I+LGL+W IIL FQI+  + N+  L A              +  S P +R+ + K  GN + ALL W     T+  GI + DF SSW+ G AF+++I+ I P+LVD +L+KRR++RENLE AF +AE  L IP+LL+PEDVDVD PDEKSIMTY++ FL +YPD
Sbjct:   12 NEQESVQKRTFTKWINSHLAKRNPPLEINDLFEDIKDGVKLLALLEVLSGQRLPSEQGRQLKRIHWVSNIGTALKFLEGRRSVYRGSPIKLVNINATDIADGRPSIVLGLMWTIILYFQIEELTSNLPALQALSNSASSVDSMASSETASPPMKRKVVTKFQGNAKRALLRWVQCTATKRLGIEVKDFGSSWRTGVAFHSVIYAIRPDLVDMELVKRRSNRENLEEAFTVAENELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYPD 280          
BLAST of nesprin-1-like vs. Ensembl Cavefish
Match: ENSAMXT00000039764.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:24167966:24185412:1 gene:ENSAMXG00000043596.1 transcript:ENSAMXT00000039764.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 215.698 bits (548), Expect = 2.167e-59
Identity = 124/268 (46.27%), Postives = 182/268 (67.91%), Query Frame = 1
Query:  232 EHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMH------IKLINIHAADIVDGRPNIILGLVWQIILNFQIK--SENMFKLIA--------------QRDSNPTRRENLVK--GNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPD 963
            E E +QK+TFTKWIN+ L+K++P  +I +L+ D+ DG++LL LL++L+ Q+L  E+ + ++R+H ++N+ + + FL+          IKL+NI+A DI DGRP+I+LGL+W IIL FQI+  + N+  L A              +  S P +R+ + K  GN + ALL W     T+  GI + DF SSW+ G AF+++I+ I P+LVD +L+KRR++RENLE AF +AE  L IP+LL+PEDVDVD PDEKSIMTY++ FL +YPD
Sbjct:   10 EQESVQKRTFTKWINSHLAKRNPPLEINDLFEDIKDGVKLLALLEVLSGQRLPSEQGRQLKRIHWVSNIGTALKFLEGRRSVYRGSPIKLVNINATDIADGRPSIVLGLMWTIILYFQIEELTSNLPALQALSNSASSVDSMASSETASPPMKRKVVTKFQGNAKRALLRWVQCTATKRLGIEVKDFGSSWRTGVAFHSVIYAIRPDLVDMELVKRRSNRENLEEAFTVAENELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYPD 277          
BLAST of nesprin-1-like vs. Ensembl Cavefish
Match: ENSAMXT00000045503.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:24166584:24193162:1 gene:ENSAMXG00000043596.1 transcript:ENSAMXT00000045503.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 219.935 bits (559), Expect = 2.261e-56
Identity = 125/269 (46.47%), Postives = 183/269 (68.03%), Query Frame = 1
Query:  229 NEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMH------IKLINIHAADIVDGRPNIILGLVWQIILNFQIK--SENMFKLIA--------------QRDSNPTRRENLVK--GNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPD 963
            NE E +QK+TFTKWIN+ L+K++P  +I +L+ D+ DG++LL LL++L+ Q+L  E+ + ++R+H ++N+ + + FL+          IKL+NI+A DI DGRP+I+LGL+W IIL FQI+  + N+  L A              +  S P +R+ + K  GN + ALL W     T+  GI + DF SSW+ G AF+++I+ I P+LVD +L+KRR++RENLE AF +AE  L IP+LL+PEDVDVD PDEKSIMTY++ FL +YPD
Sbjct:   12 NEQESVQKRTFTKWINSHLAKRNPPLEINDLFEDIKDGVKLLALLEVLSGQRLPSEQGRQLKRIHWVSNIGTALKFLEGRRSVYRGSPIKLVNINATDIADGRPSIVLGLMWTIILYFQIEELTSNLPALQALSNSASSVDSMASSETASPPMKRKVVTKFQGNAKRALLRWVQCTATKRLGIEVKDFGSSWRTGVAFHSVIYAIRPDLVDMELVKRRSNRENLEEAFTVAENELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYPD 280          
BLAST of nesprin-1-like vs. Ensembl Cavefish
Match: syne1a (spectrin repeat containing, nuclear envelope 1a [Source:ZFIN;Acc:ZDB-GENE-030131-4172])

HSP 1 Score: 201.83 bits (512), Expect = 2.090e-50
Identity = 118/274 (43.07%), Postives = 176/274 (64.23%), Query Frame = 1
Query:  199 LIRTRGRQIRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIKSENMFKLIAQRD-----------------SNPTRRENLV--KGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPD 963
            L+    + +R+E E +QK+TFTKWIN+ L+K+ P   +++LY D+ DG+ LL LL++L+  KL  E+ + ++R+H LAN+ + + FL +   IKL+NI+  D+VDGRP+I+LGL+W IIL FQI+ E    L  Q+                  S P +R+  +  +G  + ALL W  +  T+  G+ + DF  SW+ G AF+A+I  + P LV+ + +  R +R NLE AF LAE+ L IP+LL+PEDVDVD PDEKSIMTY++ FL ++PD
Sbjct:   27 LVAGVSQHLRDEQEAVQKRTFTKWINSHLAKRDPPLVVKDLYEDIKDGVMLLALLEVLSGHKLPCEQGRKLRRIHWLANVGTALRFL-EGRRIKLVNINTTDVVDGRPSIVLGLIWTIILYFQIE-ELTSSLPPQKGQNSSNSSVDSSNSTETASPPVKRKPRLSFQGGAKRALLKWVQRTATKRLGLDVKDFGPSWRSGVAFHAVIFALRPQLVNMERVWNRPNRANLEEAFSLAERELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHHPD 298          
BLAST of nesprin-1-like vs. Ensembl Cavefish
Match: ENSAMXT00000009444.2 (spectrin beta chain, non-erythrocytic 1-like [Source:NCBI gene;Acc:103033421])

HSP 1 Score: 170.629 bits (431), Expect = 4.421e-41
Identity = 102/252 (40.48%), Postives = 162/252 (64.29%), Query Frame = 1
Query:  202 IRTRGRQIRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIKSENMFKLIAQRDSNPTRRENLVKGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNY 957
            +  R +Q+++E E +QKKTFTKW+N+ L++     +I +LY+DL DG  L++LL++L+ +KL    +  M R+HCL N+   + FLK+   + L N+ + DIVDG   + LGL+W IIL FQI+           D +    +N  K + ++ALL W          ++I++F +SW+DG AFNA+IH   P+L+D+D +K+ N+  NL+ AF LAE++L + KLL+PED+ V++PDEKSI+TY+  + H +
Sbjct:   66 LEGRFKQLQDEREAVQKKTFTKWVNSHLARVSC--RITDLYMDLRDGRMLIKLLEVLSGEKLPKPTKGRM-RIHCLENVDKALQFLKE-QRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQ-----------DISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVEHPDEKSIITYVVTYYHYF 302          
BLAST of nesprin-1-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008111.1 (pep scaffold:Pmarinus_7.0:GL478136:8967:48859:1 gene:ENSPMAG00000007298.1 transcript:ENSPMAT00000008111.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 169.859 bits (429), Expect = 1.298e-41
Identity = 103/251 (41.04%), Postives = 160/251 (63.75%), Query Frame = 1
Query:  205 RTRGRQIRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIKSENMFKLIAQRDSNPTRRENLVKGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNY 957
            R+R + + +E E +QKKTFTKW+N+ L++     +I +LY DL DG  L++LL++L+ +KL    R  M R+HCL N+   + FLK+   + L N+ + DIVDG   +ILGL+W IIL FQI+      +  + + N  RR      + ++ALL W          ++I++F +SW+DG AFNAI+H   P+L+++D +K+ N+  NL+ AF +AE+ L + KLL+PED+ VD PDEKSI+TY+  + H +
Sbjct:   45 RSRIKALADEREAVQKKTFTKWVNSHLARVSC--RITDLYTDLRDGRMLIKLLEVLSGEKLPKPTRGKM-RIHCLENVDKALQFLKE-QKVHLENMGSHDIVDGNHRLILGLIWTIILRFQIQD-----ISVETEDNKERR------SAKDALLLWCQMKTAGYQNVNIHNFTTSWRDGLAFNAIVHKHRPDLIEFDKLKKSNAHHNLQNAFNIAEQKLGLTKLLDPEDISVDQPDEKSIITYVVTYYHYF 280          
BLAST of nesprin-1-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009426.1 (pep scaffold:Pmarinus_7.0:GL476614:383620:553344:1 gene:ENSPMAG00000008375.1 transcript:ENSPMAT00000009426.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 170.244 bits (430), Expect = 1.374e-41
Identity = 106/265 (40.00%), Postives = 172/265 (64.91%), Query Frame = 1
Query:  229 NEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIK--SENMFKL--------IAQRDSNPT------RRENLVKGNPREALLAWSDKVI----TENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPD 963
            +E E +QK+TFTKWIN+ L+   P   + +L+ DL DG++L+ LL++LT ++L  E+ + ++R+H L+N+ + + F+ +   IKL+NI+A  I DG+P+I+LGL+W IIL FQI+  + N+  +        ++  + + T      RR+  ++   ++ALL W   V+    +   G  I DF +SW+ G AF+ +I  I P LV+ + + +R++ ENLE AF +AE+ L IP+LL+P+DVDVD PDEK IMTY++ FL +YP+
Sbjct:    1 DEQEAVQKRTFTKWINSHLALVRPPLVVDDLFKDLRDGVKLIALLEVLTGERLPYEQGRQLKRIHALSNIGTALKFM-EARRIKLVNINAPYIADGKPSIVLGLIWTIILYFQIEEATNNLLPISPWSSETSLSSMEGSSTASPQRKRRQTPMRSTAKKALLKWVQLVVPSLESRVGGTEIRDFGASWRTGIAFHLMIRAIQPELVNLEQVTQRSNHENLEEAFIVAEEKLGIPRLLDPKDVDVDKPDEKIIMTYVAQFLKHYPN 264          
BLAST of nesprin-1-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006515.1 (pep scaffold:Pmarinus_7.0:GL476558:286719:335794:-1 gene:ENSPMAG00000005865.1 transcript:ENSPMAT00000006515.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 158.688 bits (400), Expect = 1.644e-39
Identity = 105/247 (42.51%), Postives = 150/247 (60.73%), Query Frame = 1
Query:  229 NEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIKSENMFKLIAQRDSNPTRRENLVKGNP-REALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLF---LHNY 957
            +E + +QKKTFTKWIN+ L  +     I +LY DL DG  L+ LL+ L+   +  EK +   RVH + N+  ++ +L+    +KL+NI   DIVDG P + LGL+W IIL++Q+ +  +                   G P RE LLAW+  V  +  G+S ++F SSW+DG+   AI+H   P LVD + ++RR +R+NLE A  LAE  L +P+LL+PEDVDVD PDEKSI+TY+S     LHN+
Sbjct:    1 DERDRVQKKTFTKWINSHL--QQVRMNIGDLYEDLRDGQALISLLESLSGDCIIREKGR--LRVHHVQNIQIVLNYLQH-QQVKLVNIRKEDIVDGNPKLTLGLIWTIILHYQVSAGQVGG-----------------GTPGRERLLAWARLVAKDVPGLSCHNFSSSWRDGRLLCAIVHAHRPGLVDLEEVRRRGARQNLEEALSLAESELGVPRLLDPEDVDVDAPDEKSIITYVSALHNALHNH 225          
BLAST of nesprin-1-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006506.1 (pep scaffold:Pmarinus_7.0:GL476558:286440:335800:-1 gene:ENSPMAG00000005865.1 transcript:ENSPMAT00000006506.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 155.221 bits (391), Expect = 5.465e-38
Identity = 106/244 (43.44%), Postives = 152/244 (62.30%), Query Frame = 1
Query:  223 IRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIKSENMFKLIAQRDSNPTRRENLVKGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHN 954
            + +E + +QKKTFTKWIN+ L  +     I +LY DL DG  L+ LL+ L+   +  EK +   RVH + N+  ++ +L+    +KL+NI   DIVDG P + LGL+W IIL++Q  S       A  + N +  ++      RE LLAW+  V  +  G+S ++F SSW+DG+   AI+H   P LVD + ++RR +R+NLE A  LAE  L +P+LL+PEDVDVD PDEKSI+TY+S  LHN
Sbjct:    1 LADERDRVQKKTFTKWINSHL--QQVRMNIGDLYEDLRDGQALISLLESLSGDCIIREKGR--LRVHHVQNIQIVLNYLQH-QQVKLVNIRKEDIVDGNPKLTLGLIWTIILHYQNAS------FAHIEGNHSSMQS------RERLLAWARLVAKDVPGLSCHNFSSSWRDGRLLCAIVHAHRPGLVDLEEVRRRGARQNLEEALSLAESELGVPRLLDPEDVDVDAPDEKSIITYVS-ALHN 226          
BLAST of nesprin-1-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002838.1 (pep scaffold:Pmarinus_7.0:GL477168:22072:87306:1 gene:ENSPMAG00000002584.1 transcript:ENSPMAT00000002838.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 153.68 bits (387), Expect = 1.927e-37
Identity = 102/241 (42.32%), Postives = 147/241 (61.00%), Query Frame = 1
Query:  223 IRNEHEHIQKKTFTKWINNLLSK--KHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIKSENMFKLIAQRDSNPTRRENLVKGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLS 939
            I +E + +QKKTFTKW+N  L K  KH    + ++Y DL DG  L+ LL++L+ +KL  EK +   R H L N+   + FL+    IKL+NI + DI DG P + LGL+W IIL+FQI      ++  Q +              ++ LL WS +++    GI  ++F +SW+DG+ FNAIIH   P L+D   +  R +RENLE AF +AE+ + + +LL+PEDVDV  PDEKSI+TY+S
Sbjct:    4 IADERDRVQKKTFTKWVNKHLMKVRKH----VNDMYEDLRDGHNLISLLEVLSGEKLPREKGR--MRFHRLHNVQIALDFLR-LRQIKLVNIRSDDIADGNPKLTLGLIWTIILHFQIAD---IQVSGQSEDM----------TAKDRLLLWSQRMVEGYPGIRCDNFTTSWRDGRLFNAIIHRHRPELIDMKRVAVRANRENLEQAFTVAERDMGVTRLLDPEDVDVPSPDEKSIITYVS 224          
BLAST of nesprin-1-like vs. Ensembl Yeast
Match: SAC6 (Fimbrin, actin-bundling protein; cooperates with Scp1p in organization and maintenance of the actin cytoskeleton; phosphorylated by Cdc28p/Clb2p in metaphase on T103, to regulate conformation, and modulate actin filament binding affinity and actin cable dynamics; relocalizes from the plasma membrane to the cytoplasm upon DNA replication stress; human homologs PLS3 and LCP1 implicated in spinocerebellar ataxia type 2 (SCA2) can each complement yeast null mutant [Source:SGD;Acc:S000002536])

HSP 1 Score: 51.6026 bits (122), Expect = 3.517e-6
Identity = 55/214 (25.70%), Postives = 93/214 (43.46%), Query Frame = 1
Query:  247 QKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLT---IEKR----KHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQII-LNFQIKSENMFKLIAQRDSNPTRRENLVKGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNA-----IIHNINPNLVDWDLIKRRNSRENLEYAFRLA 849
            + + FT W+N+L      +  + +L+ DL DG+ LL+  + +    +    + KR      + R   L N    +  L       L+ I  +DIVDG   + LGLVWQ++  N  I  + +    + RD + ++            +L W+   +T+      N    S+KD    NA     +++ I P  VD+DL+   N+ E      RLA
Sbjct:  413 EARVFTLWLNSL----DVDPPVISLFDDLKDGLILLQAYEKVMPGAVDFKHVNKRPASGAEISRFKALENTNYAVD-LGRAKGFSLVGIEGSDIVDGNKLLTLGLVWQLMRRNISITMKTLSS--SGRDMSDSQ------------ILKWAQDQVTKG---GKNSTIRSFKDQALSNAHFLLDVLNGIAPGYVDYDLVTPGNTEEERYANARLA 604          

HSP 2 Score: 51.6026 bits (122), Expect = 3.577e-6
Identity = 52/225 (23.11%), Postives = 108/225 (48.00%), Query Frame = 1
Query:  247 QKKTFTKWINNLLSKKH--------PEEKIQNLYVDLCDGIRLLELLQ------ILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQII-------LNFQIKSENMFKLIAQRDSNPTRRENLVKGNPREALLAWSDKVITE-NYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEK 855
            +++ FTK IN++L+           P +  Q L+ +  DG+ L +L+       I T+     +K K +       N   +I   K  +   ++N+H+ DI++GR ++ILGL+WQII       ++ ++  E +++L+   ++     E  ++  P + LL W +  + + N+   + +F     DG+ +  +++ ++P L     ++  +  E  E   + AEK
Sbjct:  141 ERREFTKHINSVLAGDQDIGDLLPFPTDTFQ-LFDECRDGLVLSKLINDSVPDTIDTRVLNWPKKGKELNNFQASENANIVINSAK-AIGCVVVNVHSEDIIEGREHLILGLIWQIIRRGLLSKIDIKLHPE-LYRLLEDDET----LEQFLRLPPEQILLRWFNYHLKQANWNRRVTNFSKDVSDGENYTILLNQLDPALCSKAPLQTTDLMERAEQVLQNAEK 358          
BLAST of nesprin-1-like vs. Ensembl Nematostella
Match: EDO41099 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5D1])

HSP 1 Score: 151.754 bits (382), Expect = 1.532e-37
Identity = 93/241 (38.59%), Postives = 140/241 (58.09%), Query Frame = 1
Query:  229 NEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIKSENMFKLIAQRDSNPTRRENLVKGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLH 951
            +EHE  QKKTFTKWIN  LS+     ++ +L+ DL DG  L+ LL++LT +K  I++ +   R+H L N+ + +  L++   I+LINI   DIVDG   + LGL+W +I +FQ+     F L    D          +G P E LL+W         G+S+ +F +SW+DG AFNA+IH   P+L  +D +   +   N E+AF++A   L +  LL+ EDV  D PD+KSI+ Y+++  H
Sbjct:    2 DEHEGTQKKTFTKWINIQLSRAGNNVRVGDLFNDLKDGTILIALLEVLTGKK--IKRERGNMRLHHLNNVNNAMMILEEN-DIRLINISNNDIVDGNHKMTLGLIWSVIAHFQLN----FALQFLMDE---------EGTPEEVLLSWCQNTTKGYKGVSVTNFTTSWRDGLAFNAVIHRYRPDLFSYDALVGSSPMSNCEHAFKVARDSLGVDSLLDAEDVVRDRPDKKSIIMYVTMLCH 226          
BLAST of nesprin-1-like vs. Ensembl Nematostella
Match: EDO29101 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4L2])

HSP 1 Score: 146.747 bits (369), Expect = 2.190e-37
Identity = 91/251 (36.25%), Postives = 146/251 (58.17%), Query Frame = 1
Query:  205 RTRGRQIRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIKSENMFKLIAQRDSNPTRRENLVKGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNY 957
            + R + ++NE    QKKTFTKW+N+ L K      + +L+ DL DG  L+ LL+I++ +K+    R    RVH + N+   + FL+ +  +KL +I A D+VDG   +ILGL+W IIL FQI        I+ +D     R++      +EALL W  ++      + I +F +SW++G AFNA++H   P+L+D+  ++      NL  AF +AE+ L I +LL+ EDVD   PD++S+MTY++ +   +
Sbjct:   11 KDRIKTLKNERIFSQKKTFTKWVNSFLDKVRSGLHVNDLFEDLADGKILISLLEIISGEKIGFAARGKF-RVHNIQNVNKALEFLQKS--VKLESIGAEDVVDGNERLILGLIWMIILRFQIAD------ISYQDDMSKERKS-----AKEALLLWCQRMTRGYPDVDIQNFSTSWRNGLAFNALLHKHRPDLIDYATLRPSQHEANLNNAFTVAEEKLGITRLLDAEDVDCPRPDDRSVMTYVAAYYQYF 247          
BLAST of nesprin-1-like vs. Ensembl Nematostella
Match: EDO42431 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1C0])

HSP 1 Score: 156.762 bits (395), Expect = 2.354e-37
Identity = 106/280 (37.86%), Postives = 161/280 (57.50%), Query Frame = 1
Query:  205 RTRGRQIRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIKSENMFKLIAQRDSNPTRRENLVKGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPDQDIHKNSAPKASHNWIDIKTSEETAMD 1044
            R+R + + +E E +QKKTFTKWIN+ L +     ++  LY DL DG +L+ LL++L+ +KL    +  M R+H L N+   + FLK    + L N+ A DIVDG   I LGL+W IIL FQI+   +              E   K + ++ALL W          ++I +F +SW+DG AFNAIIH   P+L++++ + + ++ +NLE AF +AE  L I  LL+ EDV+VD+PDEKSI+TY++ + H +      + S  +       IK +EE  +D
Sbjct:   12 RSRIKVLADERERVQKKTFTKWINSHLQRVGA--RVNELYHDLQDGRKLILLLEVLSGEKLPKPSKGRM-RIHNLENVEKSLVFLK-KQRVHLENVGAHDIVDGNQKITLGLIWTIILRFQIQDITI------------EGETTEKRSAKDALLLWCQSKTVGYVHVTITNFTTSWRDGLAFNAIIHRHRPDLIEFEKLTKADAEQNLEQAFEVAETQLGITPLLDAEDVNVDFPDEKSILTYVAAYYHYFAKMKTVEVSGSRIGKVIERIKENEELIID 275          
BLAST of nesprin-1-like vs. Ensembl Nematostella
Match: EDO30309 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T157])

HSP 1 Score: 140.584 bits (353), Expect = 9.516e-37
Identity = 84/219 (38.36%), Postives = 132/219 (60.27%), Query Frame = 1
Query:  229 NEHEHIQKKTFTKWINNLLSKKHPEE--KIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIKSENMFKLIAQRDSNPTRRENLVKGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLL 879
             E E+  +K FTKW+N+ L+  HP E   I+++  DL DG  LL LL++LT++KL  +K K   RVH + N+   +  L D   IKL+ I+  DIVDG+  +ILGL+W IIL FQ++       + Q++ N    ++       + LL W  + + + Y + INDF SSW++G AF+AI+H+ NP   D+  +K+  + E LE+AF+ AE   ++P++L
Sbjct:    6 GERENAHRKAFTKWVNSKLAD-HPTEPCTIKDVVTDLQDGRMLLNLLEVLTRKKL--KKEKGNLRVHKINNVERALVLL-DECKIKLVGINGFDIVDGKHRVILGLLWSIILRFQVEE------VMQQEVNAESAKSF---TIEKRLLEWCRERL-DGYDVEINDFSSSWQNGLAFSAILHSYNPEAFDYTEVKQMGTTERLEHAFQSAEDGFDVPRIL 210          
BLAST of nesprin-1-like vs. Ensembl Nematostella
Match: EDO49576 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGP7])

HSP 1 Score: 146.747 bits (369), Expect = 5.164e-35
Identity = 91/252 (36.11%), Postives = 146/252 (57.94%), Query Frame = 1
Query:  205 RTRGRQIRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIKSENMFKLIAQRDSNPTRRENLVKGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYP 960
            + R + ++NE    QKKTFTKW+N+ L K      + +L+ DL DG  L+ LL+I++ +K+    R    RVH + N+   + FL+ +  +KL +I A D+VDG   +ILGL+W IIL FQI        I+ +D     R++      +EALL W  ++     G+ I +F +SW++G AFNA++H   P+L+D+  ++      NL  AF +A + L I +LL+ EDVD   PD++S+MTY++ +   + 
Sbjct:   11 KDRIKTLKNERIFSQKKTFTKWVNSFLDKSGLH--VNDLFEDLADGKILISLLEIISGEKIGFAARGKF-RVHNIQNVNKALEFLQKS--VKLESIGAEDVVDGNERLILGLIWMIILRFQIAD------ISYQDDMSKERKS-----AKEALLLWCQRMTRGYPGVDIQNFSTSWRNGLAFNALLHKHRPDLIDYATLRPSQHEANLNNAFTVAAEKLGITRLLDAEDVDCPRPDDRSVMTYVAAYYQYFA 246          
BLAST of nesprin-1-like vs. Ensembl Medaka
Match: ENSORLT00000000374.2 (pep primary_assembly:ASM223467v1:22:316712:329038:1 gene:ENSORLG00000000306.2 transcript:ENSORLT00000000374.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 211.846 bits (538), Expect = 4.647e-56
Identity = 124/275 (45.09%), Postives = 181/275 (65.82%), Query Frame = 1
Query:  229 NEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIK--SENMFKLIA--------------QRDSNPTRRENLVK--GNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPDQDIHKNSAPKAS 999
            +E E +QK+TFTKWIN+ L      EK+ +L+ D+ DG++LL LL++L+ Q+L  E+ +H++R+H ++N+ + + FL +   IKL+NIHA D+ DGRP+I+LGL+W IIL FQI+  + N+  L A              +  S P +R+ L K  GN ++ LL W      +++GI + DF  SW+DG AF +++H I P+LVD + ++RR++RENLE AF LAE  L IP+LL+PEDVDVD PDEKSIMTY++ FL +YP      N  P A 
Sbjct:    4 HEQEAVQKRTFTKWINSHL------EKMNDLFEDIKDGVKLLALLEVLSGQRLPCEQGRHLKRIHWVSNISTALKFL-EGRKIKLVNIHATDVADGRPSIVLGLIWTIILYFQIEELTSNLPALQAFSNSSSSVDSLTSSETGSPPVKRKVLHKFQGNAKKVLLRWVQCTAAKHHGIEVKDFGPSWRDGVAFQSMVHAIRPDLVDMEEVRRRSNRENLEEAFSLAENELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYP------NPGPAAG 265          
BLAST of nesprin-1-like vs. Ensembl Medaka
Match: ENSORLT00000028699.1 (pep primary_assembly:ASM223467v1:24:9030419:9045840:-1 gene:ENSORLG00000028886.1 transcript:ENSORLT00000028699.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 195.667 bits (496), Expect = 1.706e-52
Identity = 120/277 (43.32%), Postives = 181/277 (65.34%), Query Frame = 1
Query:  229 NEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKD------TMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIK--SENMFKL---------------IAQRDSNPTRRENL--VKGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPDQDIHKNS 984
            +E E +QK+TFTKWIN+ L+K  P  ++++L+ D+ DG+ LL LL++L+ QKL  E+ K ++R+H +AN+ + + FL+          IKL+NI++ DIVDGRP+I+LGLVW IIL +QI+  + ++ +L                    S P +R+ L  V+G  R+ALL W  +  T+   + + DF  SW+ G AF A+I+ + PNLVD + ++RR++RENL+ AF LAE  L IP+LL+PEDVDVD PDEKS+MTY++ FL  YP Q   +++
Sbjct:   14 HEQEAVQKRTFTKWINSHLAKHAPPLEVKDLFEDIKDGVMLLALLEVLSGQKLPCEQGKKLKRIHWVANIGTALKFLEGRKSAYRGSPIKLVNINSTDIVDGRPSIVLGLVWTIILYYQIEELTSSLPELPLLSSSTSSMDSSTSSTDTTSPPVKRKPLPPVQGGARKALLRWVQQTSTKCLRLEVKDFGPSWRTGLAFFALINALRPNLVDMERVRRRSNRENLQEAFLLAETELGIPQLLDPEDVDVDKPDEKSVMTYVAQFL-KYPPQRKQRDA 289          
BLAST of nesprin-1-like vs. Ensembl Medaka
Match: ENSORLT00000031933.1 (pep primary_assembly:ASM223467v1:24:9030419:9050235:-1 gene:ENSORLG00000028886.1 transcript:ENSORLT00000031933.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 193.741 bits (491), Expect = 6.997e-52
Identity = 119/275 (43.27%), Postives = 179/275 (65.09%), Query Frame = 1
Query:  235 HEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKD------TMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIK--SENMFKL---------------IAQRDSNPTRRENL--VKGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPDQDIHKNS 984
             E +QK+TFTKWIN+ L+K  P  ++++L+ D+ DG+ LL LL++L+ QKL  E+ K ++R+H +AN+ + + FL+          IKL+NI++ DIVDGRP+I+LGLVW IIL +QI+  + ++ +L                    S P +R+ L  V+G  R+ALL W  +  T+   + + DF  SW+ G AF A+I+ + PNLVD + ++RR++RENL+ AF LAE  L IP+LL+PEDVDVD PDEKS+MTY++ FL  YP Q   +++
Sbjct:   19 QEAVQKRTFTKWINSHLAKHAPPLEVKDLFEDIKDGVMLLALLEVLSGQKLPCEQGKKLKRIHWVANIGTALKFLEGRKSAYRGSPIKLVNINSTDIVDGRPSIVLGLVWTIILYYQIEELTSSLPELPLLSSSTSSMDSSTSSTDTTSPPVKRKPLPPVQGGARKALLRWVQQTSTKCLRLEVKDFGPSWRTGLAFFALINALRPNLVDMERVRRRSNRENLQEAFLLAETELGIPQLLDPEDVDVDKPDEKSVMTYVAQFL-KYPPQRKQRDA 292          
BLAST of nesprin-1-like vs. Ensembl Medaka
Match: ENSORLT00000033742.1 (pep primary_assembly:ASM223467v1:24:9030654:9050235:-1 gene:ENSORLG00000028886.1 transcript:ENSORLT00000033742.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 196.052 bits (497), Expect = 1.264e-50
Identity = 119/269 (44.24%), Postives = 179/269 (66.54%), Query Frame = 1
Query:  235 HEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIK--SENMFKL---------------IAQRDSNPTRRENL--VKGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPDQDIHKNS 984
             E +QK+TFTKWIN+ L+K  P  ++++L+ D+ DG+ LL LL++L+ QKL  E+ K ++R+H +AN+ + + FL +   IKL+NI++ DIVDGRP+I+LGLVW IIL +QI+  + ++ +L                    S P +R+ L  V+G  R+ALL W  +  T+   + + DF  SW+ G AF A+I+ + PNLVD + ++RR++RENL+ AF LAE  L IP+LL+PEDVDVD PDEKS+MTY++ FL  YP Q   +++
Sbjct:   19 QEAVQKRTFTKWINSHLAKHAPPLEVKDLFEDIKDGVMLLALLEVLSGQKLPCEQGKKLKRIHWVANIGTALKFL-EGRKIKLVNINSTDIVDGRPSIVLGLVWTIILYYQIEELTSSLPELPLLSSSTSSMDSSTSSTDTTSPPVKRKPLPPVQGGARKALLRWVQQTSTKCLRLEVKDFGPSWRTGLAFFALINALRPNLVDMERVRRRSNRENLQEAFLLAETELGIPQLLDPEDVDVDKPDEKSVMTYVAQFL-KYPPQRKQRDA 285          
BLAST of nesprin-1-like vs. Ensembl Medaka
Match: sptb (spectrin beta chain, erythrocytic [Source:NCBI gene;Acc:101175117])

HSP 1 Score: 174.866 bits (442), Expect = 1.890e-42
Identity = 105/251 (41.83%), Postives = 159/251 (63.35%), Query Frame = 1
Query:  205 RTRGRQIRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIKSENMFKLIAQRDSNPTRRENLVKGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNY 957
            R+R + + +E E +QKKTFTKW+N++LS+     +I +LY+DL DG  L++LL++L+ ++L    +  M R+HCL N+   + FLK+   + L N+ + DIVDG   +ILGL+W IIL FQI  +++     Q D   TR       + ++ALL W          ++I +F +SWKDG AFNA+IH   P+LVD++ ++R N   NL+ AF +AE+ L + KLL+PEDV  + PDEKSI+TY+  F H +
Sbjct:   42 RSRIKALADEREAVQKKTFTKWVNSILSRVGC--RISDLYLDLRDGRMLIKLLEVLSGERLPKPTKGRM-RIHCLENVDKALQFLKE-QRVHLENMGSHDIVDGNHRLILGLIWTIILRFQI--QDIIVETGQADQKETR-------SAKDALLLWCQMKTAGYPNVNITNFTTSWKDGMAFNALIHKHRPDLVDYERLRRSNPTHNLQNAFNVAEQKLGVTKLLDPEDVFTENPDEKSIITYVVAFYHYF 279          
BLAST of nesprin-1-like vs. Planmine SMEST
Match: SMESG000023320.1 (SMESG000023320.1)

HSP 1 Score: 9030.22 bits (23431), Expect = 0.000e+0
Identity = 4823/4911 (98.21%), Postives = 4858/4911 (98.92%), Query Frame = 1
Query: 4309 LEKGNYHKSNQINEEFKGFLENINTRINRIKETLNLNVDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIFEKVNQIVEKIMKDSKDSEDIVHTLQKNIQIYHENFNKILERQQNLGERTKLLLENVKGFKSFNFTVVQWESLNRKNILNPFQNELKILQTEIHEKLEREVLNLHPPNQAVLFNFDSLISDLKFIGNLXXXXXXXXXXGSNFLSKNRDIQIGFAQSIKSISDHFSECRLDRMSTFEKQIFNFENIKDGIIEALQFNENQQMKIDQENITFNPSTLNQMKSEIINNANHLQRNLDECIELIDSRQTQRHSMDNILDQLLQQVKEIENFETFVKDLKIIFGESSIIENQLIQIKNDLNSINKPXXXXXXXXXXXXXXXXXXENLVQSKNQVKDLQTKLESIERQVNENFDFNKWSESVYRFFSEIITELENNNKNFLQISESNIRNSKQNLVHLNKKIDELKKFLKSRKTFLKLHDKNTEEIVDLFEKLGNLEKEVKNLSERMAKEEKLFDKANRNWKEFEQKKKALEAAIDKNVLKINSMTVKYLTVPGLQFLDKELEGIEHSTIELNSELDCLQATIERLYEGKTVKCQQPENCLDSILRNYKDLSMILSEKRNSFNFLSHNVSEIESCWLRISNLIKNSKDAFKPKTPFSSLYEMEMFFENSKQNFQNTKELLDKNLNSLEEGLDNLKQITYCDMKAFNSISTNQNRVKGEVESFSCLMNQFMEKFFIELKRFQDLNEKVIKLTNETNSLYENLHTISNGRSFSETTQSSIDDEEERLNSLQNYQLTIKDLLKESFQFCSIKPFQDQLNVSINTSKDCQNIIQLLXXXXXXXXXXXXNISTNVQLLSMXXXXXXXXXXXXXXYHWNDDCSQLGEVKNYEENLQLISNDLENYQKLSKNLFLQCEDKELENLISKITDLMEKATGVGANVDLVKRDINRRISQNFNLAKDEHERWISSTVSKINASKSPSQFPKDIASDLQTVNELISSLDTGEKLVEETIIQSRAYRQLDSGNTTIGVEREDADKRSLRERFQSIVSEIFLQKSDLEVALNEVNKQQDSLHSIGTAVDNNRKRFSAVTKPAVSDVESKHVNLKFMETIQLANNDDIERLTRIKSETKDISVKNNANELERVLKEFDFDIQDKTSRLLKDIKLHESLLFDLRLIEGETRAKTDQIHAIKSTLLVDSIYIMNLKQKFQELENFTENILSRQNTCVKNCESISIEGVFPNDIVEHIKAVQINIQHLNKQMSVIEQECQSCEKNFDEWNKIYTESKDLMNQIECSIEEESRASENLIEKEQKYNLALSNKDRLESYKINILNLESIANHLKGNQYRVQIDEIKNRYKQAIKHNSNNISLLNKYYQRHRNYISKITDINNSFSFFAIDNCEEIHXXXXXXXXXXXXXXXXXXIEINSEIKKLKSEKDILAKETTERGKEILDKEFLELNDKLMKLNSNCDGEIERINSQSISLDNAKKLLKQIKNWLIERKRLLNPFAAWNVDDGISARKLNEIQTLMLEFDPKLNQLLEIDNVCNFSFIEANELIFNKNELQIEFSEMKRTMEKLFADGKEIQQLTCQCKEQLKSLKESQENIKSKLNRSEIISKLENEMEYFLNLSRTVDEFDESINRPREILRTLSQFELASEIFKGLSMDLEKIETNHRFHRDQIKSKMESLNEKQKIGELFKAQMKVVSKSMDTVLLMCNSIGEKETPTGXXXXXXXXXXXXXXXXPDIDGLKSLAVDSGYSTYLDSANNMVQQYDRLLQNIRKDESVCQDQQEICDRYVHSLDQIVAEMDANSFIISDLCSKGFNDIENVSKSKLKAEEIRKLISKNQDQLLRLNQSFEKKNNPFLATLNKDESSQSLSVKMNKNHQMLNEYIDKCNEELDLVSQYTKKSXXXXXXXXXXXXXXXXXXRSGDFSETNLNKIKDLKSSAIVSESLLEELKNISDSSNLLKRRSNLKVDHNKCDSRLIEIKDQSSRLYSKLTRQIAAMESLEKLNQNFSEKVQELHERINKSNGKILNTGLVNTLGKTHQDLSSIQDKLGEILKNDIDKHNDRYLELTGSHRNRTKQIQMLEKDLFECQRKLNHQIESMSKFNSHKTLIEDSIKNLEIKFQSLTNPDDFVFLQTNETCLRTLLFHCEEIELKLNDLRNESLDNKISNYSTNLLDFSHQFNTKLDLIKNEIQVELKSYKMAIDELKEHQYIIQSVKQFLHQSQQKLTNISISSDNIHQLEHELQKIQDLHDSFNKNYFLIVDCSKLDTSKLRCLSDKAIETFQQEIDQINHFFQQLKESIENTXXXXXXXXXXXXXXXXREDRFKLWLKKEERTLKINDHIFSEHEIDGEIQRLHGILTELVTKQNEVSFVSSTSEGIPEIINPDIKELCENFSDNAKKRIVLLEKLSKDFDVFNKLLKTWTNWYENIAVKRKQMLSMPDSSGRDFVKYLLNEKTHYFDLILSIASNGESFLPYLTAEGRDVVKSTMKRMKEQWHEIFDDLLTLLERFEEKIKKLESFNENYENCRKQFETINLSLIQEIETREPVKLNFPIGIENKERQLQRLCEFKQNLNALNNSIQRLEYILESDIDGILTAEVNALVIEFHLSKEIVDKAKEMSLKSYQNHQTFEASYLQVQDYVAMMNKNVSICKTLDGTTNSIEARMERIQTVLMKELMDMEHQANHVINQLTRSFNSVLSTSCVVEQKIFRERFETIIKEKKMSDDLLKSTRTILEMAYKNLEKFKTKFGSLSSEVSNLTKEIQSIDDCEILVIEKLTDATKSLSKSYKDLHDEALEIFQATKNQYPLEMCKSIENQLEKCSRMLEKNRWKLDQLSVLRNQFDVEEKDFSDILNSSLSKFSSTQYQFDLCGDLKDFSIVATNLSEIEVQIRDSESSIESLKLLFHEIGRQFPNYSKKIVNNFSSLKQNYEKFLRDFNGFKTHFQSIFGASNEINERLAEFKSEFDLIDLSQFHFVPDEKVKKFKNVNDLNTLKMHLISIIGEINEVDIRSISHXXXXXXXXXXXXXXLKSFEELMFDADCRLKTVNDVLINQEQLENFIVSSKESLNSIEYSKDRIVVDFSVDKTHFDEKMKEIDANLSSLQVIKRSIEENLSNKVPGCLSEIGXXXXXXXXXXXXXVDLVEFKKRLSSDFEYFMALEDRIGNTRKRMNDQNEEILDLNENGMSIEDKRSRLDKAFXXXXXXXXXXXXXXXXXXXXSTKTSDPIFNETLIRTIKGLETQNKEQLEKTEKIIKHQSLSVEVEEKFESLYQDLIKELRKVKCLFSNFDSNXXXXXXXXXXXXXXXSILILNDLGRESKLYSSASWKENIAKKLGHIDENWKKLESTQIQLTKKIEQINLKIVESKTQRKNLIESLESLKENSTTFLTDKPFTVVKIQHKIFQLKNIQSQLKEWRKEMNSMKDSKSVDNGNELMKKFRKIQDEIHFEILETKLALEFLLDFDKEIDDFTSWSLTMENRILVVPRFDSSADQIGLRLKDGDSILSQLSDGRNKVLHIKAISENLLSHLSKEGQGFIQETLTRVSDNYQHLQXXXXXXXXXXXXXXXRFEEYESKFKEFLNWLVSYENLYNTKVSSSSLEDKQTSLAQFQSNLQNIFEHKSNLNELIEKGAKFPLNFSIKYNTKDIQIRYPILLKSAQNRIEYLAKSVENHEIYEKDKSTFQTFCQKFNYELKSLKEEKMEIGNLKEIFAKLTAMDIEIRKMEQSRSALEVGFNVVLVETSEIGKKELSSQHLGLLKSFEKFLIDYDEFKSLISKEKKTENNFIKQLEHFSIGLESLIQTMLNLNPSSQIHISSLQNCHEGLEKFSEELKRRSSSFDQLITNYDINKSEIVSDLITTIDTELKSASNSLAEKRAHVNLLLETNQAYQEYFDRLSNWLSNTYSRIQESSDLYGPQSVISQRSDNLNRIQLSIQTEGETLLKAVIERADELNRIILDRTNKEKLSDQVSKCQGEFYNVSNKLENIKTKVNDLETQWKNFDTNIKLLNKVNKVFANRKERFRNMKYSYFLNINAEIEKILDLVKDIEEEKSNLEIFSNQIQSLIDVSQEAQLDTIYQDLIDQIDGHEIDCKSLLDMMRQMGNEKSAFDQQVQNTQLMIDAMKAQLLPIDQLHNIASFNDYQKIFREFQLLESKLIDGDRMVDECFQMFYKLSVLFDSEKALNDMISLLKKNWDGHKEKFDEVKTRMNRLLNLWSNLENLRIPIEEWIQTTEKEMEAITCEGYQSTDANLKAFLRVKARKNESETIKPKLSKFIELFYKADIYPGFSKTKDPLVLQKVFCENLDKLMKLEKSLSTTQLNVEKLLREISDAEKWVIEMCLLITSEQQKIPFANSLLDLKDRAKLCKNLKIQIENFGECTIGLLNKNFQDISRLFIKPSPLKNDIFGKLTSLDQGMKQMASLTDKLKASIKDRSSNIKRFGSIIESVEIFLYRKFPEWWIGKEVVATINPEDCLSQLSDVSAILENVQVLEADFEQVWQDNIRQLHSISPAHSHNDGRDTFFNDSTSYINSEFTSLDDHLDRVKRDLKQTKDCIERRLEDLQGHSHEWNQIESEISELTTVFIHQKMNLKQTFANLTNDDILYERFEKSLIELIEKKDIVDKLDQRIKRLNVYRDHESWKYGKYSLLNEIYSDLLNEMVAVRKSLRAMDVHDLCQEIMAGEDMNDFSQNVSKQDISLMYPQIGTQTNRNKATSIQTIKRFSSNPNLRSFSSGKPSQNERDSSDSGPVFSRTSPCFAQKLVQTVNDIGTQHSRPSKSHKKSINTSNEYEKILTKEQKDRQFKRLNELLETVRQIKEQXXXXXXXXXXXXXXXXXXKSNNSLRNSTESIRHNLLQPKNKRKKSPQKNNQMRSSVESLGKRPSPTGCTTPISFHXXXXXXXXXXXXXXXXXXXXXIAQFAN 19041
            L+K   +KSNQI++EFKGFLENINTRINRIKETLNLNVDKNLIEELSLIEKELKAKLMKSKYSLLDLLKTDDLEEDSIFEKVNQIVEKIMKDSKDSEDI+HTLQKNIQIYHENFNKILE+QQNLGERTKLLLENVKGFKSFNFTVVQWESLNRKNILNPFQNELKILQTEIHEKLEREVLNLHPPNQAVLFNFDSLISDLKFIGNLINEENENIENGSNFLSKNRDIQIGFAQSIKSISDHFSECRLDRMSTFEKQIFN ENIKDGIIEALQFNENQQMKIDQENITFNPSTLNQMKSEIINNANHLQRNLDECIELIDSRQT RHSMDNILDQLLQQVKEIE FETFVKDLKIIFGESS+IENQLIQIKNDLNSINKPKIEK+SKSIDSLLKLTKDENLVQSKNQVKDLQTKLE+IERQVNENFDFNKWSESVYRFFSEIITELENNNKNFLQISESNIRNSKQNLVHLNKKIDELKKFLKSRKTFLKLHDKNTEEIVDLFEKLGNLEKEVKNLSERMAKEEKLFDKANRNWKEFEQKKKALEAAIDKNVLKINSMTVKYLTVPGLQFLDKELEGIEHSTIELNSELDCLQATIERLYEGKTVKCQQPENCLDSILRNYKDLSMILSEKRNSFNFLSHNVSEIESCWLRISNLIKNSKDAFKPKTPFSSLYEMEMFFENSKQNFQNTKELLDKNLNSLEEGLDNLK+ITYCDMKAFNSISTNQNRVKGEVE+FSCLMNQFMEKFFIELKRFQDLNEKVIKLTNETNSLYENLHTI N RSFSETTQSSIDDEEERLNS+QNYQLTIKDLLKESFQFCSIKPFQDQLNVSINTSKDCQNIIQLLKEKRKKIEKEKENISTNVQLLSMNLNKISNNLQNNSLYHWNDDCSQLGEVKNYEENL LISNDLENYQKLSKNLFLQCEDKELENLISKITDLMEKATGV ANVDLVKRDINRRISQNFNLAKDEHERWISSTVSKINASKSPSQFPKDIASDLQTVNELISSLDTGEKLVEETIIQSRAYRQL+SGNTTIGVEREDADKRSLRERFQSIVSEIFLQKSDLE ALNEVNKQQDSLHSIGTAVDNNRKRFSAVTKPAVSDVESKHVNLKFMETIQLANNDDIERLTRIKSETKDISVKNNANELERVLKEFDFDIQDKTSRLLKDIKLHESLLFDLRLIEGETRAKTDQIHAIKSTLLVDSIYIMNLKQKFQELENFTENILSRQNTCVKNCESISIEGVFPNDIVEHIKAVQINIQHLNKQMSVIEQECQSCEKNFDEWNKIYTESKDLMNQIEC+IEEESRASENLIEKEQKYNLALSNKDRLESYKINILNLESIANHLKGNQYRVQIDEIKNRYKQAIKHNSNNISLLNKYYQRHRNYISKITDINNSFSFFAIDNCEEIHSKSLKNSMKKLKTLKAKLI+INSEIKKLKSEKDILAKETTERGKEILDKEFLELNDKLMKLNSNCDGEIERINSQSISLDNA KLLKQIKNWLIERKRLLNPFAAWNVDDGISARKLNEIQTLMLEFDPKLNQLLEIDNVCNFSFIEANELIFNKNELQIEFSEMKRTMEKLFADGKEIQQLTCQCKEQLKSLKESQENIKSKLNRSE+ISKLENEMEYFLNLSRTVDEFDESINRPREILRTLSQFELASEIFKGLSMDLEKIETNHRFHRDQIKSKMESLNEKQKI ELFKAQMKVVSKSMDTVLLMCNSIGEKETPTGKLEKLEEILNKILDIKPDIDGLKSLAVDSGYSTYLDSANNMVQQYDRLLQNIRKDESVCQDQQEICDRYVHSLDQIVAEMDANSFIISDLCSKGFNDIENVSKSKLK EEIRKLISKNQDQLLRLNQSFEKKNNPFLATLNKDESSQSLSVKMNKNHQMLNEYIDKCNEELDLVSQYTKKSEELETLINFINLNLINIERSGDFSETNLNKIKDLKSSAIVSESLLEELKNISDSSNLLKRRSNLKVDHNKCD RLIEIKDQSSRLYSKLTRQIAAMESLEKLNQNFSEKV+ELHERINKSNGKILNTGLVNTLGKTHQDLSSIQDKLGEILKNDIDKHNDRYLELTGSHRNRTKQIQMLEKDLFECQRKLNHQIESMSKFNSHKTLIEDSIKNLEIKFQSLT PDDFVFLQTNETCLRTLLFHCEEIELKLNDLRNESLDNKISNYSTNLLDFSHQFNTKLDLIKNEIQVELKSYKMAIDELKEHQYIIQSVKQFLHQSQQKLTNISISSDNIHQLEHELQKIQDLHDSFNKNYFLIVDCSKLDTSKLRCLSDKAIETFQQEIDQINHFFQQLKESIENTKDILVKKLKDIKEKVKREDRFKLWLKKEERTLKINDHIFSEHEIDGEIQRLHGILTELVTKQNEVSFVSST EGIPEIINPDIKELCENFSDNAKKRIVLLEKLSKDFDVFNKLLKTWTNWYENIAVKRKQMLSMPDSSGRDFVKYLLNEKTHYFDLILSIASNGESFLPYLTAEGRDVVKSTMKRMKEQWHEIFDDLLTLLERFEEKIKKLESFNENYENCRKQFETINLSLIQEIETREPVKLNFPIGIENKERQLQRLCEFKQNLNALNNSIQRLEYILESDIDGILTAEVNALVIEFHLSKEIVDKAKEMSLKSYQNHQTFEASYLQVQDYVAMMNKNVSICKTLDGTTNSIEARMERIQ VLMKELMDMEHQANHVINQLTRSFNSVLSTSCVVEQKIFR RFETIIKEKKMSDDLLKSTRTILEMAYKNLEKFKTKFGSLSSEVSNLT+EIQSI DCEILVIEKLTDATKSLSKSYKDLHDEALEIFQATKNQYPLEMCKSIENQLEKCSRMLEKNRWKLDQLSVLRNQFDVEEKDFSDILNSSLSKFSSTQYQFDLCGDLKDFSIVATNLSEIEVQIRDSESSIESLKLLFHEIGRQFPNYSKKI+NNFSSLKQNYEKFLRDFNGFKTHFQSIFGASNEINERLAEFKSEFDLIDLSQFH VPDEKVKKFKNVNDLNTLKMHLISIIGEINEVDIRSISHQKIKEKFEKIKTTQLKSFEELMFDADCRLKTVND LINQEQLENFIVSSKESLNSIEYSKDRIVVDFSVDKTHFDEKMKEIDANLS LQVIKRSIEENLSNKVPGCLSEIGELKTLEKEREKLKVDLVEFKKRLSSDFEYFM LEDRIGNTRKRMNDQNEEILDLNENGMSIEDKRSRLDKAFSLKKKISEIAIEIDDIKEILSTKTSDPIFNETLIRTIKGLETQNKEQLEKTEKIIKHQSLSVEVEEKFESLYQDLIKELRKVKCLFSNFDSNQTDPFDLPTLDDLQDSILILNDLGRESKLYSSASWKENIAKKLGHIDENWKKLESTQIQLTKKIEQINLKIVESKTQRKNLIESLESLKENSTTFLTDKPFTVVKI+ KIFQLKNIQSQLKEWRKEM+SMKDSKSVDNGN+L+KKFRKIQDEIHFEILETKLALEFLLDFDKEIDDFTSWSLTMENRILVVPRFDSSADQIG RLKDGDSILS+LSDGRNKVLHIKAISENLLSHLSKEGQ FIQE LTRVSDNYQHLQETLK+KLKTLELEKTRFEEYESKFKEFLNWLVSYENLYNTKVSSSSLEDKQTSLAQFQSNLQNIFEHKS+LNELIEKGAKFPLNFSIKYNTKDIQIRYPILLKSAQNRIEYLAKSVENHEIYEKDKSTFQT CQKFNYELKSLK+EKMEIGNLKEIFAKLTAMDIEIRKMEQSRSALEVGFNVVLVETSEIGKKELSSQHLGLLKSFEKFLIDYDEFKSLISKEKKTENNFIKQLEHFSIGLESLIQTMLNLNPSSQIHISSLQNCHEGLEKFSEE+KRRSSSFDQLITNYDINKSEIVSDLITTIDTELKSASNSLAEKRAHVNLLLETNQAYQE FDRLSNWLSNTYSRIQESSDLYGPQSVISQRSDNLN IQLSIQTEGETLLKAVIERADELNRIILDRTNKEKLSDQVSKCQGEFYN+SNKLENIKTKVNDLETQWKNFDTNIKLLNKVNKVFANRKERFRNMKYSYFLNINAEIEKILDL+KDIEEEKSNLEIFSNQIQSLIDVSQEAQLDTIYQDLIDQIDGHEIDCKSLLDMMRQMGNEKSAFDQQVQNTQLMIDAMKAQLLPIDQLHNIASFNDYQKIFREFQLLESKLIDGDRMVDECFQMFYKLSVLFDSEKALNDMISLLKKNWDGHKEKF EVKTRMNRLLNLWSNLENLRIPIEEWIQTTEKEMEAITCEGYQSTDANLKAFLRVKARKNESETIKPKLSKFIELFYKADIYPGFSKTKDPLVLQKVFCENLDKLMKLEKSLSTTQLNVEKLLREISDAEKWVIEMCLLITSEQQKIPFANSLLDLKDRAKLCKNLKIQIENFGECTIGLLNKNFQDISRLFIKPSPLKNDIFGKLTSLDQGMKQMASLTDKLKASIKDRSSNIKRFG+IIESVEIFLYRKFPEWWIGKEVVATINPEDCLSQLSDVS ILENVQVLEADFEQVWQDNI QL SISPAHSHN+               EFTSLDDHLDRVKRDLKQTKDCIERRLEDLQGHSHEWNQIESEISELTTVFIHQKMNLKQTFANLTND ILYERFEKSLIELIEKKDIVDKLDQRIKRLNVYRDHESWKYGKYS LNEIYSDLLNEMVAVR SLRAMDVHDLCQ+IMAGEDMNDFSQNVSKQDISLMYPQIGTQTNRNKATSIQTIKRFSSNPNLRSFSSGKPSQNERDSSDSGPVFSRTSPCFAQKLVQTVNDIGTQHSRPSKSHKKSINTSNEYEKILTKEQKDRQFKRLNELLETVRQIKE+ISLSNSSMSIRSNRSQQMKSNNSLRNSTESIRHNLLQPKNKRKKSP+KNNQMRSSVESLGKRPSPTGCTTPISFHRESPRKMRSSPRKSPAKRNSKIAQFAN
Sbjct: 1390 LKKEIINKSNQIDDEFKGFLENINTRINRIKETLNLNVDKNLIEELSLIEKELKAKLMKSKYSLLDLLKTDDLEEDSIFEKVNQIVEKIMKDSKDSEDIIHTLQKNIQIYHENFNKILEKQQNLGERTKLLLENVKGFKSFNFTVVQWESLNRKNILNPFQNELKILQTEIHEKLEREVLNLHPPNQAVLFNFDSLISDLKFIGNLINEENENIENGSNFLSKNRDIQIGFAQSIKSISDHFSECRLDRMSTFEKQIFNLENIKDGIIEALQFNENQQMKIDQENITFNPSTLNQMKSEIINNANHLQRNLDECIELIDSRQTHRHSMDNILDQLLQQVKEIEKFETFVKDLKIIFGESSVIENQLIQIKNDLNSINKPKIEKISKSIDSLLKLTKDENLVQSKNQVKDLQTKLENIERQVNENFDFNKWSESVYRFFSEIITELENNNKNFLQISESNIRNSKQNLVHLNKKIDELKKFLKSRKTFLKLHDKNTEEIVDLFEKLGNLEKEVKNLSERMAKEEKLFDKANRNWKEFEQKKKALEAAIDKNVLKINSMTVKYLTVPGLQFLDKELEGIEHSTIELNSELDCLQATIERLYEGKTVKCQQPENCLDSILRNYKDLSMILSEKRNSFNFLSHNVSEIESCWLRISNLIKNSKDAFKPKTPFSSLYEMEMFFENSKQNFQNTKELLDKNLNSLEEGLDNLKKITYCDMKAFNSISTNQNRVKGEVETFSCLMNQFMEKFFIELKRFQDLNEKVIKLTNETNSLYENLHTIFNDRSFSETTQSSIDDEEERLNSIQNYQLTIKDLLKESFQFCSIKPFQDQLNVSINTSKDCQNIIQLLKEKRKKIEKEKENISTNVQLLSMNLNKISNNLQNNSLYHWNDDCSQLGEVKNYEENLHLISNDLENYQKLSKNLFLQCEDKELENLISKITDLMEKATGVRANVDLVKRDINRRISQNFNLAKDEHERWISSTVSKINASKSPSQFPKDIASDLQTVNELISSLDTGEKLVEETIIQSRAYRQLESGNTTIGVEREDADKRSLRERFQSIVSEIFLQKSDLEAALNEVNKQQDSLHSIGTAVDNNRKRFSAVTKPAVSDVESKHVNLKFMETIQLANNDDIERLTRIKSETKDISVKNNANELERVLKEFDFDIQDKTSRLLKDIKLHESLLFDLRLIEGETRAKTDQIHAIKSTLLVDSIYIMNLKQKFQELENFTENILSRQNTCVKNCESISIEGVFPNDIVEHIKAVQINIQHLNKQMSVIEQECQSCEKNFDEWNKIYTESKDLMNQIECAIEEESRASENLIEKEQKYNLALSNKDRLESYKINILNLESIANHLKGNQYRVQIDEIKNRYKQAIKHNSNNISLLNKYYQRHRNYISKITDINNSFSFFAIDNCEEIHSKSLKNSMKKLKTLKAKLIDINSEIKKLKSEKDILAKETTERGKEILDKEFLELNDKLMKLNSNCDGEIERINSQSISLDNATKLLKQIKNWLIERKRLLNPFAAWNVDDGISARKLNEIQTLMLEFDPKLNQLLEIDNVCNFSFIEANELIFNKNELQIEFSEMKRTMEKLFADGKEIQQLTCQCKEQLKSLKESQENIKSKLNRSEMISKLENEMEYFLNLSRTVDEFDESINRPREILRTLSQFELASEIFKGLSMDLEKIETNHRFHRDQIKSKMESLNEKQKIVELFKAQMKVVSKSMDTVLLMCNSIGEKETPTGKLEKLEEILNKILDIKPDIDGLKSLAVDSGYSTYLDSANNMVQQYDRLLQNIRKDESVCQDQQEICDRYVHSLDQIVAEMDANSFIISDLCSKGFNDIENVSKSKLKVEEIRKLISKNQDQLLRLNQSFEKKNNPFLATLNKDESSQSLSVKMNKNHQMLNEYIDKCNEELDLVSQYTKKSEELETLINFINLNLINIERSGDFSETNLNKIKDLKSSAIVSESLLEELKNISDSSNLLKRRSNLKVDHNKCDRRLIEIKDQSSRLYSKLTRQIAAMESLEKLNQNFSEKVKELHERINKSNGKILNTGLVNTLGKTHQDLSSIQDKLGEILKNDIDKHNDRYLELTGSHRNRTKQIQMLEKDLFECQRKLNHQIESMSKFNSHKTLIEDSIKNLEIKFQSLTKPDDFVFLQTNETCLRTLLFHCEEIELKLNDLRNESLDNKISNYSTNLLDFSHQFNTKLDLIKNEIQVELKSYKMAIDELKEHQYIIQSVKQFLHQSQQKLTNISISSDNIHQLEHELQKIQDLHDSFNKNYFLIVDCSKLDTSKLRCLSDKAIETFQQEIDQINHFFQQLKESIENTKDILVKKLKDIKEKVKREDRFKLWLKKEERTLKINDHIFSEHEIDGEIQRLHGILTELVTKQNEVSFVSSTPEGIPEIINPDIKELCENFSDNAKKRIVLLEKLSKDFDVFNKLLKTWTNWYENIAVKRKQMLSMPDSSGRDFVKYLLNEKTHYFDLILSIASNGESFLPYLTAEGRDVVKSTMKRMKEQWHEIFDDLLTLLERFEEKIKKLESFNENYENCRKQFETINLSLIQEIETREPVKLNFPIGIENKERQLQRLCEFKQNLNALNNSIQRLEYILESDIDGILTAEVNALVIEFHLSKEIVDKAKEMSLKSYQNHQTFEASYLQVQDYVAMMNKNVSICKTLDGTTNSIEARMERIQAVLMKELMDMEHQANHVINQLTRSFNSVLSTSCVVEQKIFRARFETIIKEKKMSDDLLKSTRTILEMAYKNLEKFKTKFGSLSSEVSNLTEEIQSIGDCEILVIEKLTDATKSLSKSYKDLHDEALEIFQATKNQYPLEMCKSIENQLEKCSRMLEKNRWKLDQLSVLRNQFDVEEKDFSDILNSSLSKFSSTQYQFDLCGDLKDFSIVATNLSEIEVQIRDSESSIESLKLLFHEIGRQFPNYSKKIINNFSSLKQNYEKFLRDFNGFKTHFQSIFGASNEINERLAEFKSEFDLIDLSQFHNVPDEKVKKFKNVNDLNTLKMHLISIIGEINEVDIRSISHQKIKEKFEKIKTTQLKSFEELMFDADCRLKTVNDALINQEQLENFIVSSKESLNSIEYSKDRIVVDFSVDKTHFDEKMKEIDANLSFLQVIKRSIEENLSNKVPGCLSEIGELKTLEKEREKLKVDLVEFKKRLSSDFEYFMTLEDRIGNTRKRMNDQNEEILDLNENGMSIEDKRSRLDKAFSLKKKISEIAIEIDDIKEILSTKTSDPIFNETLIRTIKGLETQNKEQLEKTEKIIKHQSLSVEVEEKFESLYQDLIKELRKVKCLFSNFDSNQTDPFDLPTLDDLQDSILILNDLGRESKLYSSASWKENIAKKLGHIDENWKKLESTQIQLTKKIEQINLKIVESKTQRKNLIESLESLKENSTTFLTDKPFTVVKIRRKIFQLKNIQSQLKEWRKEMDSMKDSKSVDNGNQLVKKFRKIQDEIHFEILETKLALEFLLDFDKEIDDFTSWSLTMENRILVVPRFDSSADQIGSRLKDGDSILSELSDGRNKVLHIKAISENLLSHLSKEGQVFIQENLTRVSDNYQHLQETLKEKLKTLELEKTRFEEYESKFKEFLNWLVSYENLYNTKVSSSSLEDKQTSLAQFQSNLQNIFEHKSDLNELIEKGAKFPLNFSIKYNTKDIQIRYPILLKSAQNRIEYLAKSVENHEIYEKDKSTFQTLCQKFNYELKSLKDEKMEIGNLKEIFAKLTAMDIEIRKMEQSRSALEVGFNVVLVETSEIGKKELSSQHLGLLKSFEKFLIDYDEFKSLISKEKKTENNFIKQLEHFSIGLESLIQTMLNLNPSSQIHISSLQNCHEGLEKFSEEIKRRSSSFDQLITNYDINKSEIVSDLITTIDTELKSASNSLAEKRAHVNLLLETNQAYQESFDRLSNWLSNTYSRIQESSDLYGPQSVISQRSDNLNHIQLSIQTEGETLLKAVIERADELNRIILDRTNKEKLSDQVSKCQGEFYNISNKLENIKTKVNDLETQWKNFDTNIKLLNKVNKVFANRKERFRNMKYSYFLNINAEIEKILDLIKDIEEEKSNLEIFSNQIQSLIDVSQEAQLDTIYQDLIDQIDGHEIDCKSLLDMMRQMGNEKSAFDQQVQNTQLMIDAMKAQLLPIDQLHNIASFNDYQKIFREFQLLESKLIDGDRMVDECFQMFYKLSVLFDSEKALNDMISLLKKNWDGHKEKFYEVKTRMNRLLNLWSNLENLRIPIEEWIQTTEKEMEAITCEGYQSTDANLKAFLRVKARKNESETIKPKLSKFIELFYKADIYPGFSKTKDPLVLQKVFCENLDKLMKLEKSLSTTQLNVEKLLREISDAEKWVIEMCLLITSEQQKIPFANSLLDLKDRAKLCKNLKIQIENFGECTIGLLNKNFQDISRLFIKPSPLKNDIFGKLTSLDQGMKQMASLTDKLKASIKDRSSNIKRFGNIIESVEIFLYRKFPEWWIGKEVVATINPEDCLSQLSDVSGILENVQVLEADFEQVWQDNIHQLQSISPAHSHNE---------------EFTSLDDHLDRVKRDLKQTKDCIERRLEDLQGHSHEWNQIESEISELTTVFIHQKMNLKQTFANLTNDVILYERFEKSLIELIEKKDIVDKLDQRIKRLNVYRDHESWKYGKYSRLNEIYSDLLNEMVAVRNSLRAMDVHDLCQKIMAGEDMNDFSQNVSKQDISLMYPQIGTQTNRNKATSIQTIKRFSSNPNLRSFSSGKPSQNERDSSDSGPVFSRTSPCFAQKLVQTVNDIGTQHSRPSKSHKKSINTSNEYEKILTKEQKDRQFKRLNELLETVRQIKEEISLSNSSMSIRSNRSQQMKSNNSLRNSTESIRHNLLQPKNKRKKSPEKNNQMRSSVESLGKRPSPTGCTTPISFHRESPRKMRSSPRKSPAKRNSKIAQFAN 6285          

HSP 2 Score: 1634.39 bits (4231), Expect = 0.000e+0
Identity = 885/914 (96.83%), Postives = 896/914 (98.03%), Query Frame = 2
Query: 1586 NKFSVNRFQIFQNPPSRVPRIYVDSIKSRINIISDKCPELSAYFELFGLFRAATDKHLELQNKIKFLKSGFESFQILVDKYEELKSLVHGEDTESLKVHLKQISESSSKIVKGFISKDISRQMILNQTNQKINDVVKSTLKEIEDILSNQNSLLNKWKKYNEKKDDLIKWISQAKSALKLDKSKRDEFFAANFKLNYQSFVEEKNHFSSSDPDCIRFIENEFEMINESWNSIVKEIELKRQFENIFTLKKEYNERIERIENWMSKSETIADRKTTCERAELEENLDILEAAAKNFETVKIDLQKAAKIGESMFKSNLMESDTEEILGKLQIHKDRFVIVRDXXXXXXXXXXXXXXVMTVFRRNSAELNKWLESAENNLLCNFETGNDEDFHDWISEHEKCFEGNYHLVLDGKINENAKILQRILEQVEEDVDTKLIEDEMENLTERVQICFKNSLGIRNQKEFEHFRDKLKKLLNETRDQIMEEETQLNLNKDFSQVLFMHENYFDNGKIQTKCNELLNSLKLVNIHLINGGKGSLPVDYHNERNNMEYEVDLVFERVATIHSSLLTIPHMLKEFDNLLSNLVDWMSKVEDLSSQLEIYDPMSHHDSTDCNNSIDIENNITFEEYDKTLTEFQRLYDFTETHLKDGEHLTKLLSDIQKASPYLSLEDEKLNLDIALSKCNEIEPKISNTQKIAPIIAESIAFKAKQMKVKKRLLQIKMDLXXXXXXXXXXXXXXXXXXQILQQTFAVETPNIIREIEKEQKIVADFETINLKPVLSKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXIESNSNNLQADIANFEGELKLLKEEIPAQFDFDGSVEKLKGFLENFEDKIDNKVFHYESSVNEAHKTLHLGKDIELDKERVKLKSIINSIKESASKEINNLHLKKEII 4327
            +KFSVNRFQIFQNPPSRVPRIYVDSIKSRINIISDKCPELSAYFELFGLFRAATDKHLELQNKIKFLKSGFESFQILVDKYEELKSLVHGEDTESLKVHLKQISESSSKIVKGFISKDISRQMILNQTNQK+NDVVKSTLKEIEDILSNQNSLLNKWKKYNEKKDDLIKWISQAK+ALKLDKSKRDEFFAANFKLNYQSFVEEKNHFSSSDPDCIRFIENEFEMINESWNSIVKEIELKRQFENIFTLKKEYNERIERIENWMSKSETIADRKTTCERAELEENLDILEAAAKNFETVKIDLQKAAKIGESMFKSNLMESDTEEILGKLQIHKDRFVIVRDKINKKLKILKKLILVMTVFRRNSAELNKWLESAENNLLCNFETGNDEDFH W+SEHEKCFEGNYHLVLDGKINENAKILQRILE+VEEDVDTKLIEDEMENLTERVQ             EFEHFRDKLK LLNETRDQIMEEETQLNLNKDFSQVLFMHENYFDNGKIQTKCNELLNSLKLVNIHLINGGKGSLPVDYHNERNNMEYEVDLVFERVATIHSSLLTIPHMLKEFDNLLSNLVDW SKVEDLS QLEIYDPMSHHDSTDCNNSIDIENNITFEEYDKTLTEFQRLYDFTETHLKDGEHLTKLLSDIQKASPYLSLEDEKLNLD+ALSKCNEIEPKISNTQKIAPIIAESIAFKAKQMKVKKRLLQIKMDLEKIEEEEICEIENIYEKE++LQ+TFAVETPNIIR+IEKEQKIVAD ETIN+KPVLSKVLEEEWKMLNELKEEKLEKLKEAKEMLVEIESNSNNLQADIANFEGELKLLKEEIPAQFDFDGSVEKLKGFLENFEDKIDNKVFHYESSVNEAHKTLHLGKDIELDKERVKLKSIINSIKESASKEINNLHLKKEII
Sbjct:  495 DKFSVNRFQIFQNPPSRVPRIYVDSIKSRINIISDKCPELSAYFELFGLFRAATDKHLELQNKIKFLKSGFESFQILVDKYEELKSLVHGEDTESLKVHLKQISESSSKIVKGFISKDISRQMILNQTNQKVNDVVKSTLKEIEDILSNQNSLLNKWKKYNEKKDDLIKWISQAKTALKLDKSKRDEFFAANFKLNYQSFVEEKNHFSSSDPDCIRFIENEFEMINESWNSIVKEIELKRQFENIFTLKKEYNERIERIENWMSKSETIADRKTTCERAELEENLDILEAAAKNFETVKIDLQKAAKIGESMFKSNLMESDTEEILGKLQIHKDRFVIVRDKINKKLKILKKLILVMTVFRRNSAELNKWLESAENNLLCNFETGNDEDFHYWMSEHEKCFEGNYHLVLDGKINENAKILQRILEKVEEDVDTKLIEDEMENLTERVQ-------------EFEHFRDKLKNLLNETRDQIMEEETQLNLNKDFSQVLFMHENYFDNGKIQTKCNELLNSLKLVNIHLINGGKGSLPVDYHNERNNMEYEVDLVFERVATIHSSLLTIPHMLKEFDNLLSNLVDWTSKVEDLSLQLEIYDPMSHHDSTDCNNSIDIENNITFEEYDKTLTEFQRLYDFTETHLKDGEHLTKLLSDIQKASPYLSLEDEKLNLDMALSKCNEIEPKISNTQKIAPIIAESIAFKAKQMKVKKRLLQIKMDLEKIEEEEICEIENIYEKEKMLQKTFAVETPNIIRDIEKEQKIVADLETINVKPVLSKVLEEEWKMLNELKEEKLEKLKEAKEMLVEIESNSNNLQADIANFEGELKLLKEEIPAQFDFDGSVEKLKGFLENFEDKIDNKVFHYESSVNEAHKTLHLGKDIELDKERVKLKSIINSIKESASKEINNLHLKKEII 1395          

HSP 3 Score: 888.256 bits (2294), Expect = 0.000e+0
Identity = 461/480 (96.04%), Postives = 464/480 (96.67%), Query Frame = 1
Query:  196 MLIRTRGRQIRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIKSENMFKLIAQRDSNPTRRENLVKGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPDQDIHKNSAPKASHNWIDIKTSEETAMDKISQEEIVKQRSSLKKSEFNKYTTPTLQSTMTIKRQNQPKPVVNPSVVRQIXXXXXXXXXXXXAFNDEFQSLRYQIKTILLEIDSDLKDPQKYKIDSVEENMKSIVPVVEKINQLKELQERLENLDSRL----------------DFQERFRNLLNIQWEIESDIDESEPLSNYLNNLRMLEQGLFFVTDLTVTDVE 1587
            MLIRTRGRQIRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLAN+CSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIKSENMFKLIAQRDSNPTRRENLVKGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLEPEDVDVDYPDEKSIMTYLSLFLHNYPDQDIHKNSAPKASHNWIDIKTSEETAMDKISQEEIVKQRSSLKKSEFNKYTTPTLQSTMTIKRQNQPKPVVNPSVVRQIKNDKKSEEEENKAFNDEFQSLRYQIKT+LLEIDSDLKDPQKYKIDSVEENMKSIVPVVEKINQLKELQERLENLDSRL                DF+ERFRNLLNIQWEIESDIDESEPLSNYLNNLRMLEQGLFFVTDLTVTDVE
Sbjct:    1 MLIRTRGRQIRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANICSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIKSENMFKLIAQRDSNPTRRENLVKGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLEPEDVDVDYPDEKSIMTYLSLFLHNYPDQDIHKNSAPKASHNWIDIKTSEETAMDKISQEEIVKQRSSLKKSEFNKYTTPTLQSTMTIKRQNQPKPVVNPSVVRQIKNDKKSEEEENKAFNDEFQSLRYQIKTLLLEIDSDLKDPQKYKIDSVEENMKSIVPVVEKINQLKELQERLENLDSRLGINMEEKSNKTKSLNKDFKERFRNLLNIQWEIESDIDESEPLSNYLNNLRMLEQGLFFVTDLTVTDVE 480          
BLAST of nesprin-1-like vs. Planmine SMEST
Match: SMESG000023320.1 (SMESG000023320.1)

HSP 1 Score: 9019.43 bits (23403), Expect = 0.000e+0
Identity = 4823/4911 (98.21%), Postives = 4858/4911 (98.92%), Query Frame = 1
Query: 4309 LEKGNYHKSNQINEEFKGFLENINTRINRIKETLNLNVDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIFEKVNQIVEKIMKDSKDSEDIVHTLQKNIQIYHENFNKILERQQNLGERTKLLLENVKGFKSFNFTVVQWESLNRKNILNPFQNELKILQTEIHEKLEREVLNLHPPNQAVLFNFDSLISDLKFIGNLXXXXXXXXXXGSNFLSKNRDIQIGFAQSIKSISDHFSECRLDRMSTFEKQIFNFENIKDGIIEALQFNENQQMKIDQENITFNPSTLNQMKSEIINNANHLQRNLDECIELIDSRQTQRHSMDNILDQLLQQVKEIENFETFVKDLKIIFGESSIIENQLIQIKNDLNSINKPXXXXXXXXXXXXXXXXXXENLVQSKNQVKDLQTKLESIERQVNENFDFNKWSESVYRFFSEIITELENNNKNFLQISESNIRNSKQNLVHLNKKIDELKKFLKSRKTFLKLHDKNTEEIVDLFEKLGNLEKEVKNLSERMAKEEKLFDKANRNWKEFEQKKKALEAAIDKNVLKINSMTVKYLTVPGLQFLDKELEGIEHSTIELNSELDCLQATIERLYEGKTVKCQQPENCLDSILRNYKDLSMILSEKRNSFNFLSHNVSEIESCWLRISNLIKNSKDAFKPKTPFSSLYEMEMFFENSKQNFQNTKELLDKNLNSLEEGLDNLKQITYCDMKAFNSISTNQNRVKGEVESFSCLMNQFMEKFFIELKRFQDLNEKVIKLTNETNSLYENLHTISNGRSFSETTQSSIDDEEERLNSLQNYQLTIKDLLKESFQFCSIKPFQDQLNVSINTSKDCQNIIQLLXXXXXXXXXXXXNISTNVQLLSMXXXXXXXXXXXXXXYHWNDDCSQLGEVKNYEENLQLISNDLENYQKLSKNLFLQCEDKELENLISKITDLMEKATGVGANVDLVKRDINRRISQNFNLAKDEHERWISSTVSKINASKSPSQFPKDIASDLQTVNELISSLDTGEKLVEETIIQSRAYRQLDSGNTTIGVEREDADKRSLRERFQSIVSEIFLQKSDLEVALNEVNKQQDSLHSIGTAVDNNRKRFSAVTKPAVSDVESKHVNLKFMETIQLANNDDIERLTRIKSETKDISVKNNANELERVLKEFDFDIQDKTSRLLKDIKLHESLLFDLRLIEGETRAKTDQIHAIKSTLLVDSIYIMNLKQKFQELENFTENILSRQNTCVKNCESISIEGVFPNDIVEHIKAVQINIQHLNKQMSVIEQECQSCEKNFDEWNKIYTESKDLMNQIECSIEEESRASENLIEKEQKYNLALSNKDRLESYKINILNLESIANHLKGNQYRVQIDEIKNRYKQAIKHNSNNISLLNKYYQRHRNYISKITDINNSFSFFAIDNCEEIHXXXXXXXXXXXXXXXXXXIEINSEIKKLKSEKDILAKETTERGKEILDKEFLELNDKLMKLNSNCDGEIERINSQSISLDNAKKLLKQIKNWLIERKRLLNPFAAWNVDDGISARKLNEIQTLMLEFDPKLNQLLEIDNVCNFSFIEANELIFNKNELQIEFSEMKRTMEKLFADGKEIQQLTCQCKEQLKSLKESQENIKSKLNRSEIISKLENEMEYFLNLSRTVDEFDESINRPREILRTLSQFELASEIFKGLSMDLEKIETNHRFHRDQIKSKMESLNEKQKIGELFKAQMKVVSKSMDTVLLMCNSIGEKETPTGXXXXXXXXXXXXXXXXPDIDGLKSLAVDSGYSTYLDSANNMVQQYDRLLQNIRKDESVCQDQQEICDRYVHSLDQIVAEMDANSFIISDLCSKGFNDIENVSKSKLKAEEIRKLISKNQDQLLRLNQSFEKKNNPFLATLNKDESSQSLSVKMNKNHQMLNEYIDKCNEELDLVSQYTKKSXXXXXXXXXXXXXXXXXXRSGDFSETNLNKIKDLKSSAIVSESLLEELKNISDSSNLLKRRSNLKVDHNKCDSRLIEIKDQSSRLYSKLTRQIAAMESLEKLNQNFSEKVQELHERINKSNGKILNTGLVNTLGKTHQDLSSIQDKLGEILKNDIDKHNDRYLELTGSHRNRTKQIQMLEKDLFECQRKLNHQIESMSKFNSHKTLIEDSIKNLEIKFQSLTNPDDFVFLQTNETCLRTLLFHCEEIELKLNDLRNESLDNKISNYSTNLLDFSHQFNTKLDLIKNEIQVELKSYKMAIDELKEHQYIIQSVKQFLHQSQQKLTNISISSDNIHQLEHELQKIQDLHDSFNKNYFLIVDCSKLDTSKLRCLSDKAIETFQQEIDQINHFFQQLKESIENTXXXXXXXXXXXXXXXXREDRFKLWLKKEERTLKINDHIFSEHEIDGEIQRLHGILTELVTKQNEVSFVSSTSEGIPEIINPDIKELCENFSDNAKKRIVLLEKLSKDFDVFNKLLKTWTNWYENIAVKRKQMLSMPDSSGRDFVKYLLNEKTHYFDLILSIASNGESFLPYLTAEGRDVVKSTMKRMKEQWHEIFDDLLTLLERFEEKIKKLESFNENYENCRKQFETINLSLIQEIETREPVKLNFPIGIENKERQLQRLCEFKQNLNALNNSIQRLEYILESDIDGILTAEVNALVIEFHLSKEIVDKAKEMSLKSYQNHQTFEASYLQVQDYVAMMNKNVSICKTLDGTTNSIEARMERIQTVLMKELMDMEHQANHVINQLTRSFNSVLSTSCVVEQKIFRERFETIIKEKKMSDDLLKSTRTILEMAYKNLEKFKTKFGSLSSEVSNLTKEIQSIDDCEILVIEKLTDATKSLSKSYKDLHDEALEIFQATKNQYPLEMCKSIENQLEKCSRMLEKNRWKLDQLSVLRNQFDVEEKDFSDILNSSLSKFSSTQYQFDLCGDLKDFSIVATNLSEIEVQIRDSESSIESLKLLFHEIGRQFPNYSKKIVNNFSSLKQNYEKFLRDFNGFKTHFQSIFGASNEINERLAEFKSEFDLIDLSQFHFVPDEKVKKFKNVNDLNTLKMHLISIIGEINEVDIRSISHXXXXXXXXXXXXXXLKSFEELMFDADCRLKTVNDVLINQEQLENFIVSSKESLNSIEYSKDRIVVDFSVDKTHFDEKMKEIDANLSSLQVIKRSIEENLSNKVPGCLSEIGXXXXXXXXXXXXXVDLVEFKKRLSSDFEYFMALEDRIGNTRKRMNDQNEEILDLNENGMSIEDKRSRLDKAFXXXXXXXXXXXXXXXXXXXXSTKTSDPIFNETLIRTIKGLETQNKEQLEKTEKIIKHQSLSVEVEEKFESLYQDLIKELRKVKCLFSNFDSNXXXXXXXXXXXXXXXSILILNDLGRESKLYSSASWKENIAKKLGHIDENWKKLESTQIQLTKKIEQINLKIVESKTQRKNLIESLESLKENSTTFLTDKPFTVVKIQHKIFQLKNIQSQLKEWRKEMNSMKDSKSVDNGNELMKKFRKIQDEIHFEILETKLALEFLLDFDKEIDDFTSWSLTMENRILVVPRFDSSADQIGLRLKDGDSILSQLSDGRNKVLHIKAISENLLSHLSKEGQGFIQETLTRVSDNYQHLQXXXXXXXXXXXXXXXRFEEYESKFKEFLNWLVSYENLYNTKVSSSSLEDKQTSLAQFQSNLQNIFEHKSNLNELIEKGAKFPLNFSIKYNTKDIQIRYPILLKSAQNRIEYLAKSVENHEIYEKDKSTFQTFCQKFNYELKSLKEEKMEIGNLKEIFAKLTAMDIEIRKMEQSRSALEVGFNVVLVETSEIGKKELSSQHLGLLKSFEKFLIDYDEFKSLISKEKKTENNFIKQLEHFSIGLESLIQTMLNLNPSSQIHISSLQNCHEGLEKFSEELKRRSSSFDQLITNYDINKSEIVSDLITTIDTELKSASNSLAEKRAHVNLLLETNQAYQEYFDRLSNWLSNTYSRIQESSDLYGPQSVISQRSDNLNRIQLSIQTEGETLLKAVIERADELNRIILDRTNKEKLSDQVSKCQGEFYNVSNKLENIKTKVNDLETQWKNFDTNIKLLNKVNKVFANRKERFRNMKYSYFLNINAEIEKILDLVKDIEEEKSNLEIFSNQIQSLIDVSQEAQLDTIYQDLIDQIDGHEIDCKSLLDMMRQMGNEKSAFDQQVQNTQLMIDAMKAQLLPIDQLHNIASFNDYQKIFREFQLLESKLIDGDRMVDECFQMFYKLSVLFDSEKALNDMISLLKKNWDGHKEKFDEVKTRMNRLLNLWSNLENLRIPIEEWIQTTEKEMEAITCEGYQSTDANLKAFLRVKARKNESETIKPKLSKFIELFYKADIYPGFSKTKDPLVLQKVFCENLDKLMKLEKSLSTTQLNVEKLLREISDAEKWVIEMCLLITSEQQKIPFANSLLDLKDRAKLCKNLKIQIENFGECTIGLLNKNFQDISRLFIKPSPLKNDIFGKLTSLDQGMKQMASLTDKLKASIKDRSSNIKRFGSIIESVEIFLYRKFPEWWIGKEVVATINPEDCLSQLSDVSAILENVQVLEADFEQVWQDNIRQLHSISPAHSHNDGRDTFFNDSTSYINSEFTSLDDHLDRVKRDLKQTKDCIERRLEDLQGHSHEWNQIESEISELTTVFIHQKMNLKQTFANLTNDDILYERFEKSLIELIEKKDIVDKLDQRIKRLNVYRDHESWKYGKYSLLNEIYSDLLNEMVAVRKSLRAMDVHDLCQEIMAGEDMNDFSQNVSKQDISLMYPQIGTQTNRNKATSIQTIKRFSSNPNLRSFSSGKPSQNERDSSDSGPVFSRTSPCFAQKLVQTVNDIGTQHSRPSKSHKKSINTSNEYEKILTKEQKDRQFKRLNELLETVRQIKEQXXXXXXXXXXXXXXXXXXKSNNSLRNSTESIRHNLLQPKNKRKKSPQKNNQMRSSVESLGKRPSPTGCTTPISFHXXXXXXXXXXXXXXXXXXXXXIAQFAN 19041
            L+K   +KSNQI++EFKGFLENINTRINRIKETLNLNVDKNLIEELSLIEKELKAKLMKSKYSLLDLLKTDDLEEDSIFEKVNQIVEKIMKDSKDSEDI+HTLQKNIQIYHENFNKILE+QQNLGERTKLLLENVKGFKSFNFTVVQWESLNRKNILNPFQNELKILQTEIHEKLEREVLNLHPPNQAVLFNFDSLISDLKFIGNLINEENENIENGSNFLSKNRDIQIGFAQSIKSISDHFSECRLDRMSTFEKQIFN ENIKDGIIEALQFNENQQMKIDQENITFNPSTLNQMKSEIINNANHLQRNLDECIELIDSRQT RHSMDNILDQLLQQVKEIE FETFVKDLKIIFGESS+IENQLIQIKNDLNSINKPKIEK+SKSIDSLLKLTKDENLVQSKNQVKDLQTKLE+IERQVNENFDFNKWSESVYRFFSEIITELENNNKNFLQISESNIRNSKQNLVHLNKKIDELKKFLKSRKTFLKLHDKNTEEIVDLFEKLGNLEKEVKNLSERMAKEEKLFDKANRNWKEFEQKKKALEAAIDKNVLKINSMTVKYLTVPGLQFLDKELEGIEHSTIELNSELDCLQATIERLYEGKTVKCQQPENCLDSILRNYKDLSMILSEKRNSFNFLSHNVSEIESCWLRISNLIKNSKDAFKPKTPFSSLYEMEMFFENSKQNFQNTKELLDKNLNSLEEGLDNLK+ITYCDMKAFNSISTNQNRVKGEVE+FSCLMNQFMEKFFIELKRFQDLNEKVIKLTNETNSLYENLHTI N RSFSETTQSSIDDEEERLNS+QNYQLTIKDLLKESFQFCSIKPFQDQLNVSINTSKDCQNIIQLLKEKRKKIEKEKENISTNVQLLSMNLNKISNNLQNNSLYHWNDDCSQLGEVKNYEENL LISNDLENYQKLSKNLFLQCEDKELENLISKITDLMEKATGV ANVDLVKRDINRRISQNFNLAKDEHERWISSTVSKINASKSPSQFPKDIASDLQTVNELISSLDTGEKLVEETIIQSRAYRQL+SGNTTIGVEREDADKRSLRERFQSIVSEIFLQKSDLE ALNEVNKQQDSLHSIGTAVDNNRKRFSAVTKPAVSDVESKHVNLKFMETIQLANNDDIERLTRIKSETKDISVKNNANELERVLKEFDFDIQDKTSRLLKDIKLHESLLFDLRLIEGETRAKTDQIHAIKSTLLVDSIYIMNLKQKFQELENFTENILSRQNTCVKNCESISIEGVFPNDIVEHIKAVQINIQHLNKQMSVIEQECQSCEKNFDEWNKIYTESKDLMNQIEC+IEEESRASENLIEKEQKYNLALSNKDRLESYKINILNLESIANHLKGNQYRVQIDEIKNRYKQAIKHNSNNISLLNKYYQRHRNYISKITDINNSFSFFAIDNCEEIHSKSLKNSMKKLKTLKAKLI+INSEIKKLKSEKDILAKETTERGKEILDKEFLELNDKLMKLNSNCDGEIERINSQSISLDNA KLLKQIKNWLIERKRLLNPFAAWNVDDGISARKLNEIQTLMLEFDPKLNQLLEIDNVCNFSFIEANELIFNKNELQIEFSEMKRTMEKLFADGKEIQQLTCQCKEQLKSLKESQENIKSKLNRSE+ISKLENEMEYFLNLSRTVDEFDESINRPREILRTLSQFELASEIFKGLSMDLEKIETNHRFHRDQIKSKMESLNEKQKI ELFKAQMKVVSKSMDTVLLMCNSIGEKETPTGKLEKLEEILNKILDIKPDIDGLKSLAVDSGYSTYLDSANNMVQQYDRLLQNIRKDESVCQDQQEICDRYVHSLDQIVAEMDANSFIISDLCSKGFNDIENVSKSKLK EEIRKLISKNQDQLLRLNQSFEKKNNPFLATLNKDESSQSLSVKMNKNHQMLNEYIDKCNEELDLVSQYTKKSEELETLINFINLNLINIERSGDFSETNLNKIKDLKSSAIVSESLLEELKNISDSSNLLKRRSNLKVDHNKCD RLIEIKDQSSRLYSKLTRQIAAMESLEKLNQNFSEKV+ELHERINKSNGKILNTGLVNTLGKTHQDLSSIQDKLGEILKNDIDKHNDRYLELTGSHRNRTKQIQMLEKDLFECQRKLNHQIESMSKFNSHKTLIEDSIKNLEIKFQSLT PDDFVFLQTNETCLRTLLFHCEEIELKLNDLRNESLDNKISNYSTNLLDFSHQFNTKLDLIKNEIQVELKSYKMAIDELKEHQYIIQSVKQFLHQSQQKLTNISISSDNIHQLEHELQKIQDLHDSFNKNYFLIVDCSKLDTSKLRCLSDKAIETFQQEIDQINHFFQQLKESIENTKDILVKKLKDIKEKVKREDRFKLWLKKEERTLKINDHIFSEHEIDGEIQRLHGILTELVTKQNEVSFVSST EGIPEIINPDIKELCENFSDNAKKRIVLLEKLSKDFDVFNKLLKTWTNWYENIAVKRKQMLSMPDSSGRDFVKYLLNEKTHYFDLILSIASNGESFLPYLTAEGRDVVKSTMKRMKEQWHEIFDDLLTLLERFEEKIKKLESFNENYENCRKQFETINLSLIQEIETREPVKLNFPIGIENKERQLQRLCEFKQNLNALNNSIQRLEYILESDIDGILTAEVNALVIEFHLSKEIVDKAKEMSLKSYQNHQTFEASYLQVQDYVAMMNKNVSICKTLDGTTNSIEARMERIQ VLMKELMDMEHQANHVINQLTRSFNSVLSTSCVVEQKIFR RFETIIKEKKMSDDLLKSTRTILEMAYKNLEKFKTKFGSLSSEVSNLT+EIQSI DCEILVIEKLTDATKSLSKSYKDLHDEALEIFQATKNQYPLEMCKSIENQLEKCSRMLEKNRWKLDQLSVLRNQFDVEEKDFSDILNSSLSKFSSTQYQFDLCGDLKDFSIVATNLSEIEVQIRDSESSIESLKLLFHEIGRQFPNYSKKI+NNFSSLKQNYEKFLRDFNGFKTHFQSIFGASNEINERLAEFKSEFDLIDLSQFH VPDEKVKKFKNVNDLNTLKMHLISIIGEINEVDIRSISHQKIKEKFEKIKTTQLKSFEELMFDADCRLKTVND LINQEQLENFIVSSKESLNSIEYSKDRIVVDFSVDKTHFDEKMKEIDANLS LQVIKRSIEENLSNKVPGCLSEIGELKTLEKEREKLKVDLVEFKKRLSSDFEYFM LEDRIGNTRKRMNDQNEEILDLNENGMSIEDKRSRLDKAFSLKKKISEIAIEIDDIKEILSTKTSDPIFNETLIRTIKGLETQNKEQLEKTEKIIKHQSLSVEVEEKFESLYQDLIKELRKVKCLFSNFDSNQTDPFDLPTLDDLQDSILILNDLGRESKLYSSASWKENIAKKLGHIDENWKKLESTQIQLTKKIEQINLKIVESKTQRKNLIESLESLKENSTTFLTDKPFTVVKI+ KIFQLKNIQSQLKEWRKEM+SMKDSKSVDNGN+L+KKFRKIQDEIHFEILETKLALEFLLDFDKEIDDFTSWSLTMENRILVVPRFDSSADQIG RLKDGDSILS+LSDGRNKVLHIKAISENLLSHLSKEGQ FIQE LTRVSDNYQHLQETLK+KLKTLELEKTRFEEYESKFKEFLNWLVSYENLYNTKVSSSSLEDKQTSLAQFQSNLQNIFEHKS+LNELIEKGAKFPLNFSIKYNTKDIQIRYPILLKSAQNRIEYLAKSVENHEIYEKDKSTFQT CQKFNYELKSLK+EKMEIGNLKEIFAKLTAMDIEIRKMEQSRSALEVGFNVVLVETSEIGKKELSSQHLGLLKSFEKFLIDYDEFKSLISKEKKTENNFIKQLEHFSIGLESLIQTMLNLNPSSQIHISSLQNCHEGLEKFSEE+KRRSSSFDQLITNYDINKSEIVSDLITTIDTELKSASNSLAEKRAHVNLLLETNQAYQE FDRLSNWLSNTYSRIQESSDLYGPQSVISQRSDNLN IQLSIQTEGETLLKAVIERADELNRIILDRTNKEKLSDQVSKCQGEFYN+SNKLENIKTKVNDLETQWKNFDTNIKLLNKVNKVFANRKERFRNMKYSYFLNINAEIEKILDL+KDIEEEKSNLEIFSNQIQSLIDVSQEAQLDTIYQDLIDQIDGHEIDCKSLLDMMRQMGNEKSAFDQQVQNTQLMIDAMKAQLLPIDQLHNIASFNDYQKIFREFQLLESKLIDGDRMVDECFQMFYKLSVLFDSEKALNDMISLLKKNWDGHKEKF EVKTRMNRLLNLWSNLENLRIPIEEWIQTTEKEMEAITCEGYQSTDANLKAFLRVKARKNESETIKPKLSKFIELFYKADIYPGFSKTKDPLVLQKVFCENLDKLMKLEKSLSTTQLNVEKLLREISDAEKWVIEMCLLITSEQQKIPFANSLLDLKDRAKLCKNLKIQIENFGECTIGLLNKNFQDISRLFIKPSPLKNDIFGKLTSLDQGMKQMASLTDKLKASIKDRSSNIKRFG+IIESVEIFLYRKFPEWWIGKEVVATINPEDCLSQLSDVS ILENVQVLEADFEQVWQDNI QL SISPAHSHN+               EFTSLDDHLDRVKRDLKQTKDCIERRLEDLQGHSHEWNQIESEISELTTVFIHQKMNLKQTFANLTND ILYERFEKSLIELIEKKDIVDKLDQRIKRLNVYRDHESWKYGKYS LNEIYSDLLNEMVAVR SLRAMDVHDLCQ+IMAGEDMNDFSQNVSKQDISLMYPQIGTQTNRNKATSIQTIKRFSSNPNLRSFSSGKPSQNERDSSDSGPVFSRTSPCFAQKLVQTVNDIGTQHSRPSKSHKKSINTSNEYEKILTKEQKDRQFKRLNELLETVRQIKE+ISLSNSSMSIRSNRSQQMKSNNSLRNSTESIRHNLLQPKNKRKKSP+KNNQMRSSVESLGKRPSPTGCTTPISFHRESPRKMRSSPRKSPAKRNSKIAQFAN
Sbjct: 1308 LKKEIINKSNQIDDEFKGFLENINTRINRIKETLNLNVDKNLIEELSLIEKELKAKLMKSKYSLLDLLKTDDLEEDSIFEKVNQIVEKIMKDSKDSEDIIHTLQKNIQIYHENFNKILEKQQNLGERTKLLLENVKGFKSFNFTVVQWESLNRKNILNPFQNELKILQTEIHEKLEREVLNLHPPNQAVLFNFDSLISDLKFIGNLINEENENIENGSNFLSKNRDIQIGFAQSIKSISDHFSECRLDRMSTFEKQIFNLENIKDGIIEALQFNENQQMKIDQENITFNPSTLNQMKSEIINNANHLQRNLDECIELIDSRQTHRHSMDNILDQLLQQVKEIEKFETFVKDLKIIFGESSVIENQLIQIKNDLNSINKPKIEKISKSIDSLLKLTKDENLVQSKNQVKDLQTKLENIERQVNENFDFNKWSESVYRFFSEIITELENNNKNFLQISESNIRNSKQNLVHLNKKIDELKKFLKSRKTFLKLHDKNTEEIVDLFEKLGNLEKEVKNLSERMAKEEKLFDKANRNWKEFEQKKKALEAAIDKNVLKINSMTVKYLTVPGLQFLDKELEGIEHSTIELNSELDCLQATIERLYEGKTVKCQQPENCLDSILRNYKDLSMILSEKRNSFNFLSHNVSEIESCWLRISNLIKNSKDAFKPKTPFSSLYEMEMFFENSKQNFQNTKELLDKNLNSLEEGLDNLKKITYCDMKAFNSISTNQNRVKGEVETFSCLMNQFMEKFFIELKRFQDLNEKVIKLTNETNSLYENLHTIFNDRSFSETTQSSIDDEEERLNSIQNYQLTIKDLLKESFQFCSIKPFQDQLNVSINTSKDCQNIIQLLKEKRKKIEKEKENISTNVQLLSMNLNKISNNLQNNSLYHWNDDCSQLGEVKNYEENLHLISNDLENYQKLSKNLFLQCEDKELENLISKITDLMEKATGVRANVDLVKRDINRRISQNFNLAKDEHERWISSTVSKINASKSPSQFPKDIASDLQTVNELISSLDTGEKLVEETIIQSRAYRQLESGNTTIGVEREDADKRSLRERFQSIVSEIFLQKSDLEAALNEVNKQQDSLHSIGTAVDNNRKRFSAVTKPAVSDVESKHVNLKFMETIQLANNDDIERLTRIKSETKDISVKNNANELERVLKEFDFDIQDKTSRLLKDIKLHESLLFDLRLIEGETRAKTDQIHAIKSTLLVDSIYIMNLKQKFQELENFTENILSRQNTCVKNCESISIEGVFPNDIVEHIKAVQINIQHLNKQMSVIEQECQSCEKNFDEWNKIYTESKDLMNQIECAIEEESRASENLIEKEQKYNLALSNKDRLESYKINILNLESIANHLKGNQYRVQIDEIKNRYKQAIKHNSNNISLLNKYYQRHRNYISKITDINNSFSFFAIDNCEEIHSKSLKNSMKKLKTLKAKLIDINSEIKKLKSEKDILAKETTERGKEILDKEFLELNDKLMKLNSNCDGEIERINSQSISLDNATKLLKQIKNWLIERKRLLNPFAAWNVDDGISARKLNEIQTLMLEFDPKLNQLLEIDNVCNFSFIEANELIFNKNELQIEFSEMKRTMEKLFADGKEIQQLTCQCKEQLKSLKESQENIKSKLNRSEMISKLENEMEYFLNLSRTVDEFDESINRPREILRTLSQFELASEIFKGLSMDLEKIETNHRFHRDQIKSKMESLNEKQKIVELFKAQMKVVSKSMDTVLLMCNSIGEKETPTGKLEKLEEILNKILDIKPDIDGLKSLAVDSGYSTYLDSANNMVQQYDRLLQNIRKDESVCQDQQEICDRYVHSLDQIVAEMDANSFIISDLCSKGFNDIENVSKSKLKVEEIRKLISKNQDQLLRLNQSFEKKNNPFLATLNKDESSQSLSVKMNKNHQMLNEYIDKCNEELDLVSQYTKKSEELETLINFINLNLINIERSGDFSETNLNKIKDLKSSAIVSESLLEELKNISDSSNLLKRRSNLKVDHNKCDRRLIEIKDQSSRLYSKLTRQIAAMESLEKLNQNFSEKVKELHERINKSNGKILNTGLVNTLGKTHQDLSSIQDKLGEILKNDIDKHNDRYLELTGSHRNRTKQIQMLEKDLFECQRKLNHQIESMSKFNSHKTLIEDSIKNLEIKFQSLTKPDDFVFLQTNETCLRTLLFHCEEIELKLNDLRNESLDNKISNYSTNLLDFSHQFNTKLDLIKNEIQVELKSYKMAIDELKEHQYIIQSVKQFLHQSQQKLTNISISSDNIHQLEHELQKIQDLHDSFNKNYFLIVDCSKLDTSKLRCLSDKAIETFQQEIDQINHFFQQLKESIENTKDILVKKLKDIKEKVKREDRFKLWLKKEERTLKINDHIFSEHEIDGEIQRLHGILTELVTKQNEVSFVSSTPEGIPEIINPDIKELCENFSDNAKKRIVLLEKLSKDFDVFNKLLKTWTNWYENIAVKRKQMLSMPDSSGRDFVKYLLNEKTHYFDLILSIASNGESFLPYLTAEGRDVVKSTMKRMKEQWHEIFDDLLTLLERFEEKIKKLESFNENYENCRKQFETINLSLIQEIETREPVKLNFPIGIENKERQLQRLCEFKQNLNALNNSIQRLEYILESDIDGILTAEVNALVIEFHLSKEIVDKAKEMSLKSYQNHQTFEASYLQVQDYVAMMNKNVSICKTLDGTTNSIEARMERIQAVLMKELMDMEHQANHVINQLTRSFNSVLSTSCVVEQKIFRARFETIIKEKKMSDDLLKSTRTILEMAYKNLEKFKTKFGSLSSEVSNLTEEIQSIGDCEILVIEKLTDATKSLSKSYKDLHDEALEIFQATKNQYPLEMCKSIENQLEKCSRMLEKNRWKLDQLSVLRNQFDVEEKDFSDILNSSLSKFSSTQYQFDLCGDLKDFSIVATNLSEIEVQIRDSESSIESLKLLFHEIGRQFPNYSKKIINNFSSLKQNYEKFLRDFNGFKTHFQSIFGASNEINERLAEFKSEFDLIDLSQFHNVPDEKVKKFKNVNDLNTLKMHLISIIGEINEVDIRSISHQKIKEKFEKIKTTQLKSFEELMFDADCRLKTVNDALINQEQLENFIVSSKESLNSIEYSKDRIVVDFSVDKTHFDEKMKEIDANLSFLQVIKRSIEENLSNKVPGCLSEIGELKTLEKEREKLKVDLVEFKKRLSSDFEYFMTLEDRIGNTRKRMNDQNEEILDLNENGMSIEDKRSRLDKAFSLKKKISEIAIEIDDIKEILSTKTSDPIFNETLIRTIKGLETQNKEQLEKTEKIIKHQSLSVEVEEKFESLYQDLIKELRKVKCLFSNFDSNQTDPFDLPTLDDLQDSILILNDLGRESKLYSSASWKENIAKKLGHIDENWKKLESTQIQLTKKIEQINLKIVESKTQRKNLIESLESLKENSTTFLTDKPFTVVKIRRKIFQLKNIQSQLKEWRKEMDSMKDSKSVDNGNQLVKKFRKIQDEIHFEILETKLALEFLLDFDKEIDDFTSWSLTMENRILVVPRFDSSADQIGSRLKDGDSILSELSDGRNKVLHIKAISENLLSHLSKEGQVFIQENLTRVSDNYQHLQETLKEKLKTLELEKTRFEEYESKFKEFLNWLVSYENLYNTKVSSSSLEDKQTSLAQFQSNLQNIFEHKSDLNELIEKGAKFPLNFSIKYNTKDIQIRYPILLKSAQNRIEYLAKSVENHEIYEKDKSTFQTLCQKFNYELKSLKDEKMEIGNLKEIFAKLTAMDIEIRKMEQSRSALEVGFNVVLVETSEIGKKELSSQHLGLLKSFEKFLIDYDEFKSLISKEKKTENNFIKQLEHFSIGLESLIQTMLNLNPSSQIHISSLQNCHEGLEKFSEEIKRRSSSFDQLITNYDINKSEIVSDLITTIDTELKSASNSLAEKRAHVNLLLETNQAYQESFDRLSNWLSNTYSRIQESSDLYGPQSVISQRSDNLNHIQLSIQTEGETLLKAVIERADELNRIILDRTNKEKLSDQVSKCQGEFYNISNKLENIKTKVNDLETQWKNFDTNIKLLNKVNKVFANRKERFRNMKYSYFLNINAEIEKILDLIKDIEEEKSNLEIFSNQIQSLIDVSQEAQLDTIYQDLIDQIDGHEIDCKSLLDMMRQMGNEKSAFDQQVQNTQLMIDAMKAQLLPIDQLHNIASFNDYQKIFREFQLLESKLIDGDRMVDECFQMFYKLSVLFDSEKALNDMISLLKKNWDGHKEKFYEVKTRMNRLLNLWSNLENLRIPIEEWIQTTEKEMEAITCEGYQSTDANLKAFLRVKARKNESETIKPKLSKFIELFYKADIYPGFSKTKDPLVLQKVFCENLDKLMKLEKSLSTTQLNVEKLLREISDAEKWVIEMCLLITSEQQKIPFANSLLDLKDRAKLCKNLKIQIENFGECTIGLLNKNFQDISRLFIKPSPLKNDIFGKLTSLDQGMKQMASLTDKLKASIKDRSSNIKRFGNIIESVEIFLYRKFPEWWIGKEVVATINPEDCLSQLSDVSGILENVQVLEADFEQVWQDNIHQLQSISPAHSHNE---------------EFTSLDDHLDRVKRDLKQTKDCIERRLEDLQGHSHEWNQIESEISELTTVFIHQKMNLKQTFANLTNDVILYERFEKSLIELIEKKDIVDKLDQRIKRLNVYRDHESWKYGKYSRLNEIYSDLLNEMVAVRNSLRAMDVHDLCQKIMAGEDMNDFSQNVSKQDISLMYPQIGTQTNRNKATSIQTIKRFSSNPNLRSFSSGKPSQNERDSSDSGPVFSRTSPCFAQKLVQTVNDIGTQHSRPSKSHKKSINTSNEYEKILTKEQKDRQFKRLNELLETVRQIKEEISLSNSSMSIRSNRSQQMKSNNSLRNSTESIRHNLLQPKNKRKKSPEKNNQMRSSVESLGKRPSPTGCTTPISFHRESPRKMRSSPRKSPAKRNSKIAQFAN 6203          

HSP 2 Score: 1635.54 bits (4234), Expect = 0.000e+0
Identity = 885/914 (96.83%), Postives = 896/914 (98.03%), Query Frame = 2
Query: 1586 NKFSVNRFQIFQNPPSRVPRIYVDSIKSRINIISDKCPELSAYFELFGLFRAATDKHLELQNKIKFLKSGFESFQILVDKYEELKSLVHGEDTESLKVHLKQISESSSKIVKGFISKDISRQMILNQTNQKINDVVKSTLKEIEDILSNQNSLLNKWKKYNEKKDDLIKWISQAKSALKLDKSKRDEFFAANFKLNYQSFVEEKNHFSSSDPDCIRFIENEFEMINESWNSIVKEIELKRQFENIFTLKKEYNERIERIENWMSKSETIADRKTTCERAELEENLDILEAAAKNFETVKIDLQKAAKIGESMFKSNLMESDTEEILGKLQIHKDRFVIVRDXXXXXXXXXXXXXXVMTVFRRNSAELNKWLESAENNLLCNFETGNDEDFHDWISEHEKCFEGNYHLVLDGKINENAKILQRILEQVEEDVDTKLIEDEMENLTERVQICFKNSLGIRNQKEFEHFRDKLKKLLNETRDQIMEEETQLNLNKDFSQVLFMHENYFDNGKIQTKCNELLNSLKLVNIHLINGGKGSLPVDYHNERNNMEYEVDLVFERVATIHSSLLTIPHMLKEFDNLLSNLVDWMSKVEDLSSQLEIYDPMSHHDSTDCNNSIDIENNITFEEYDKTLTEFQRLYDFTETHLKDGEHLTKLLSDIQKASPYLSLEDEKLNLDIALSKCNEIEPKISNTQKIAPIIAESIAFKAKQMKVKKRLLQIKMDLXXXXXXXXXXXXXXXXXXQILQQTFAVETPNIIREIEKEQKIVADFETINLKPVLSKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXIESNSNNLQADIANFEGELKLLKEEIPAQFDFDGSVEKLKGFLENFEDKIDNKVFHYESSVNEAHKTLHLGKDIELDKERVKLKSIINSIKESASKEINNLHLKKEII 4327
            +KFSVNRFQIFQNPPSRVPRIYVDSIKSRINIISDKCPELSAYFELFGLFRAATDKHLELQNKIKFLKSGFESFQILVDKYEELKSLVHGEDTESLKVHLKQISESSSKIVKGFISKDISRQMILNQTNQK+NDVVKSTLKEIEDILSNQNSLLNKWKKYNEKKDDLIKWISQAK+ALKLDKSKRDEFFAANFKLNYQSFVEEKNHFSSSDPDCIRFIENEFEMINESWNSIVKEIELKRQFENIFTLKKEYNERIERIENWMSKSETIADRKTTCERAELEENLDILEAAAKNFETVKIDLQKAAKIGESMFKSNLMESDTEEILGKLQIHKDRFVIVRDKINKKLKILKKLILVMTVFRRNSAELNKWLESAENNLLCNFETGNDEDFH W+SEHEKCFEGNYHLVLDGKINENAKILQRILE+VEEDVDTKLIEDEMENLTERVQ             EFEHFRDKLK LLNETRDQIMEEETQLNLNKDFSQVLFMHENYFDNGKIQTKCNELLNSLKLVNIHLINGGKGSLPVDYHNERNNMEYEVDLVFERVATIHSSLLTIPHMLKEFDNLLSNLVDW SKVEDLS QLEIYDPMSHHDSTDCNNSIDIENNITFEEYDKTLTEFQRLYDFTETHLKDGEHLTKLLSDIQKASPYLSLEDEKLNLD+ALSKCNEIEPKISNTQKIAPIIAESIAFKAKQMKVKKRLLQIKMDLEKIEEEEICEIENIYEKE++LQ+TFAVETPNIIR+IEKEQKIVAD ETIN+KPVLSKVLEEEWKMLNELKEEKLEKLKEAKEMLVEIESNSNNLQADIANFEGELKLLKEEIPAQFDFDGSVEKLKGFLENFEDKIDNKVFHYESSVNEAHKTLHLGKDIELDKERVKLKSIINSIKESASKEINNLHLKKEII
Sbjct:  413 DKFSVNRFQIFQNPPSRVPRIYVDSIKSRINIISDKCPELSAYFELFGLFRAATDKHLELQNKIKFLKSGFESFQILVDKYEELKSLVHGEDTESLKVHLKQISESSSKIVKGFISKDISRQMILNQTNQKVNDVVKSTLKEIEDILSNQNSLLNKWKKYNEKKDDLIKWISQAKTALKLDKSKRDEFFAANFKLNYQSFVEEKNHFSSSDPDCIRFIENEFEMINESWNSIVKEIELKRQFENIFTLKKEYNERIERIENWMSKSETIADRKTTCERAELEENLDILEAAAKNFETVKIDLQKAAKIGESMFKSNLMESDTEEILGKLQIHKDRFVIVRDKINKKLKILKKLILVMTVFRRNSAELNKWLESAENNLLCNFETGNDEDFHYWMSEHEKCFEGNYHLVLDGKINENAKILQRILEKVEEDVDTKLIEDEMENLTERVQ-------------EFEHFRDKLKNLLNETRDQIMEEETQLNLNKDFSQVLFMHENYFDNGKIQTKCNELLNSLKLVNIHLINGGKGSLPVDYHNERNNMEYEVDLVFERVATIHSSLLTIPHMLKEFDNLLSNLVDWTSKVEDLSLQLEIYDPMSHHDSTDCNNSIDIENNITFEEYDKTLTEFQRLYDFTETHLKDGEHLTKLLSDIQKASPYLSLEDEKLNLDMALSKCNEIEPKISNTQKIAPIIAESIAFKAKQMKVKKRLLQIKMDLEKIEEEEICEIENIYEKEKMLQKTFAVETPNIIRDIEKEQKIVADLETINVKPVLSKVLEEEWKMLNELKEEKLEKLKEAKEMLVEIESNSNNLQADIANFEGELKLLKEEIPAQFDFDGSVEKLKGFLENFEDKIDNKVFHYESSVNEAHKTLHLGKDIELDKERVKLKSIINSIKESASKEINNLHLKKEII 1313          

HSP 3 Score: 503.827 bits (1296), Expect = 8.563e-142
Identity = 251/257 (97.67%), Postives = 253/257 (98.44%), Query Frame = 1
Query:  226 RNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIKSENMFKLIAQRDSNPTRRENLVKGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPDQDIHKNSAPKA 996
            +NEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLAN+CSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIKSENMFKLIAQRDSNPTRRENLVKGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLEPEDVDVDYPDEKSIMTYLSLFLHNYPDQDIHK    KA
Sbjct:    9 KNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANICSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIKSENMFKLIAQRDSNPTRRENLVKGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLEPEDVDVDYPDEKSIMTYLSLFLHNYPDQDIHKEEENKA 265          

HSP 4 Score: 224.942 bits (572), Expect = 1.637e-57
Identity = 116/134 (86.57%), Postives = 118/134 (88.06%), Query Frame = 1
Query: 1234 AFNDEFQSLRYQIKTILLEIDSDLKDPQKYKIDSVEENMKSIVPVVEKINQLKELQERLENLDSRL----------------DFQERFRNLLNIQWEIESDIDESEPLSNYLNNLRMLEQGLFFVTDLTVTDVE 1587
            AFNDEFQSLRYQIKT+LLEIDSDLKDPQKYKIDSVEENMKSIVPVVEKINQLKELQERLENLDSRL                DF+ERFRNLLNIQWEIESDIDESEPLSNYLNNLRMLEQGLFFVTDLTVTDVE
Sbjct:  265 AFNDEFQSLRYQIKTLLLEIDSDLKDPQKYKIDSVEENMKSIVPVVEKINQLKELQERLENLDSRLGINMEEKSNKTKSLNKDFKERFRNLLNIQWEIESDIDESEPLSNYLNNLRMLEQGLFFVTDLTVTDVE 398          
BLAST of nesprin-1-like vs. Planmine SMEST
Match: SMESG000023320.1 (SMESG000023320.1)

HSP 1 Score: 9012.89 bits (23386), Expect = 0.000e+0
Identity = 4819/4911 (98.13%), Postives = 4854/4911 (98.84%), Query Frame = 1
Query: 4309 LEKGNYHKSNQINEEFKGFLENINTRINRIKETLNLNVDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIFEKVNQIVEKIMKDSKDSEDIVHTLQKNIQIYHENFNKILERQQNLGERTKLLLENVKGFKSFNFTVVQWESLNRKNILNPFQNELKILQTEIHEKLEREVLNLHPPNQAVLFNFDSLISDLKFIGNLXXXXXXXXXXGSNFLSKNRDIQIGFAQSIKSISDHFSECRLDRMSTFEKQIFNFENIKDGIIEALQFNENQQMKIDQENITFNPSTLNQMKSEIINNANHLQRNLDECIELIDSRQTQRHSMDNILDQLLQQVKEIENFETFVKDLKIIFGESSIIENQLIQIKNDLNSINKPXXXXXXXXXXXXXXXXXXENLVQSKNQVKDLQTKLESIERQVNENFDFNKWSESVYRFFSEIITELENNNKNFLQISESNIRNSKQNLVHLNKKIDELKKFLKSRKTFLKLHDKNTEEIVDLFEKLGNLEKEVKNLSERMAKEEKLFDKANRNWKEFEQKKKALEAAIDKNVLKINSMTVKYLTVPGLQFLDKELEGIEHSTIELNSELDCLQATIERLYEGKTVKCQQPENCLDSILRNYKDLSMILSEKRNSFNFLSHNVSEIESCWLRISNLIKNSKDAFKPKTPFSSLYEMEMFFENSKQNFQNTKELLDKNLNSLEEGLDNLKQITYCDMKAFNSISTNQNRVKGEVESFSCLMNQFMEKFFIELKRFQDLNEKVIKLTNETNSLYENLHTISNGRSFSETTQSSIDDEEERLNSLQNYQLTIKDLLKESFQFCSIKPFQDQLNVSINTSKDCQNIIQLLXXXXXXXXXXXXNISTNVQLLSMXXXXXXXXXXXXXXYHWNDDCSQLGEVKNYEENLQLISNDLENYQKLSKNLFLQCEDKELENLISKITDLMEKATGVGANVDLVKRDINRRISQNFNLAKDEHERWISSTVSKINASKSPSQFPKDIASDLQTVNELISSLDTGEKLVEETIIQSRAYRQLDSGNTTIGVEREDADKRSLRERFQSIVSEIFLQKSDLEVALNEVNKQQDSLHSIGTAVDNNRKRFSAVTKPAVSDVESKHVNLKFMETIQLANNDDIERLTRIKSETKDISVKNNANELERVLKEFDFDIQDKTSRLLKDIKLHESLLFDLRLIEGETRAKTDQIHAIKSTLLVDSIYIMNLKQKFQELENFTENILSRQNTCVKNCESISIEGVFPNDIVEHIKAVQINIQHLNKQMSVIEQECQSCEKNFDEWNKIYTESKDLMNQIECSIEEESRASENLIEKEQKYNLALSNKDRLESYKINILNLESIANHLKGNQYRVQIDEIKNRYKQAIKHNSNNISLLNKYYQRHRNYISKITDINNSFSFFAIDNCEEIHXXXXXXXXXXXXXXXXXXIEINSEIKKLKSEKDILAKETTERGKEILDKEFLELNDKLMKLNSNCDGEIERINSQSISLDNAKKLLKQIKNWLIERKRLLNPFAAWNVDDGISARKLNEIQTLMLEFDPKLNQLLEIDNVCNFSFIEANELIFNKNELQIEFSEMKRTMEKLFADGKEIQQLTCQCKEQLKSLKESQENIKSKLNRSEIISKLENEMEYFLNLSRTVDEFDESINRPREILRTLSQFELASEIFKGLSMDLEKIETNHRFHRDQIKSKMESLNEKQKIGELFKAQMKVVSKSMDTVLLMCNSIGEKETPTGXXXXXXXXXXXXXXXXPDIDGLKSLAVDSGYSTYLDSANNMVQQYDRLLQNIRKDESVCQDQQEICDRYVHSLDQIVAEMDANSFIISDLCSKGFNDIENVSKSKLKAEEIRKLISKNQDQLLRLNQSFEKKNNPFLATLNKDESSQSLSVKMNKNHQMLNEYIDKCNEELDLVSQYTKKSXXXXXXXXXXXXXXXXXXRSGDFSETNLNKIKDLKSSAIVSESLLEELKNISDSSNLLKRRSNLKVDHNKCDSRLIEIKDQSSRLYSKLTRQIAAMESLEKLNQNFSEKVQELHERINKSNGKILNTGLVNTLGKTHQDLSSIQDKLGEILKNDIDKHNDRYLELTGSHRNRTKQIQMLEKDLFECQRKLNHQIESMSKFNSHKTLIEDSIKNLEIKFQSLTNPDDFVFLQTNETCLRTLLFHCEEIELKLNDLRNESLDNKISNYSTNLLDFSHQFNTKLDLIKNEIQVELKSYKMAIDELKEHQYIIQSVKQFLHQSQQKLTNISISSDNIHQLEHELQKIQDLHDSFNKNYFLIVDCSKLDTSKLRCLSDKAIETFQQEIDQINHFFQQLKESIENTXXXXXXXXXXXXXXXXREDRFKLWLKKEERTLKINDHIFSEHEIDGEIQRLHGILTELVTKQNEVSFVSSTSEGIPEIINPDIKELCENFSDNAKKRIVLLEKLSKDFDVFNKLLKTWTNWYENIAVKRKQMLSMPDSSGRDFVKYLLNEKTHYFDLILSIASNGESFLPYLTAEGRDVVKSTMKRMKEQWHEIFDDLLTLLERFEEKIKKLESFNENYENCRKQFETINLSLIQEIETREPVKLNFPIGIENKERQLQRLCEFKQNLNALNNSIQRLEYILESDIDGILTAEVNALVIEFHLSKEIVDKAKEMSLKSYQNHQTFEASYLQVQDYVAMMNKNVSICKTLDGTTNSIEARMERIQTVLMKELMDMEHQANHVINQLTRSFNSVLSTSCVVEQKIFRERFETIIKEKKMSDDLLKSTRTILEMAYKNLEKFKTKFGSLSSEVSNLTKEIQSIDDCEILVIEKLTDATKSLSKSYKDLHDEALEIFQATKNQYPLEMCKSIENQLEKCSRMLEKNRWKLDQLSVLRNQFDVEEKDFSDILNSSLSKFSSTQYQFDLCGDLKDFSIVATNLSEIEVQIRDSESSIESLKLLFHEIGRQFPNYSKKIVNNFSSLKQNYEKFLRDFNGFKTHFQSIFGASNEINERLAEFKSEFDLIDLSQFHFVPDEKVKKFKNVNDLNTLKMHLISIIGEINEVDIRSISHXXXXXXXXXXXXXXLKSFEELMFDADCRLKTVNDVLINQEQLENFIVSSKESLNSIEYSKDRIVVDFSVDKTHFDEKMKEIDANLSSLQVIKRSIEENLSNKVPGCLSEIGXXXXXXXXXXXXXVDLVEFKKRLSSDFEYFMALEDRIGNTRKRMNDQNEEILDLNENGMSIEDKRSRLDKAFXXXXXXXXXXXXXXXXXXXXSTKTSDPIFNETLIRTIKGLETQNKEQLEKTEKIIKHQSLSVEVEEKFESLYQDLIKELRKVKCLFSNFDSNXXXXXXXXXXXXXXXSILILNDLGRESKLYSSASWKENIAKKLGHIDENWKKLESTQIQLTKKIEQINLKIVESKTQRKNLIESLESLKENSTTFLTDKPFTVVKIQHKIFQLKNIQSQLKEWRKEMNSMKDSKSVDNGNELMKKFRKIQDEIHFEILETKLALEFLLDFDKEIDDFTSWSLTMENRILVVPRFDSSADQIGLRLKDGDSILSQLSDGRNKVLHIKAISENLLSHLSKEGQGFIQETLTRVSDNYQHLQXXXXXXXXXXXXXXXRFEEYESKFKEFLNWLVSYENLYNTKVSSSSLEDKQTSLAQFQSNLQNIFEHKSNLNELIEKGAKFPLNFSIKYNTKDIQIRYPILLKSAQNRIEYLAKSVENHEIYEKDKSTFQTFCQKFNYELKSLKEEKMEIGNLKEIFAKLTAMDIEIRKMEQSRSALEVGFNVVLVETSEIGKKELSSQHLGLLKSFEKFLIDYDEFKSLISKEKKTENNFIKQLEHFSIGLESLIQTMLNLNPSSQIHISSLQNCHEGLEKFSEELKRRSSSFDQLITNYDINKSEIVSDLITTIDTELKSASNSLAEKRAHVNLLLETNQAYQEYFDRLSNWLSNTYSRIQESSDLYGPQSVISQRSDNLNRIQLSIQTEGETLLKAVIERADELNRIILDRTNKEKLSDQVSKCQGEFYNVSNKLENIKTKVNDLETQWKNFDTNIKLLNKVNKVFANRKERFRNMKYSYFLNINAEIEKILDLVKDIEEEKSNLEIFSNQIQSLIDVSQEAQLDTIYQDLIDQIDGHEIDCKSLLDMMRQMGNEKSAFDQQVQNTQLMIDAMKAQLLPIDQLHNIASFNDYQKIFREFQLLESKLIDGDRMVDECFQMFYKLSVLFDSEKALNDMISLLKKNWDGHKEKFDEVKTRMNRLLNLWSNLENLRIPIEEWIQTTEKEMEAITCEGYQSTDANLKAFLRVKARKNESETIKPKLSKFIELFYKADIYPGFSKTKDPLVLQKVFCENLDKLMKLEKSLSTTQLNVEKLLREISDAEKWVIEMCLLITSEQQKIPFANSLLDLKDRAKLCKNLKIQIENFGECTIGLLNKNFQDISRLFIKPSPLKNDIFGKLTSLDQGMKQMASLTDKLKASIKDRSSNIKRFGSIIESVEIFLYRKFPEWWIGKEVVATINPEDCLSQLSDVSAILENVQVLEADFEQVWQDNIRQLHSISPAHSHNDGRDTFFNDSTSYINSEFTSLDDHLDRVKRDLKQTKDCIERRLEDLQGHSHEWNQIESEISELTTVFIHQKMNLKQTFANLTNDDILYERFEKSLIELIEKKDIVDKLDQRIKRLNVYRDHESWKYGKYSLLNEIYSDLLNEMVAVRKSLRAMDVHDLCQEIMAGEDMNDFSQNVSKQDISLMYPQIGTQTNRNKATSIQTIKRFSSNPNLRSFSSGKPSQNERDSSDSGPVFSRTSPCFAQKLVQTVNDIGTQHSRPSKSHKKSINTSNEYEKILTKEQKDRQFKRLNELLETVRQIKEQXXXXXXXXXXXXXXXXXXKSNNSLRNSTESIRHNLLQPKNKRKKSPQKNNQMRSSVESLGKRPSPTGCTTPISFHXXXXXXXXXXXXXXXXXXXXXIAQFAN 19041
            L+K   +KSNQI++EFKGFLENINTRINRIKETLNLNVDKNLIEELSLIEKELKAKLMKSKYSLLDLLKTDDLEEDSIFEKVNQIVEKIMKDSKDSEDI+HTLQKNIQIYHENFNKILE+QQNLGERTKLLLENVKGFKSFNFTVVQWESLNRKNILNPFQNELKILQTEIHEKLEREVLNLHPPNQAVLFNFDSLISDLKFIGNLINEENENIENGSNFLSKNRDIQIGFAQSIKSISDHFSECRLDRMSTFEKQIFN ENIKDGIIEALQFNENQQMKIDQENITFNPSTLNQMKSEIINNANHLQRNLDECIELIDSRQT RHSMDNILDQLLQQVKEIE FETFVKDLKIIFGESS+IENQLIQIKNDLNSINKPKIEK+SKSIDSLLKLTKDENLVQSKNQVKDLQTKLE+IERQVNENFDFNKWSESVYRFFSEIITELENNNKNFLQISESNIRNSKQNLVHLNKKIDELKKFLKSRKTFLKLHDKNTEEIVDLFEKLGNLEKEVKNLSERMAKEEKLFDKANRNWKEFEQKKKALEAAIDKNVLKINSMTVKYLTVPGLQFLDKELEGIEHSTIELNSELDCLQATIERLYEGKTVKCQQPENCLDSILRNYKDLSMILSEKRNSFNFLSHNVSEIESCWLRISNLIKNSKDAFKPKTPFSSLYEMEMFFENSKQNFQNTKELLDKNLNSLEEGLDNLK+ITYCDMKAFNSISTNQNRVKGEVE+FSCLMNQFMEKFFIELKRFQDLNEKVIKLTNETNSLYENLHTI N RSFSETTQSSIDDEEERLNS+QNYQLTIKDLLKESFQFCSIKPFQDQLNVSINTSKDCQNIIQLLKEKRKKIEKEKENISTNVQLLSMNLNKISNNLQNNSLYHWNDDCSQLGEVKNYEENL LISNDLENYQKLSKNLFLQCEDKELENLISKITDLMEKATGV ANVDLVKRDINRRISQNFNLAKDEHERWISSTVSKINASKSPSQFPKDIASDLQTVNELISSLDTGEKLVEETIIQSRAYRQL+SGNTTIGVEREDADKRSLRERFQSIVSEIFLQKSDLE ALNEVNKQQDSLHSIGTAVDNNRKRFSAVTKPAVSDVESKHVNLKFMETIQLANNDDIERLTRIKSETKDISVKNNANELERVLKEFDFDIQDKTSRLLKDIKLHESLLFDLRLIEGETRAKTDQIHAIKSTLLVDSIYIMNLKQKFQELENFTENILSRQNTCVKNCESISIEGVFPNDIVEHIKAVQINIQHLNKQMSVIEQECQSCEKNFDEWNKIYTESKDLMNQIEC+IEEESRASENLIEKEQKYNLALSNKDRLESYKINILNLESIANHLKGNQYRVQIDEIKNRYKQAIKHNSNNISLLNKYYQRHRNYISKITDINNSFSFFAIDNCEEIHSKSLKNSMKKLKTLKAKLI+INSEIKKLKSEKDILAKETTERGKEILDKEFLELNDKLMKLNSNCDGEIERINSQSISLDNA KLLKQIKNWLIERKRLLNPFAAWNVDDGISARKLNEIQTLMLEFDPKLNQLLEIDNVCNFSFIEANELIFNKNELQIEFSEMKRTMEKLFADGKEIQQLTCQCKEQLKSLKESQENIKSKLNRSE+ISKLENEMEYFLNLSRTVDEFDESINRPREILRTLSQFELASEIFKGLSMDLEKIETNHRFHRDQIKSKMESLNEKQKI ELFKAQMKVVSKSMDTVLLMCNSIGEKETPTGKLEKLEEILNKILDIKPDIDGLKSLAVDSGYSTYLDSANNMVQQYDRLLQNIRKDESVCQDQQEICDRYVHSLDQIVAEMDANSFIISDLCSKGFNDIENVSKSKLK EEIRKLISKNQDQLLRLNQSFEKKNNPFLATLNKDESSQSLSVKMNKNHQMLNEYIDKCNEELDLVSQYTKKSEELETLINFINLNLINIERSGDFSETNLNKIKDLKSSAIVSESLLEELKNISDSSNLLKRRSNLKVDHNKCD RLIEIKDQSSRLYSKLTRQIAAMESLEKLNQNFSEKV+ELHERINKSNGKILNTGLVNTLGKTHQDLSSIQDKLGEILKNDIDKHNDRYLELTGSHRNRTKQIQMLEKDLFECQRKLNHQIESMSKFNSHKTLIEDSIKNLEIKFQSLT PDDFVFLQTNETCLRTLLFHCEEIELKLNDLRNESLDNKISNYSTNLLDFSHQFNTKLDLIKNEIQVELKSYKMAIDELKEHQYIIQSVKQFLHQSQQKLTNISISSDNIHQLEHELQKIQDLHDSFNKNYFLIVDCSKLDTSKLRCLSDKAIETFQQEIDQINHFFQQLKESIENTKDILVKKLKDIKEKVKREDRFKLWLKKEERTLKINDHIFSEHEIDGEIQRLHGILTELVTKQNEVSFVSST EGIPEIINPDIKELCENFSDNAKKRIVLLEKLSKDFDVFNKLLKTWTNWYENIAVKRKQMLSMPDSSGRDFVKYLLNEKTHYFDLILSIASNGESFLPYLTAEGRDVVKSTMKRMKEQWHEIFDDLLTLLERFEEKIKKLESFNENYENCRKQFETINLSLIQEIETREPVKLNFPIGIENKERQLQRLCEFKQNLNALNNSIQRLEYILESDIDGILTAEVNALVIEFHLSKEIVDKAKEMSLKSYQNHQTFEASYLQVQDYVAMMNKNVSICKTLDGTTNSIEARMERIQ     ELMDMEHQANHVINQLTRSFNSVLSTSCVVEQKIFR RFETIIKEKKMSDDLLKSTRTILEMAYKNLEKFKTKFGSLSSEVSNLT+EIQSI DCEILVIEKLTDATKSLSKSYKDLHDEALEIFQATKNQYPLEMCKSIENQLEKCSRMLEKNRWKLDQLSVLRNQFDVEEKDFSDILNSSLSKFSSTQYQFDLCGDLKDFSIVATNLSEIEVQIRDSESSIESLKLLFHEIGRQFPNYSKKI+NNFSSLKQNYEKFLRDFNGFKTHFQSIFGASNEINERLAEFKSEFDLIDLSQFH VPDEKVKKFKNVNDLNTLKMHLISIIGEINEVDIRSISHQKIKEKFEKIKTTQLKSFEELMFDADCRLKTVND LINQEQLENFIVSSKESLNSIEYSKDRIVVDFSVDKTHFDEKMKEIDANLS LQVIKRSIEENLSNKVPGCLSEIGELKTLEKEREKLKVDLVEFKKRLSSDFEYFM LEDRIGNTRKRMNDQNEEILDLNENGMSIEDKRSRLDKAFSLKKKISEIAIEIDDIKEILSTKTSDPIFNETLIRTIKGLETQNKEQLEKTEKIIKHQSLSVEVEEKFESLYQDLIKELRKVKCLFSNFDSNQTDPFDLPTLDDLQDSILILNDLGRESKLYSSASWKENIAKKLGHIDENWKKLESTQIQLTKKIEQINLKIVESKTQRKNLIESLESLKENSTTFLTDKPFTVVKI+ KIFQLKNIQSQLKEWRKEM+SMKDSKSVDNGN+L+KKFRKIQDEIHFEILETKLALEFLLDFDKEIDDFTSWSLTMENRILVVPRFDSSADQIG RLKDGDSILS+LSDGRNKVLHIKAISENLLSHLSKEGQ FIQE LTRVSDNYQHLQETLK+KLKTLELEKTRFEEYESKFKEFLNWLVSYENLYNTKVSSSSLEDKQTSLAQFQSNLQNIFEHKS+LNELIEKGAKFPLNFSIKYNTKDIQIRYPILLKSAQNRIEYLAKSVENHEIYEKDKSTFQT CQKFNYELKSLK+EKMEIGNLKEIFAKLTAMDIEIRKMEQSRSALEVGFNVVLVETSEIGKKELSSQHLGLLKSFEKFLIDYDEFKSLISKEKKTENNFIKQLEHFSIGLESLIQTMLNLNPSSQIHISSLQNCHEGLEKFSEE+KRRSSSFDQLITNYDINKSEIVSDLITTIDTELKSASNSLAEKRAHVNLLLETNQAYQE FDRLSNWLSNTYSRIQESSDLYGPQSVISQRSDNLN IQLSIQTEGETLLKAVIERADELNRIILDRTNKEKLSDQVSKCQGEFYN+SNKLENIKTKVNDLETQWKNFDTNIKLLNKVNKVFANRKERFRNMKYSYFLNINAEIEKILDL+KDIEEEKSNLEIFSNQIQSLIDVSQEAQLDTIYQDLIDQIDGHEIDCKSLLDMMRQMGNEKSAFDQQVQNTQLMIDAMKAQLLPIDQLHNIASFNDYQKIFREFQLLESKLIDGDRMVDECFQMFYKLSVLFDSEKALNDMISLLKKNWDGHKEKF EVKTRMNRLLNLWSNLENLRIPIEEWIQTTEKEMEAITCEGYQSTDANLKAFLRVKARKNESETIKPKLSKFIELFYKADIYPGFSKTKDPLVLQKVFCENLDKLMKLEKSLSTTQLNVEKLLREISDAEKWVIEMCLLITSEQQKIPFANSLLDLKDRAKLCKNLKIQIENFGECTIGLLNKNFQDISRLFIKPSPLKNDIFGKLTSLDQGMKQMASLTDKLKASIKDRSSNIKRFG+IIESVEIFLYRKFPEWWIGKEVVATINPEDCLSQLSDVS ILENVQVLEADFEQVWQDNI QL SISPAHSHN+               EFTSLDDHLDRVKRDLKQTKDCIERRLEDLQGHSHEWNQIESEISELTTVFIHQKMNLKQTFANLTND ILYERFEKSLIELIEKKDIVDKLDQRIKRLNVYRDHESWKYGKYS LNEIYSDLLNEMVAVR SLRAMDVHDLCQ+IMAGEDMNDFSQNVSKQDISLMYPQIGTQTNRNKATSIQTIKRFSSNPNLRSFSSGKPSQNERDSSDSGPVFSRTSPCFAQKLVQTVNDIGTQHSRPSKSHKKSINTSNEYEKILTKEQKDRQFKRLNELLETVRQIKE+ISLSNSSMSIRSNRSQQMKSNNSLRNSTESIRHNLLQPKNKRKKSP+KNNQMRSSVESLGKRPSPTGCTTPISFHRESPRKMRSSPRKSPAKRNSKIAQFAN
Sbjct: 1388 LKKEIINKSNQIDDEFKGFLENINTRINRIKETLNLNVDKNLIEELSLIEKELKAKLMKSKYSLLDLLKTDDLEEDSIFEKVNQIVEKIMKDSKDSEDIIHTLQKNIQIYHENFNKILEKQQNLGERTKLLLENVKGFKSFNFTVVQWESLNRKNILNPFQNELKILQTEIHEKLEREVLNLHPPNQAVLFNFDSLISDLKFIGNLINEENENIENGSNFLSKNRDIQIGFAQSIKSISDHFSECRLDRMSTFEKQIFNLENIKDGIIEALQFNENQQMKIDQENITFNPSTLNQMKSEIINNANHLQRNLDECIELIDSRQTHRHSMDNILDQLLQQVKEIEKFETFVKDLKIIFGESSVIENQLIQIKNDLNSINKPKIEKISKSIDSLLKLTKDENLVQSKNQVKDLQTKLENIERQVNENFDFNKWSESVYRFFSEIITELENNNKNFLQISESNIRNSKQNLVHLNKKIDELKKFLKSRKTFLKLHDKNTEEIVDLFEKLGNLEKEVKNLSERMAKEEKLFDKANRNWKEFEQKKKALEAAIDKNVLKINSMTVKYLTVPGLQFLDKELEGIEHSTIELNSELDCLQATIERLYEGKTVKCQQPENCLDSILRNYKDLSMILSEKRNSFNFLSHNVSEIESCWLRISNLIKNSKDAFKPKTPFSSLYEMEMFFENSKQNFQNTKELLDKNLNSLEEGLDNLKKITYCDMKAFNSISTNQNRVKGEVETFSCLMNQFMEKFFIELKRFQDLNEKVIKLTNETNSLYENLHTIFNDRSFSETTQSSIDDEEERLNSIQNYQLTIKDLLKESFQFCSIKPFQDQLNVSINTSKDCQNIIQLLKEKRKKIEKEKENISTNVQLLSMNLNKISNNLQNNSLYHWNDDCSQLGEVKNYEENLHLISNDLENYQKLSKNLFLQCEDKELENLISKITDLMEKATGVRANVDLVKRDINRRISQNFNLAKDEHERWISSTVSKINASKSPSQFPKDIASDLQTVNELISSLDTGEKLVEETIIQSRAYRQLESGNTTIGVEREDADKRSLRERFQSIVSEIFLQKSDLEAALNEVNKQQDSLHSIGTAVDNNRKRFSAVTKPAVSDVESKHVNLKFMETIQLANNDDIERLTRIKSETKDISVKNNANELERVLKEFDFDIQDKTSRLLKDIKLHESLLFDLRLIEGETRAKTDQIHAIKSTLLVDSIYIMNLKQKFQELENFTENILSRQNTCVKNCESISIEGVFPNDIVEHIKAVQINIQHLNKQMSVIEQECQSCEKNFDEWNKIYTESKDLMNQIECAIEEESRASENLIEKEQKYNLALSNKDRLESYKINILNLESIANHLKGNQYRVQIDEIKNRYKQAIKHNSNNISLLNKYYQRHRNYISKITDINNSFSFFAIDNCEEIHSKSLKNSMKKLKTLKAKLIDINSEIKKLKSEKDILAKETTERGKEILDKEFLELNDKLMKLNSNCDGEIERINSQSISLDNATKLLKQIKNWLIERKRLLNPFAAWNVDDGISARKLNEIQTLMLEFDPKLNQLLEIDNVCNFSFIEANELIFNKNELQIEFSEMKRTMEKLFADGKEIQQLTCQCKEQLKSLKESQENIKSKLNRSEMISKLENEMEYFLNLSRTVDEFDESINRPREILRTLSQFELASEIFKGLSMDLEKIETNHRFHRDQIKSKMESLNEKQKIVELFKAQMKVVSKSMDTVLLMCNSIGEKETPTGKLEKLEEILNKILDIKPDIDGLKSLAVDSGYSTYLDSANNMVQQYDRLLQNIRKDESVCQDQQEICDRYVHSLDQIVAEMDANSFIISDLCSKGFNDIENVSKSKLKVEEIRKLISKNQDQLLRLNQSFEKKNNPFLATLNKDESSQSLSVKMNKNHQMLNEYIDKCNEELDLVSQYTKKSEELETLINFINLNLINIERSGDFSETNLNKIKDLKSSAIVSESLLEELKNISDSSNLLKRRSNLKVDHNKCDRRLIEIKDQSSRLYSKLTRQIAAMESLEKLNQNFSEKVKELHERINKSNGKILNTGLVNTLGKTHQDLSSIQDKLGEILKNDIDKHNDRYLELTGSHRNRTKQIQMLEKDLFECQRKLNHQIESMSKFNSHKTLIEDSIKNLEIKFQSLTKPDDFVFLQTNETCLRTLLFHCEEIELKLNDLRNESLDNKISNYSTNLLDFSHQFNTKLDLIKNEIQVELKSYKMAIDELKEHQYIIQSVKQFLHQSQQKLTNISISSDNIHQLEHELQKIQDLHDSFNKNYFLIVDCSKLDTSKLRCLSDKAIETFQQEIDQINHFFQQLKESIENTKDILVKKLKDIKEKVKREDRFKLWLKKEERTLKINDHIFSEHEIDGEIQRLHGILTELVTKQNEVSFVSSTPEGIPEIINPDIKELCENFSDNAKKRIVLLEKLSKDFDVFNKLLKTWTNWYENIAVKRKQMLSMPDSSGRDFVKYLLNEKTHYFDLILSIASNGESFLPYLTAEGRDVVKSTMKRMKEQWHEIFDDLLTLLERFEEKIKKLESFNENYENCRKQFETINLSLIQEIETREPVKLNFPIGIENKERQLQRLCEFKQNLNALNNSIQRLEYILESDIDGILTAEVNALVIEFHLSKEIVDKAKEMSLKSYQNHQTFEASYLQVQDYVAMMNKNVSICKTLDGTTNSIEARMERIQ-----ELMDMEHQANHVINQLTRSFNSVLSTSCVVEQKIFRARFETIIKEKKMSDDLLKSTRTILEMAYKNLEKFKTKFGSLSSEVSNLTEEIQSIGDCEILVIEKLTDATKSLSKSYKDLHDEALEIFQATKNQYPLEMCKSIENQLEKCSRMLEKNRWKLDQLSVLRNQFDVEEKDFSDILNSSLSKFSSTQYQFDLCGDLKDFSIVATNLSEIEVQIRDSESSIESLKLLFHEIGRQFPNYSKKIINNFSSLKQNYEKFLRDFNGFKTHFQSIFGASNEINERLAEFKSEFDLIDLSQFHNVPDEKVKKFKNVNDLNTLKMHLISIIGEINEVDIRSISHQKIKEKFEKIKTTQLKSFEELMFDADCRLKTVNDALINQEQLENFIVSSKESLNSIEYSKDRIVVDFSVDKTHFDEKMKEIDANLSFLQVIKRSIEENLSNKVPGCLSEIGELKTLEKEREKLKVDLVEFKKRLSSDFEYFMTLEDRIGNTRKRMNDQNEEILDLNENGMSIEDKRSRLDKAFSLKKKISEIAIEIDDIKEILSTKTSDPIFNETLIRTIKGLETQNKEQLEKTEKIIKHQSLSVEVEEKFESLYQDLIKELRKVKCLFSNFDSNQTDPFDLPTLDDLQDSILILNDLGRESKLYSSASWKENIAKKLGHIDENWKKLESTQIQLTKKIEQINLKIVESKTQRKNLIESLESLKENSTTFLTDKPFTVVKIRRKIFQLKNIQSQLKEWRKEMDSMKDSKSVDNGNQLVKKFRKIQDEIHFEILETKLALEFLLDFDKEIDDFTSWSLTMENRILVVPRFDSSADQIGSRLKDGDSILSELSDGRNKVLHIKAISENLLSHLSKEGQVFIQENLTRVSDNYQHLQETLKEKLKTLELEKTRFEEYESKFKEFLNWLVSYENLYNTKVSSSSLEDKQTSLAQFQSNLQNIFEHKSDLNELIEKGAKFPLNFSIKYNTKDIQIRYPILLKSAQNRIEYLAKSVENHEIYEKDKSTFQTLCQKFNYELKSLKDEKMEIGNLKEIFAKLTAMDIEIRKMEQSRSALEVGFNVVLVETSEIGKKELSSQHLGLLKSFEKFLIDYDEFKSLISKEKKTENNFIKQLEHFSIGLESLIQTMLNLNPSSQIHISSLQNCHEGLEKFSEEIKRRSSSFDQLITNYDINKSEIVSDLITTIDTELKSASNSLAEKRAHVNLLLETNQAYQESFDRLSNWLSNTYSRIQESSDLYGPQSVISQRSDNLNHIQLSIQTEGETLLKAVIERADELNRIILDRTNKEKLSDQVSKCQGEFYNISNKLENIKTKVNDLETQWKNFDTNIKLLNKVNKVFANRKERFRNMKYSYFLNINAEIEKILDLIKDIEEEKSNLEIFSNQIQSLIDVSQEAQLDTIYQDLIDQIDGHEIDCKSLLDMMRQMGNEKSAFDQQVQNTQLMIDAMKAQLLPIDQLHNIASFNDYQKIFREFQLLESKLIDGDRMVDECFQMFYKLSVLFDSEKALNDMISLLKKNWDGHKEKFYEVKTRMNRLLNLWSNLENLRIPIEEWIQTTEKEMEAITCEGYQSTDANLKAFLRVKARKNESETIKPKLSKFIELFYKADIYPGFSKTKDPLVLQKVFCENLDKLMKLEKSLSTTQLNVEKLLREISDAEKWVIEMCLLITSEQQKIPFANSLLDLKDRAKLCKNLKIQIENFGECTIGLLNKNFQDISRLFIKPSPLKNDIFGKLTSLDQGMKQMASLTDKLKASIKDRSSNIKRFGNIIESVEIFLYRKFPEWWIGKEVVATINPEDCLSQLSDVSGILENVQVLEADFEQVWQDNIHQLQSISPAHSHNE---------------EFTSLDDHLDRVKRDLKQTKDCIERRLEDLQGHSHEWNQIESEISELTTVFIHQKMNLKQTFANLTNDVILYERFEKSLIELIEKKDIVDKLDQRIKRLNVYRDHESWKYGKYSRLNEIYSDLLNEMVAVRNSLRAMDVHDLCQKIMAGEDMNDFSQNVSKQDISLMYPQIGTQTNRNKATSIQTIKRFSSNPNLRSFSSGKPSQNERDSSDSGPVFSRTSPCFAQKLVQTVNDIGTQHSRPSKSHKKSINTSNEYEKILTKEQKDRQFKRLNELLETVRQIKEEISLSNSSMSIRSNRSQQMKSNNSLRNSTESIRHNLLQPKNKRKKSPEKNNQMRSSVESLGKRPSPTGCTTPISFHRESPRKMRSSPRKSPAKRNSKIAQFAN 6278          

HSP 2 Score: 1634.77 bits (4232), Expect = 0.000e+0
Identity = 885/914 (96.83%), Postives = 896/914 (98.03%), Query Frame = 2
Query: 1586 NKFSVNRFQIFQNPPSRVPRIYVDSIKSRINIISDKCPELSAYFELFGLFRAATDKHLELQNKIKFLKSGFESFQILVDKYEELKSLVHGEDTESLKVHLKQISESSSKIVKGFISKDISRQMILNQTNQKINDVVKSTLKEIEDILSNQNSLLNKWKKYNEKKDDLIKWISQAKSALKLDKSKRDEFFAANFKLNYQSFVEEKNHFSSSDPDCIRFIENEFEMINESWNSIVKEIELKRQFENIFTLKKEYNERIERIENWMSKSETIADRKTTCERAELEENLDILEAAAKNFETVKIDLQKAAKIGESMFKSNLMESDTEEILGKLQIHKDRFVIVRDXXXXXXXXXXXXXXVMTVFRRNSAELNKWLESAENNLLCNFETGNDEDFHDWISEHEKCFEGNYHLVLDGKINENAKILQRILEQVEEDVDTKLIEDEMENLTERVQICFKNSLGIRNQKEFEHFRDKLKKLLNETRDQIMEEETQLNLNKDFSQVLFMHENYFDNGKIQTKCNELLNSLKLVNIHLINGGKGSLPVDYHNERNNMEYEVDLVFERVATIHSSLLTIPHMLKEFDNLLSNLVDWMSKVEDLSSQLEIYDPMSHHDSTDCNNSIDIENNITFEEYDKTLTEFQRLYDFTETHLKDGEHLTKLLSDIQKASPYLSLEDEKLNLDIALSKCNEIEPKISNTQKIAPIIAESIAFKAKQMKVKKRLLQIKMDLXXXXXXXXXXXXXXXXXXQILQQTFAVETPNIIREIEKEQKIVADFETINLKPVLSKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXIESNSNNLQADIANFEGELKLLKEEIPAQFDFDGSVEKLKGFLENFEDKIDNKVFHYESSVNEAHKTLHLGKDIELDKERVKLKSIINSIKESASKEINNLHLKKEII 4327
            +KFSVNRFQIFQNPPSRVPRIYVDSIKSRINIISDKCPELSAYFELFGLFRAATDKHLELQNKIKFLKSGFESFQILVDKYEELKSLVHGEDTESLKVHLKQISESSSKIVKGFISKDISRQMILNQTNQK+NDVVKSTLKEIEDILSNQNSLLNKWKKYNEKKDDLIKWISQAK+ALKLDKSKRDEFFAANFKLNYQSFVEEKNHFSSSDPDCIRFIENEFEMINESWNSIVKEIELKRQFENIFTLKKEYNERIERIENWMSKSETIADRKTTCERAELEENLDILEAAAKNFETVKIDLQKAAKIGESMFKSNLMESDTEEILGKLQIHKDRFVIVRDKINKKLKILKKLILVMTVFRRNSAELNKWLESAENNLLCNFETGNDEDFH W+SEHEKCFEGNYHLVLDGKINENAKILQRILE+VEEDVDTKLIEDEMENLTERVQ             EFEHFRDKLK LLNETRDQIMEEETQLNLNKDFSQVLFMHENYFDNGKIQTKCNELLNSLKLVNIHLINGGKGSLPVDYHNERNNMEYEVDLVFERVATIHSSLLTIPHMLKEFDNLLSNLVDW SKVEDLS QLEIYDPMSHHDSTDCNNSIDIENNITFEEYDKTLTEFQRLYDFTETHLKDGEHLTKLLSDIQKASPYLSLEDEKLNLD+ALSKCNEIEPKISNTQKIAPIIAESIAFKAKQMKVKKRLLQIKMDLEKIEEEEICEIENIYEKE++LQ+TFAVETPNIIR+IEKEQKIVAD ETIN+KPVLSKVLEEEWKMLNELKEEKLEKLKEAKEMLVEIESNSNNLQADIANFEGELKLLKEEIPAQFDFDGSVEKLKGFLENFEDKIDNKVFHYESSVNEAHKTLHLGKDIELDKERVKLKSIINSIKESASKEINNLHLKKEII
Sbjct:  493 DKFSVNRFQIFQNPPSRVPRIYVDSIKSRINIISDKCPELSAYFELFGLFRAATDKHLELQNKIKFLKSGFESFQILVDKYEELKSLVHGEDTESLKVHLKQISESSSKIVKGFISKDISRQMILNQTNQKVNDVVKSTLKEIEDILSNQNSLLNKWKKYNEKKDDLIKWISQAKTALKLDKSKRDEFFAANFKLNYQSFVEEKNHFSSSDPDCIRFIENEFEMINESWNSIVKEIELKRQFENIFTLKKEYNERIERIENWMSKSETIADRKTTCERAELEENLDILEAAAKNFETVKIDLQKAAKIGESMFKSNLMESDTEEILGKLQIHKDRFVIVRDKINKKLKILKKLILVMTVFRRNSAELNKWLESAENNLLCNFETGNDEDFHYWMSEHEKCFEGNYHLVLDGKINENAKILQRILEKVEEDVDTKLIEDEMENLTERVQ-------------EFEHFRDKLKNLLNETRDQIMEEETQLNLNKDFSQVLFMHENYFDNGKIQTKCNELLNSLKLVNIHLINGGKGSLPVDYHNERNNMEYEVDLVFERVATIHSSLLTIPHMLKEFDNLLSNLVDWTSKVEDLSLQLEIYDPMSHHDSTDCNNSIDIENNITFEEYDKTLTEFQRLYDFTETHLKDGEHLTKLLSDIQKASPYLSLEDEKLNLDMALSKCNEIEPKISNTQKIAPIIAESIAFKAKQMKVKKRLLQIKMDLEKIEEEEICEIENIYEKEKMLQKTFAVETPNIIRDIEKEQKIVADLETINVKPVLSKVLEEEWKMLNELKEEKLEKLKEAKEMLVEIESNSNNLQADIANFEGELKLLKEEIPAQFDFDGSVEKLKGFLENFEDKIDNKVFHYESSVNEAHKTLHLGKDIELDKERVKLKSIINSIKESASKEINNLHLKKEII 1393          

HSP 3 Score: 865.914 bits (2236), Expect = 0.000e+0
Identity = 450/470 (95.74%), Postives = 454/470 (96.60%), Query Frame = 1
Query:  226 RNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIKSENMFKLIAQRDSNPTRRENLVKGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPDQDIHKNSAPKASHNWIDIKTSEETAMDKISQEEIVKQRSSLKKSEFNKYTTPTLQSTMTIKRQNQPKPVVNPSVVRQIXXXXXXXXXXXXAFNDEFQSLRYQIKTILLEIDSDLKDPQKYKIDSVEENMKSIVPVVEKINQLKELQERLENLDSRL----------------DFQERFRNLLNIQWEIESDIDESEPLSNYLNNLRMLEQGLFFVTDLTVTDVE 1587
            +NEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLAN+CSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIKSENMFKLIAQRDSNPTRRENLVKGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLEPEDVDVDYPDEKSIMTYLSLFLHNYPDQDIHKNSAPKASHNWIDIKTSEETAMDKISQEEIVKQRSSLKKSEFNKYTTPTLQSTMTIKRQNQPKPVVNPSVVRQIKNDKKSEEEENKAFNDEFQSLRYQIKT+LLEIDSDLKDPQKYKIDSVEENMKSIVPVVEKINQLKELQERLENLDSRL                DF+ERFRNLLNIQWEIESDIDESEPLSNYLNNLRMLEQGLFFVTDLTVTDVE
Sbjct:    9 KNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANICSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIKSENMFKLIAQRDSNPTRRENLVKGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLEPEDVDVDYPDEKSIMTYLSLFLHNYPDQDIHKNSAPKASHNWIDIKTSEETAMDKISQEEIVKQRSSLKKSEFNKYTTPTLQSTMTIKRQNQPKPVVNPSVVRQIKNDKKSEEEENKAFNDEFQSLRYQIKTLLLEIDSDLKDPQKYKIDSVEENMKSIVPVVEKINQLKELQERLENLDSRLGINMEEKSNKTKSLNKDFKERFRNLLNIQWEIESDIDESEPLSNYLNNLRMLEQGLFFVTDLTVTDVE 478          
BLAST of nesprin-1-like vs. Planmine SMEST
Match: SMESG000069851.1 (SMESG000069851.1)

HSP 1 Score: 218.779 bits (556), Expect = 6.516e-56
Identity = 119/249 (47.79%), Postives = 173/249 (69.48%), Query Frame = 1
Query:  226 RNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIKSEN---MFKLIAQRDSNPTRRENLVKGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPD 963
            ++E E +Q+KTFT WIN  L + HP  KI NLY  + DG+ L+ LL+ +T +KL  E+ K+MQ++H L+N+ + + FLK +  IKL+NI+A DI DGRP+IILGL+W +IL FQI+ +    +  L A  D          K N + +LL W +K I + Y +++ DF  SW+DGKAFNA++HNI+P+LVDW+ +K + ++ENL+ AF+ AE+ L IP LL+ +DVDV  PDEKSIMTY++ FL +YP+
Sbjct:   19 KDEQERVQRKTFTNWINTYLVQAHPPYKIDNLYESIKDGLCLIHLLEAMTGEKLRKEQPKNMQKIHRLSNINTALEFLK-SRKIKLVNINATDIADGRPSIILGLMWTVILFFQIEEQEEILIGALGADYDG---------KLNAKTSLLNWVNKTIGDKYNLNVTDFGPSWRDGKAFNALVHNIDPSLVDWNGVKNKTNKENLQEAFKQAEQ-LGIPHLLDVQDVDVAKPDEKSIMTYITQFLKSYPE 256          
BLAST of nesprin-1-like vs. Planmine SMEST
Match: SMESG000077685.1 (SMESG000077685.1)

HSP 1 Score: 209.149 bits (531), Expect = 8.501e-53
Identity = 123/252 (48.81%), Postives = 184/252 (73.02%), Query Frame = 1
Query:  211 RGRQIRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGIRLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIHAADIVDGRPNIILGLVWQIILNFQIKSENMFKLIAQRDSN-PTRRENLVKGNPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWDLIKRRNSRENLEYAFRLAEKYLNIPKLLXXXXXXXXXXXXKSIMTYLSLFLHNYPD 963
            +G  +++E E +QKKTFTKW+N+ L +K P   I++L  DL DG+ LL+LL+ILTK  L  EK K+MQ++HCL+N+ + + F+++   IKL+NI+ +D+VDG+P I+LGLVW  IL+FQI+ +  F L A   +N P  +   VKG  ++ L+AW++  +++ YG++I DF  SW DG+AFNA++HNI+P LV+ + I++  ++E LE AF +AE  L IPKLL+ EDVDV+ PDEKSIMTY++ FL +YP+
Sbjct:   10 KGVLLKDEQEKMQKKTFTKWMNSYLCQKKPPIIIKDLMKDLSDGLLLLDLLEILTKTTLKKEKPKNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAILHFQIEEQEEFLLQALGMANDPNAK---VKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPE 258          
The following BLAST results are available for this feature:
BLAST of nesprin-1-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYNE15.072e-5944.48spectrin repeat containing nuclear envelope protei... [more]
SYNE19.972e-5844.73spectrin repeat containing nuclear envelope protei... [more]
SYNE13.650e-5745.16spectrin repeat containing nuclear envelope protei... [more]
SYNE11.346e-5644.73spectrin repeat containing nuclear envelope protei... [more]
SYNE19.729e-5645.16spectrin repeat containing nuclear envelope protei... [more]
back to top
BLAST of nesprin-1-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-702.221e-3939.78Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:... [more]
unc-704.319e-3939.64Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:... [more]
unc-704.361e-3939.64Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:... [more]
unc-705.054e-3939.05Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:... [more]
sma-17.056e-3840.30SMAll [Source:UniProtKB/TrEMBL;Acc:G5EFW3][more]
back to top
BLAST of nesprin-1-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Msp3002.173e-4743.13gene:FBgn0261836 transcript:FBtr0303388[more]
Msp3002.209e-4743.13gene:FBgn0261836 transcript:FBtr0332404[more]
Msp3002.363e-4743.13gene:FBgn0261836 transcript:FBtr0303389[more]
Msp3002.532e-4743.46gene:FBgn0261836 transcript:FBtr0303385[more]
Msp3002.639e-4743.46gene:FBgn0261836 transcript:FBtr0332405[more]
back to top
BLAST of nesprin-1-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syne1b8.172e-5644.94spectrin repeat containing, nuclear envelope 1b [S... [more]
syne1b8.172e-5644.94spectrin repeat containing, nuclear envelope 1b [S... [more]
syne1a1.676e-4942.29spectrin repeat containing, nuclear envelope 1a [S... [more]
syne1a1.791e-4942.29spectrin repeat containing, nuclear envelope 1a [S... [more]
syne2b2.947e-4338.97spectrin repeat containing, nuclear envelope 2b [S... [more]
back to top
BLAST of nesprin-1-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYNE15.205e-5344.85spectrin repeat containing, nuclear envelope 1 [So... [more]
SYNE11.604e-4543.19spectrin repeat containing, nuclear envelope 1 [So... [more]
SYNE11.645e-4543.19spectrin repeat containing, nuclear envelope 1 [So... [more]
SYNE11.677e-4543.19spectrin repeat containing, nuclear envelope 1 [So... [more]
SYNE11.717e-4543.36spectrin repeat containing, nuclear envelope 1 [So... [more]
back to top
BLAST of nesprin-1-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Syne11.423e-5645.32spectrin repeat containing, nuclear envelope 1 [So... [more]
Syne11.475e-5344.69spectrin repeat containing, nuclear envelope 1 [So... [more]
Syne12.240e-5344.69spectrin repeat containing, nuclear envelope 1 [So... [more]
Syne21.621e-4442.21spectrin repeat containing, nuclear envelope 2 [So... [more]
Syne21.264e-4241.79spectrin repeat containing, nuclear envelope 2 [So... [more]
back to top
BLAST of nesprin-1-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8NF91|SYNE1_HUMAN4.753e-5444.89Nesprin-1 OS=Homo sapiens OX=9606 GN=SYNE1 PE=1 SV... [more]
sp|Q6ZWR6|SYNE1_MOUSE5.025e-5345.32Nesprin-1 OS=Mus musculus OX=10090 GN=Syne1 PE=1 S... [more]
sp|Q6ZWQ0|SYNE2_MOUSE9.531e-4241.79Nesprin-2 OS=Mus musculus OX=10090 GN=Syne2 PE=1 S... [more]
sp|Q96JQ2|CLMN_HUMAN2.501e-4040.58Calmin OS=Homo sapiens OX=9606 GN=CLMN PE=1 SV=1[more]
sp|Q01082|SPTB2_HUMAN1.009e-3940.64Spectrin beta chain, non-erythrocytic 1 OS=Homo sa... [more]
back to top
BLAST of nesprin-1-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0S7K5438.635e-6146.42SYNE1 (Fragment) OS=Poeciliopsis prolifica OX=1881... [more]
A0A3P9C6D21.909e-5946.13Uncharacterized protein OS=Maylandia zebra OX=1065... [more]
A0A3P8NQC62.120e-5946.13Uncharacterized protein OS=Astatotilapia callipter... [more]
A0A3Q3K8944.934e-5946.44Uncharacterized protein OS=Monopterus albus OX=437... [more]
A0A1I8GMD06.184e-5950.60Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of nesprin-1-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000036923.13.633e-6046.47pep primary_assembly:Astyanax_mexicanus-2.0:9:2416... [more]
ENSAMXT00000039764.12.167e-5946.27pep primary_assembly:Astyanax_mexicanus-2.0:9:2416... [more]
ENSAMXT00000045503.12.261e-5646.47pep primary_assembly:Astyanax_mexicanus-2.0:9:2416... [more]
syne1a2.090e-5043.07spectrin repeat containing, nuclear envelope 1a [S... [more]
ENSAMXT00000009444.24.421e-4140.48spectrin beta chain, non-erythrocytic 1-like [Sour... [more]
back to top
BLAST of nesprin-1-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008111.11.298e-4141.04pep scaffold:Pmarinus_7.0:GL478136:8967:48859:1 ge... [more]
ENSPMAT00000009426.11.374e-4140.00pep scaffold:Pmarinus_7.0:GL476614:383620:553344:1... [more]
ENSPMAT00000006515.11.644e-3942.51pep scaffold:Pmarinus_7.0:GL476558:286719:335794:-... [more]
ENSPMAT00000006506.15.465e-3843.44pep scaffold:Pmarinus_7.0:GL476558:286440:335800:-... [more]
ENSPMAT00000002838.11.927e-3742.32pep scaffold:Pmarinus_7.0:GL477168:22072:87306:1 g... [more]
back to top
BLAST of nesprin-1-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SAC63.517e-625.70Fimbrin, actin-bundling protein; cooperates with S... [more]
back to top
BLAST of nesprin-1-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO410991.532e-3738.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO291012.190e-3736.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424312.354e-3737.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303099.516e-3738.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495765.164e-3536.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of nesprin-1-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000000374.24.647e-5645.09pep primary_assembly:ASM223467v1:22:316712:329038:... [more]
ENSORLT00000028699.11.706e-5243.32pep primary_assembly:ASM223467v1:24:9030419:904584... [more]
ENSORLT00000031933.16.997e-5243.27pep primary_assembly:ASM223467v1:24:9030419:905023... [more]
ENSORLT00000033742.11.264e-5044.24pep primary_assembly:ASM223467v1:24:9030654:905023... [more]
sptb1.890e-4241.83spectrin beta chain, erythrocytic [Source:NCBI gen... [more]
back to top
BLAST of nesprin-1-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023320.10.000e+098.21SMESG000023320.1[more]
SMESG000023320.18.563e-14298.21SMESG000023320.1[more]
SMESG000023320.10.000e+098.13SMESG000023320.1[more]
SMESG000069851.16.516e-5647.79SMESG000069851.1[more]
SMESG000077685.18.501e-5348.81SMESG000077685.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035723 ID=SMED30035723|Name=nesprin-1-like|organism=Schmidtea mediterranea sexual|type=transcript|length=19186bp
GTCTATTCTTTTATTTTTAGTAATTAAAATAGTGAAATTGACATTGGCTG
ACGCATTTCAGGGATATTTCATTGTGTTTCGGCTATTGTATTTGTCAATA
GATCATCACTTTTCAAGAGAACCTGAAGGGGAAAAAACTCATAAATTTTC
ACTAGTCAAAGCAAAGTTGACAAAAATTGTGTTTGAAAATTATCTATGCT
AATCCGAACAAGAGGTCGGCAAATCCGAAACGAGCATGAGCACATCCAGA
AAAAGACGTTCACAAAATGGATCAACAATTTACTGTCGAAGAAACATCCG
GAGGAGAAAATTCAAAATCTTTATGTTGATTTGTGTGACGGAATACGGCT
CCTGGAACTCTTGCAGATTTTGACAAAACAGAAACTGACCATTGAAAAAC
GGAAACACATGCAAAGAGTGCATTGTCTTGCCAACATGTGTAGCCTGATC
GGGTTTTTGAAAGATACTATGCACATAAAGTTGATCAACATTCACGCAGC
AGATATCGTTGATGGAAGACCAAATATTATTCTCGGATTGGTTTGGCAAA
TCATCTTAAATTTTCAGATCAAATCTGAAAATATGTTCAAACTAATAGCT
CAACGAGATAGTAATCCTACAAGAAGGGAAAATCTAGTGAAAGGAAACCC
TAGGGAGGCGTTACTCGCCTGGTCAGACAAAGTAATAACAGAAAATTATG
GGATTTCCATAAACGATTTTCATAGTAGCTGGAAAGATGGAAAGGCTTTC
AACGCAATCATTCATAATATCAATCCGAATTTGGTTGACTGGGATTTGAT
TAAAAGAAGAAACTCAAGGGAAAATTTGGAGTATGCCTTTCGATTGGCCG
AAAAATATTTAAATATTCCTAAACTTTTGGAACCAGAAGATGTCGACGTC
GACTATCCCGATGAGAAGTCTATTATGACATATTTGTCATTGTTCCTTCA
CAATTATCCCGATCAGGACATTCATAAAAATTCAGCTCCTAAAGCATCTC
ATAACTGGATTGATATCAAAACCAGTGAAGAAACGGCGATGGACAAAATA
AGTCAAGAAGAAATTGTCAAGCAAAGGTCTTCTTTAAAGAAATCTGAATT
TAATAAATATACAACACCAACATTGCAATCAACTATGACAATCAAAAGAC
AAAACCAACCAAAACCTGTCGTAAATCCTTCTGTAGTTCGTCAAATAAAA
AATGACAAAAAGAGTGAGGAGGAAGAAAATAAGGCATTCAATGATGAATT
TCAAAGTCTTCGTTACCAAATCAAAACTATTTTATTGGAAATAGATTCCG
ATCTCAAAGATCCCCAAAAATATAAAATAGATTCAGTTGAAGAAAATATG
AAATCTATTGTGCCAGTAGTGGAGAAAATAAATCAGTTGAAGGAATTGCA
AGAAAGACTTGAAAATCTTGACAGCAGACTTGATTTTCAGGAACGATTTA
GAAACCTTCTCAATATTCAATGGGAAATTGAGTCTGACATCGACGAATCT
GAACCTTTAAGTAATTATTTAAACAACCTCCGAATGTTAGAACAAGGTTT
ATTTTTTGTCACTGATTTGACTGTTACCGATGTCGAATAAATTTAGCGTT
AATCGGTTTCAAATTTTCCAAAACCCCCCTAGCCGAGTGCCAAGAATTTA
TGTTGATAGCATTAAATCAAGAATTAACATCATCAGTGATAAATGTCCCG
AATTATCCGCGTATTTTGAATTGTTTGGACTATTTCGTGCCGCAACGGAC
AAACATTTGGAGTTGCAGAACAAAATTAAATTCCTGAAAAGTGGATTTGA
AAGTTTCCAAATATTGGTGGACAAATATGAAGAACTTAAATCGCTTGTCC
ACGGAGAAGACACCGAAAGCTTGAAAGTTCACCTAAAGCAAATTTCAGAA
TCAAGTTCTAAAATTGTGAAAGGTTTTATTTCGAAGGATATTTCTCGTCA
AATGATTCTCAATCAAACGAACCAAAAGATAAATGACGTCGTCAAATCAA
CCTTGAAAGAAATCGAAGACATTTTGTCCAATCAGAATTCATTATTAAAT
AAATGGAAGAAATATAACGAGAAAAAGGACGATCTAATCAAATGGATCAG
TCAAGCTAAATCTGCACTCAAACTTGACAAATCAAAGCGCGATGAATTTT
TTGCCGCAAATTTTAAATTAAACTATCAAAGCTTTGTTGAGGAGAAGAAT
CATTTCTCATCGTCGGACCCAGATTGCATAAGATTCATCGAGAACGAATT
TGAAATGATAAATGAAAGCTGGAACTCAATTGTTAAAGAAATTGAATTGA
AAAGGCAATTTGAAAATATTTTCACTTTGAAAAAAGAATACAACGAAAGA
ATCGAAAGAATCGAGAACTGGATGAGTAAAAGTGAAACGATTGCCGATCG
GAAAACGACTTGTGAAAGAGCGGAACTGGAAGAAAATCTCGATATTTTAG
AAGCGGCGGCGAAAAATTTCGAAACCGTTAAAATAGATTTGCAAAAAGCT
GCGAAAATTGGTGAATCTATGTTCAAATCGAACTTGATGGAGTCTGACAC
CGAAGAAATTCTGGGAAAGCTTCAAATCCACAAAGACCGATTCGTGATCG
TTCGGGATAAAATCAACAAGAAACTGAAAATTTTGAAAAAACTCATTCTC
GTTATGACGGTTTTCCGCAGAAATTCAGCCGAACTGAACAAATGGCTAGA
ATCAGCGGAAAATAATCTGTTATGCAATTTTGAAACCGGAAATGATGAAG
ATTTTCATGATTGGATATCTGAGCATGAAAAATGCTTCGAAGGAAATTAT
CACCTCGTGCTCGACGGGAAAATTAATGAAAATGCCAAAATCCTTCAAAG
GATTCTAGAACAGGTGGAGGAGGACGTCGACACGAAATTGATAGAAGATG
AAATGGAAAATCTCACTGAAAGAGTTCAGATTTGTTTTAAAAACTCTCTG
GGAATAAGAAATCAAAAGGAATTCGAGCACTTTAGGGATAAGCTAAAGAA
ACTTTTAAACGAAACTCGAGATCAAATAATGGAGGAAGAAACCCAACTCA
ATTTGAATAAAGATTTTTCACAAGTTCTTTTCATGCACGAGAATTACTTT
GACAACGGGAAAATTCAAACCAAATGCAATGAGTTACTAAATTCCCTGAA
ATTGGTGAACATTCATTTGATAAACGGAGGAAAAGGTTCTTTGCCAGTCG
ACTATCACAATGAAAGGAATAACATGGAATATGAAGTGGACTTAGTGTTT
GAAAGGGTTGCCACAATTCACAGTTCCCTGCTGACAATACCTCATATGTT
GAAGGAATTTGATAATTTGCTGTCAAATCTTGTTGACTGGATGTCGAAGG
TTGAGGATTTATCATCACAACTCGAAATCTATGATCCAATGTCACACCAT
GATTCTACAGATTGCAATAATTCCATTGACATAGAAAATAACATTACATT
TGAGGAATATGATAAAACGTTAACGGAGTTTCAGAGATTATATGATTTTA
CCGAGACACATCTAAAAGATGGAGAACATCTTACTAAACTCTTATCAGAC
ATACAGAAGGCCAGTCCATATTTGTCTTTGGAAGACGAAAAATTGAATTT
AGACATAGCACTTTCGAAATGTAATGAAATAGAACCAAAAATATCAAATA
CTCAAAAAATCGCTCCTATCATAGCAGAATCTATTGCTTTCAAAGCAAAA
CAAATGAAAGTCAAAAAACGATTACTCCAAATAAAAATGGACTTGGAGAA
AATTGAGGAAGAAGAAATTTGCGAAATCGAAAATATTTACGAAAAAGAAC
AAATCCTTCAACAAACATTTGCTGTAGAAACTCCGAATATTATTCGAGAA
ATTGAAAAGGAGCAAAAGATCGTTGCGGATTTTGAAACAATAAATCTCAA
ACCGGTTTTATCAAAAGTTCTTGAAGAAGAATGGAAAATGTTGAATGAAT
TGAAAGAAGAGAAATTGGAGAAATTGAAAGAAGCAAAAGAAATGCTAGTG
GAAATCGAATCGAACTCGAATAATCTCCAAGCCGACATTGCAAATTTCGA
AGGAGAATTAAAACTTTTGAAGGAAGAGATTCCTGCTCAATTTGATTTCG
ATGGTTCAGTTGAAAAATTGAAAGGCTTTCTTGAAAATTTCGAGGATAAA
ATTGATAATAAAGTTTTTCATTATGAATCCTCGGTCAATGAGGCTCATAA
AACCCTTCATTTGGGAAAGGATATTGAACTTGATAAAGAAAGAGTAAAAC
TAAAATCTATTATCAATTCAATAAAGGAAAGTGCTTCAAAGGAAATCAAT
AATTTGCACTTGAAAAAGGAAATTATCATAAATCAAATCAAATAAATGAA
GAATTCAAGGGGTTCCTTGAAAACATAAATACAAGGATAAATAGAATAAA
GGAGACTTTAAATTTGAATGTTGACAAAAATCTAATTGAAGAACTCTCTC
TTATCGAAAAGGAATTGAAAGCCAAACTGATGAAGTCAAAATATTCTCTT
TTAGATTTATTAAAAACCGATGACCTAGAGGAAGATAGTATTTTTGAAAA
AGTAAATCAGATCGTTGAGAAAATCATGAAAGACTCGAAAGATTCAGAAG
ATATTGTCCACACTCTTCAAAAGAACATTCAAATTTATCATGAAAATTTC
AACAAAATATTAGAAAGACAGCAAAACCTTGGAGAAAGAACTAAATTATT
ACTAGAAAATGTAAAAGGTTTTAAGTCCTTTAACTTCACCGTTGTCCAAT
GGGAAAGTCTAAACAGGAAGAATATTTTAAATCCCTTCCAAAATGAACTA
AAGATCCTTCAAACGGAAATCCACGAGAAATTAGAACGTGAAGTTTTAAA
TCTTCACCCTCCAAATCAAGCGGTCCTCTTCAATTTCGATTCATTAATTT
CCGATCTGAAATTCATCGGAAATCTTATCAATGAAGAAAACGAGAACATT
GAAAATGGATCAAATTTTCTGTCGAAAAACCGAGACATCCAAATCGGATT
TGCACAATCGATCAAATCAATATCGGATCACTTTAGTGAATGCCGATTGG
ATAGGATGAGCACCTTTGAGAAACAGATTTTCAACTTTGAAAACATCAAA
GATGGAATAATCGAAGCTCTTCAATTCAACGAAAATCAGCAAATGAAAAT
CGACCAAGAAAATATAACTTTCAACCCCAGCACTTTGAATCAGATGAAAA
GTGAAATAATCAATAATGCCAATCATTTACAACGGAACCTCGATGAGTGC
ATTGAGTTGATCGACAGTAGACAAACTCAAAGACATTCAATGGATAACAT
ACTCGACCAATTACTTCAACAAGTCAAAGAAATAGAAAACTTCGAAACCT
TCGTTAAAGACCTCAAAATCATTTTCGGGGAGAGTTCTATTATTGAAAAC
CAATTAATTCAAATTAAAAATGATTTAAATTCCATCAATAAGCCCAAAAT
CGAAAAACTTTCAAAATCAATCGACTCTCTCTTGAAACTGACAAAGGACG
AAAACTTAGTCCAGTCAAAGAATCAAGTGAAAGACTTGCAAACGAAACTC
GAGAGTATTGAAAGACAAGTCAACGAGAATTTCGATTTCAACAAATGGTC
GGAATCAGTCTACAGATTCTTTTCGGAAATAATCACCGAGCTCGAAAATA
ACAACAAGAACTTTCTCCAGATCTCTGAAAGTAACATCCGAAACAGCAAA
CAAAATTTGGTTCATTTAAACAAAAAAATAGACGAGTTAAAGAAATTTCT
AAAGTCTCGAAAAACCTTTCTGAAACTTCATGACAAAAACACTGAGGAAA
TTGTTGATTTATTTGAAAAGCTGGGAAACTTGGAAAAAGAGGTGAAAAAT
CTCAGTGAACGAATGGCGAAAGAAGAAAAACTGTTTGATAAAGCCAATCG
AAATTGGAAGGAGTTTGAGCAGAAAAAGAAAGCTCTTGAAGCAGCTATTG
ATAAAAATGTGTTGAAAATCAATTCGATGACGGTGAAATATTTGACAGTT
CCGGGGTTACAGTTTCTTGATAAGGAACTTGAAGGAATCGAACATAGTAC
AATTGAATTGAATTCCGAATTGGATTGTTTACAAGCCACAATCGAGAGAT
TGTATGAAGGGAAAACTGTAAAGTGTCAACAGCCAGAAAATTGTTTGGAT
AGCATACTCCGTAACTATAAAGACCTTTCAATGATTCTCTCGGAAAAAAG
GAATTCCTTTAATTTTCTAAGTCACAATGTCAGTGAAATCGAGTCCTGTT
GGTTGAGAATCTCAAACCTCATAAAGAATTCAAAAGACGCATTCAAACCT
AAAACTCCTTTTAGCAGTCTTTACGAAATGGAAATGTTTTTTGAAAATTC
TAAACAGAATTTTCAAAATACTAAAGAACTCCTCGATAAAAATCTCAATT
CCTTGGAAGAAGGCCTAGATAACCTGAAACAAATCACTTATTGCGATATG
AAAGCATTCAATTCAATTTCAACCAATCAAAACCGAGTAAAAGGCGAAGT
TGAAAGTTTTTCATGTTTAATGAATCAGTTTATGGAAAAATTCTTTATTG
AATTGAAAAGGTTTCAGGATCTCAACGAAAAAGTTATCAAATTAACAAAC
GAAACAAATAGTCTTTATGAGAATTTACACACGATCTCCAATGGTAGGTC
TTTTTCAGAGACAACTCAAAGTTCTATTGATGATGAAGAAGAAAGATTGA
ATTCCCTTCAAAACTACCAACTAACAATAAAGGATTTACTCAAAGAATCT
TTCCAATTCTGTTCAATAAAACCGTTCCAAGATCAACTGAATGTTTCGAT
TAATACAAGTAAAGACTGTCAAAATATCATTCAGTTACTAAAAGAAAAAA
GAAAAAAAATCGAAAAAGAAAAAGAAAACATTTCTACGAATGTTCAACTT
TTGTCAATGAATTTAAACAAAATTTCTAATAATCTTCAGAATAATAGTTT
GTATCATTGGAACGATGATTGTTCTCAACTTGGAGAAGTGAAGAATTATG
AAGAAAATCTTCAGTTGATTTCTAATGATTTGGAAAATTATCAAAAACTT
TCGAAAAATCTTTTTCTTCAATGCGAGGATAAAGAACTCGAGAATCTGAT
TTCTAAAATAACTGACTTGATGGAGAAAGCCACAGGGGTAGGAGCTAATG
TCGATTTGGTTAAAAGAGACATAAACCGAAGAATCTCTCAGAATTTCAAT
CTAGCAAAAGACGAGCACGAACGATGGATATCCTCTACAGTTTCTAAAAT
AAACGCATCAAAGTCTCCGTCTCAGTTTCCTAAAGATATTGCCAGTGATT
TACAGACTGTTAACGAGTTGATTTCCTCTCTCGATACCGGGGAAAAGCTC
GTAGAAGAAACTATTATTCAATCTAGAGCTTATCGGCAATTAGATTCCGG
AAACACCACTATCGGTGTTGAAAGAGAAGACGCCGATAAAAGATCCTTGC
GCGAACGATTCCAGTCCATTGTATCGGAGATCTTCCTTCAAAAGTCCGAT
CTAGAAGTCGCTCTAAATGAAGTCAACAAACAGCAAGATAGTCTTCACTC
AATCGGAACCGCAGTAGACAACAATCGAAAAAGATTTTCTGCAGTCACTA
AACCAGCAGTTTCAGACGTTGAGTCAAAACATGTGAACTTGAAATTCATG
GAGACTATCCAGCTAGCAAATAACGATGATATTGAACGACTGACGAGAAT
CAAATCTGAGACGAAAGATATTTCAGTAAAGAATAATGCCAATGAACTCG
AGAGGGTTCTTAAAGAATTCGACTTTGACATTCAAGACAAAACTTCTCGT
CTGTTGAAAGATATAAAGCTTCATGAAAGCTTACTGTTTGATCTACGTCT
AATCGAAGGTGAAACAAGAGCTAAAACCGATCAAATTCACGCGATAAAGT
CTACATTATTAGTCGATTCAATATATATAATGAATCTCAAACAAAAATTT
CAAGAACTGGAAAATTTCACCGAAAACATTCTTTCAAGACAAAATACTTG
TGTGAAAAATTGCGAAAGCATCTCTATTGAAGGAGTGTTTCCCAATGATA
TCGTTGAGCACATTAAGGCAGTGCAAATCAATATTCAGCATCTAAACAAG
CAAATGTCGGTCATTGAGCAGGAATGTCAGTCATGCGAAAAGAATTTTGA
TGAATGGAATAAGATTTATACTGAAAGCAAAGATTTAATGAATCAAATCG
AATGTTCAATAGAAGAAGAATCTCGAGCTTCAGAAAATCTCATTGAGAAA
GAACAAAAATATAATCTAGCTCTGTCAAACAAGGATCGATTGGAATCATA
TAAAATCAATATTCTCAATCTCGAATCTATTGCCAATCATTTGAAGGGCA
ATCAATATAGAGTGCAAATTGATGAAATAAAAAATCGTTATAAACAAGCC
ATTAAGCACAATTCCAACAACATTTCCCTTCTCAATAAATACTATCAACG
TCACAGAAATTATATTTCTAAAATTACGGATATCAACAATTCATTTAGCT
TCTTTGCAATTGATAATTGTGAAGAAATTCATTCAAAATCGTTGAAAAAC
TCTATGAAAAAGCTGAAAACGCTAAAAGCTAAATTGATAGAGATAAACAG
TGAGATAAAAAAATTAAAATCCGAAAAGGATATTTTAGCCAAAGAAACAA
CAGAACGGGGAAAAGAAATCCTCGACAAAGAGTTTTTAGAATTAAATGAT
AAATTAATGAAATTAAATTCGAATTGTGACGGGGAAATTGAGAGAATAAA
TTCCCAATCGATTTCATTGGACAACGCTAAAAAACTGTTGAAACAAATCA
AAAATTGGCTGATTGAGCGAAAGAGACTGTTAAATCCTTTCGCGGCTTGG
AATGTCGACGATGGCATTAGCGCGAGGAAATTGAATGAGATTCAGACCTT
AATGCTAGAATTTGATCCAAAACTCAATCAATTATTGGAAATCGATAATG
TCTGTAATTTCTCTTTCATAGAAGCAAATGAATTGATCTTCAACAAAAAT
GAATTGCAAATAGAGTTTTCAGAAATGAAACGAACGATGGAGAAACTATT
TGCCGATGGAAAGGAAATACAGCAATTGACATGCCAGTGTAAAGAACAAC
TGAAATCGTTGAAAGAATCTCAGGAGAACATAAAGTCCAAACTCAATCGA
TCGGAAATTATATCAAAGTTAGAGAATGAAATGGAATATTTTCTCAATTT
ATCCCGCACAGTTGACGAGTTTGACGAGTCAATAAATCGGCCGAGAGAAA
TTCTTAGGACGCTTTCCCAGTTTGAGTTGGCCAGTGAAATTTTCAAAGGT
TTGTCAATGGATCTGGAGAAAATCGAAACCAATCATAGATTTCATCGAGA
TCAAATTAAAAGCAAAATGGAATCGTTGAATGAAAAACAGAAGATTGGTG
AGCTTTTCAAAGCACAAATGAAAGTTGTTAGTAAATCTATGGATACGGTG
CTACTGATGTGCAATAGCATTGGGGAAAAGGAAACTCCGACTGGGAAGTT
AGAAAAACTTGAGGAAATTCTCAACAAAATTCTTGATATTAAACCGGATA
TTGATGGACTGAAATCGTTGGCAGTTGATTCCGGTTACAGCACTTATCTG
GATTCAGCAAACAACATGGTCCAACAGTATGACAGGCTTTTGCAAAACAT
AAGAAAAGACGAATCAGTCTGTCAAGACCAACAAGAGATCTGTGACAGAT
ACGTCCATTCCCTAGATCAAATAGTAGCCGAAATGGATGCCAACAGCTTC
ATAATATCAGATCTCTGTTCAAAAGGATTCAATGATATCGAAAACGTCTC
GAAATCGAAATTGAAAGCGGAAGAAATTCGGAAATTAATATCGAAAAATC
AAGACCAACTGTTAAGACTCAATCAAAGTTTTGAAAAGAAAAATAATCCT
TTCTTGGCAACCTTGAATAAAGATGAATCATCCCAAAGTTTGTCGGTGAA
AATGAATAAAAATCACCAAATGTTGAATGAATATATTGATAAATGTAATG
AAGAACTCGACTTGGTCTCACAGTATACCAAGAAATCAGAAGAATTAGAA
ACCTTAATTAATTTTATTAATTTAAACTTAATTAATATAGAAAGATCAGG
AGATTTCAGTGAGACAAACTTAAATAAAATTAAAGATTTAAAATCCAGTG
CAATAGTAAGTGAAAGTTTACTTGAGGAATTAAAGAACATAAGTGATTCA
TCAAATCTCCTTAAAAGACGGTCAAATTTGAAAGTAGATCACAACAAATG
TGATAGCAGACTAATAGAGATCAAAGACCAATCTAGTAGACTATATTCCA
AACTCACGCGTCAAATTGCAGCGATGGAAAGCCTTGAAAAGTTAAACCAG
AACTTCTCTGAAAAGGTTCAAGAACTTCACGAAAGAATTAACAAATCAAA
CGGGAAAATATTAAATACTGGACTAGTCAATACGCTAGGCAAAACTCATC
AGGATCTTAGTTCTATTCAAGACAAACTGGGAGAAATATTAAAGAATGAT
ATAGACAAGCACAATGACAGGTACCTAGAACTTACTGGCAGTCATCGAAA
CCGCACTAAGCAGATCCAAATGCTGGAAAAAGACTTATTCGAATGTCAAC
GAAAACTAAATCATCAAATCGAGAGCATGTCCAAATTTAATTCTCACAAA
ACTCTCATAGAAGACAGCATCAAAAATCTTGAAATAAAGTTCCAATCTCT
AACTAATCCCGACGATTTCGTGTTCCTGCAAACCAATGAAACTTGCCTTC
GAACTCTGTTGTTTCATTGTGAGGAGATCGAGCTGAAACTGAACGATCTG
AGAAATGAATCCCTCGACAATAAAATCTCGAATTACTCCACAAACCTTCT
AGATTTCTCCCATCAGTTCAATACAAAATTAGATTTAATTAAAAATGAAA
TTCAAGTCGAGTTGAAAAGCTACAAAATGGCAATTGATGAACTAAAAGAG
CATCAGTATATCATTCAATCTGTCAAGCAATTTTTGCATCAGTCTCAACA
GAAACTGACGAATATCTCAATTTCAAGCGACAACATCCATCAACTTGAAC
ATGAGCTACAAAAGATTCAGGATTTGCATGATTCTTTCAACAAAAACTAT
TTCCTCATTGTTGACTGTTCAAAACTTGATACTTCGAAGCTTCGATGTCT
ATCCGATAAAGCCATCGAGACTTTTCAACAAGAAATTGACCAGATCAACC
ATTTCTTTCAACAGTTGAAGGAGTCGATAGAAAATACGAAAGATATACTC
GTAAAGAAATTAAAAGATATTAAAGAAAAGGTAAAACGTGAAGATAGATT
TAAACTATGGCTTAAAAAGGAAGAACGCACTTTAAAGATAAATGATCATA
TATTCAGTGAACATGAGATTGATGGAGAAATACAAAGACTACATGGAATT
CTAACGGAACTAGTAACCAAACAAAATGAAGTATCGTTTGTATCATCTAC
ATCTGAAGGAATTCCTGAAATAATAAATCCAGATATAAAAGAGTTGTGTG
AAAACTTTTCGGACAATGCAAAAAAAAGAATAGTTTTACTTGAAAAATTG
TCGAAAGATTTTGACGTTTTCAACAAATTACTGAAAACCTGGACAAACTG
GTACGAAAACATTGCGGTTAAACGGAAGCAAATGTTATCAATGCCGGATT
CCAGTGGTAGAGACTTTGTCAAGTACCTATTGAATGAGAAAACTCATTAT
TTTGATTTGATTTTATCAATTGCTTCGAATGGAGAATCCTTCCTGCCTTA
CTTGACTGCGGAAGGACGCGATGTTGTTAAATCGACTATGAAACGCATGA
AAGAGCAATGGCATGAAATTTTCGACGATCTTTTAACTCTATTGGAACGT
TTTGAAGAAAAAATCAAAAAACTCGAATCTTTTAATGAGAACTATGAAAA
TTGTCGAAAACAGTTTGAAACAATAAATTTGTCGTTGATTCAGGAAATCG
AAACCAGGGAGCCAGTGAAACTCAATTTCCCTATTGGAATAGAAAATAAG
GAAAGGCAGTTACAAAGATTGTGTGAATTTAAACAGAACCTAAATGCGTT
GAATAATAGCATTCAAAGATTGGAATATATTCTCGAATCAGATATCGATG
GCATATTAACTGCTGAAGTCAATGCTCTAGTTATAGAGTTTCACTTGTCT
AAAGAAATTGTGGATAAAGCCAAAGAAATGTCGTTAAAAAGTTATCAAAA
TCATCAAACATTTGAAGCTTCGTATTTACAAGTTCAGGATTATGTGGCTA
TGATGAATAAAAACGTATCGATATGCAAAACTCTGGATGGAACAACAAAT
TCAATTGAGGCAAGAATGGAGAGAATTCAAACCGTTTTAATGAAAGAATT
AATGGATATGGAACATCAAGCTAATCATGTGATCAACCAATTGACTCGAT
CTTTCAATTCCGTTCTATCCACCAGTTGTGTAGTCGAGCAAAAGATTTTC
AGAGAGAGATTTGAAACGATCATTAAAGAAAAGAAAATGTCAGATGATCT
CTTGAAGTCAACCCGAACAATACTGGAAATGGCCTATAAAAATCTAGAAA
AATTCAAAACCAAATTCGGTTCCCTGTCGAGTGAGGTTTCAAATTTAACC
AAAGAAATTCAGTCCATTGACGATTGTGAGATTCTCGTCATCGAAAAATT
AACTGACGCAACAAAATCCCTCTCAAAAAGTTATAAAGATCTTCACGATG
AGGCACTGGAAATCTTTCAAGCGACAAAAAATCAATATCCACTAGAAATG
TGCAAATCGATAGAAAATCAACTGGAAAAGTGCTCGAGGATGTTGGAAAA
GAATCGATGGAAATTGGATCAATTATCAGTTCTTCGAAATCAATTTGATG
TCGAGGAAAAAGATTTCAGTGACATTCTAAATTCATCTTTGTCGAAATTT
TCTTCTACTCAATATCAATTTGATTTGTGTGGAGACTTGAAAGACTTCTC
GATTGTGGCGACGAATTTGAGCGAGATTGAAGTGCAAATTCGAGATTCGG
AATCATCTATCGAATCGCTGAAATTATTATTCCATGAAATAGGGAGACAA
TTTCCCAATTATTCAAAGAAAATTGTAAACAATTTCAGTTCATTAAAACA
AAACTATGAAAAATTTCTCCGTGACTTCAACGGATTTAAAACTCACTTTC
AATCGATTTTTGGAGCATCCAATGAAATCAATGAAAGACTCGCAGAATTC
AAATCCGAATTTGATTTAATCGATTTGTCACAATTTCACTTTGTGCCCGA
TGAGAAGGTAAAGAAATTCAAAAATGTCAATGATTTAAACACTTTGAAAA
TGCACTTGATCTCGATCATAGGCGAGATCAATGAAGTCGATATCAGATCA
ATTTCACATCAAAAAATCAAAGAAAAATTTGAAAAAATTAAAACAACTCA
ATTGAAATCCTTTGAAGAATTAATGTTTGATGCTGACTGCCGATTAAAAA
CTGTTAATGACGTCCTAATCAATCAAGAGCAATTGGAAAACTTTATCGTC
TCCTCGAAAGAATCTTTGAATTCCATCGAATACTCAAAGGATCGAATAGT
CGTGGACTTTTCTGTAGATAAGACTCATTTCGATGAAAAAATGAAGGAGA
TAGATGCAAATCTTTCATCTCTTCAAGTTATTAAAAGGTCGATCGAAGAG
AATTTATCCAATAAAGTCCCGGGATGTTTAAGTGAGATCGGAGAGTTGAA
AACCTTAGAAAAGGAAAGAGAGAAATTAAAAGTTGATTTAGTCGAATTCA
AAAAAAGATTAAGCAGCGATTTTGAATATTTTATGGCCCTTGAGGATAGA
ATTGGTAATACAAGGAAAAGAATGAATGATCAGAATGAAGAGATCCTCGA
CTTGAATGAAAATGGAATGTCGATAGAGGATAAAAGATCCCGACTTGATA
AAGCTTTTAGCTTGAAGAAGAAAATCAGTGAAATAGCAATAGAAATTGAC
GATATCAAAGAAATTTTATCAACCAAAACCTCCGATCCGATTTTCAACGA
AACATTGATTCGAACTATAAAAGGTCTCGAAACACAGAATAAAGAACAAT
TGGAAAAAACTGAAAAAATCATCAAACATCAAAGCTTGTCAGTTGAAGTT
GAAGAAAAATTTGAAAGTCTTTATCAAGATTTGATAAAAGAACTCCGAAA
GGTAAAATGTTTATTTAGTAATTTCGATTCCAATCAAACCGATCCATTTG
ATCTTCCAACCTTGGATGATTTACAAGACTCGATTTTGATTCTAAACGAC
CTTGGTCGAGAAAGTAAGCTTTATTCCTCAGCAAGTTGGAAGGAAAACAT
TGCCAAGAAATTGGGTCACATTGACGAGAACTGGAAAAAACTCGAATCGA
CCCAGATCCAATTGACAAAGAAAATTGAACAAATCAATTTGAAGATTGTT
GAATCCAAAACCCAACGAAAGAATTTAATTGAATCTTTGGAAAGTCTCAA
AGAAAATTCCACAACTTTTCTAACGGATAAACCTTTTACTGTTGTGAAAA
TCCAACACAAGATTTTTCAGTTGAAAAATATTCAATCTCAACTAAAAGAA
TGGAGAAAAGAAATGAATTCGATGAAAGATTCCAAGTCCGTTGATAACGG
AAATGAGCTGATGAAGAAGTTTCGAAAGATCCAAGATGAAATTCATTTTG
AAATATTAGAAACGAAATTAGCGTTGGAATTTCTGTTGGATTTTGATAAG
GAAATCGACGATTTTACCAGTTGGTCTTTGACAATGGAGAATAGGATTCT
AGTCGTTCCAAGATTTGATTCTTCGGCAGATCAAATAGGTTTAAGGTTAA
AAGATGGAGATTCAATATTATCCCAACTATCTGATGGAAGGAATAAAGTT
TTACATATAAAAGCCATCAGTGAAAATTTATTATCCCATTTATCAAAGGA
AGGACAAGGATTTATTCAAGAGACTTTAACTCGAGTTTCGGATAATTACC
AACATCTACAAGAAACTTTAAAAGATAAATTAAAAACTCTAGAACTGGAA
AAGACTCGATTTGAAGAATACGAGTCAAAGTTTAAGGAATTTTTAAATTG
GTTAGTAAGTTATGAGAACCTTTATAATACCAAAGTCTCATCGTCGTCTT
TGGAAGATAAACAAACAAGCTTGGCGCAGTTTCAAAGCAACCTTCAAAAC
ATATTTGAGCATAAATCGAACTTAAATGAATTAATCGAAAAAGGCGCCAA
ATTTCCGCTGAATTTCTCCATCAAATATAATACGAAGGACATTCAAATCC
GATACCCGATTCTGTTGAAGTCGGCCCAGAATCGCATTGAATATCTGGCA
AAGTCCGTGGAAAACCACGAAATTTACGAAAAGGATAAGTCAACATTTCA
AACCTTTTGTCAGAAATTCAACTACGAATTGAAATCATTGAAGGAAGAAA
AGATGGAAATCGGAAATTTGAAAGAAATCTTTGCAAAGTTGACTGCAATG
GACATAGAAATAAGAAAAATGGAACAGTCAAGATCTGCACTTGAGGTCGG
GTTTAATGTTGTGTTGGTTGAGACGAGTGAAATTGGGAAAAAGGAATTGT
CAAGTCAACATTTAGGTCTGTTGAAGAGTTTTGAAAAGTTCCTCATAGAT
TATGATGAATTTAAATCTTTGATTTCCAAAGAAAAAAAGACGGAAAACAA
TTTTATCAAACAATTGGAGCATTTCTCAATTGGCTTAGAATCATTGATTC
AAACGATGCTTAACCTCAACCCCTCCTCTCAAATCCACATTTCCTCATTA
CAGAATTGCCATGAAGGACTGGAAAAATTTTCAGAAGAACTCAAACGAAG
GTCTTCAAGTTTCGATCAATTAATCACAAATTATGACATCAACAAGAGTG
AAATAGTGTCAGACCTGATCACGACTATTGATACAGAGTTGAAATCCGCT
TCAAATAGTTTAGCTGAAAAACGAGCCCATGTAAATTTGCTGTTGGAAAC
AAACCAGGCTTATCAAGAATATTTCGACAGGCTCAGTAATTGGCTGTCAA
ATACATATTCGAGGATTCAAGAGTCTTCTGACTTATATGGTCCCCAGTCG
GTCATTTCTCAAAGATCTGACAATCTTAATCGCATTCAATTGTCCATTCA
AACCGAAGGAGAAACTCTATTGAAAGCTGTCATTGAAAGAGCTGACGAGT
TGAATAGGATCATCCTTGATCGTACAAATAAAGAAAAACTATCCGATCAA
GTTTCAAAATGTCAAGGAGAATTTTATAATGTATCAAATAAACTGGAGAA
TATTAAAACAAAAGTCAATGATCTGGAGACTCAATGGAAAAACTTCGACA
CAAACATTAAACTTTTGAATAAAGTGAATAAAGTATTTGCTAATAGAAAG
GAGAGATTTAGAAATATGAAATATAGTTATTTTCTTAACATAAATGCAGA
AATAGAGAAAATATTGGATCTAGTCAAAGATATTGAAGAAGAAAAGTCAA
ATTTAGAAATATTTTCAAATCAAATCCAATCTTTGATAGATGTTTCCCAG
GAGGCTCAACTGGATACGATCTATCAAGATTTAATAGATCAAATAGATGG
ACATGAAATCGATTGCAAGTCTCTGCTGGATATGATGCGGCAAATGGGGA
ATGAGAAATCCGCGTTTGACCAGCAAGTGCAAAACACCCAACTCATGATA
GACGCCATGAAAGCGCAACTGCTGCCAATTGATCAACTGCATAATATTGC
TTCATTCAATGATTATCAGAAGATTTTTCGAGAATTTCAATTATTGGAAT
CAAAACTGATCGACGGGGATCGAATGGTGGACGAATGTTTTCAGATGTTT
TACAAGCTGTCCGTTTTATTCGATTCGGAAAAGGCTTTAAACGACATGAT
TTCCCTACTTAAGAAAAACTGGGATGGACATAAAGAAAAATTCGACGAAG
TGAAAACCAGAATGAATCGGCTGTTAAATTTGTGGTCGAATCTGGAAAAT
TTGAGAATTCCAATTGAGGAATGGATTCAAACCACCGAAAAAGAAATGGA
AGCAATCACTTGTGAAGGGTATCAGAGTACGGACGCAAATCTCAAAGCAT
TCCTTAGAGTGAAAGCTAGGAAAAATGAATCCGAAACGATCAAACCGAAG
CTGTCTAAATTCATCGAACTATTTTACAAAGCGGATATTTATCCTGGATT
TTCAAAAACTAAAGATCCTTTAGTTTTGCAAAAGGTTTTCTGTGAAAATC
TAGACAAATTAATGAAGTTGGAAAAGTCTCTTTCAACTACCCAATTAAAT
GTGGAAAAATTGTTGCGGGAAATATCGGATGCCGAAAAATGGGTTATCGA
AATGTGCCTGTTGATAACAAGTGAGCAGCAGAAAATTCCATTTGCCAACA
GTTTACTTGATTTGAAAGACCGCGCCAAATTGTGTAAGAATCTGAAAATT
CAGATTGAAAACTTTGGAGAGTGCACTATTGGTTTATTAAATAAAAACTT
TCAAGATATTTCAAGATTATTTATAAAGCCGAGTCCTCTGAAAAACGATA
TATTTGGCAAACTCACATCTCTTGATCAAGGAATGAAACAAATGGCTTCA
CTTACTGATAAATTAAAAGCAAGCATCAAAGATAGATCGAGCAATATTAA
ACGATTTGGAAGTATTATTGAAAGCGTTGAAATATTTCTCTACCGAAAAT
TTCCAGAATGGTGGATTGGGAAAGAAGTCGTCGCAACAATTAATCCCGAA
GATTGTCTTTCGCAATTATCAGATGTTTCAGCGATTTTAGAAAATGTTCA
AGTGTTGGAGGCTGATTTTGAACAAGTATGGCAGGATAATATTCGTCAAC
TTCATTCAATATCTCCTGCGCATTCTCATAATGATGGTAGAGACACCTTT
TTCAATGATAGCACGTCCTATATTAATTCAGAATTCACTAGCCTTGATGA
TCATCTCGACCGTGTTAAGCGTGATCTGAAGCAAACAAAGGATTGTATTG
AAAGGCGCCTGGAAGACCTGCAGGGTCATTCACATGAATGGAATCAAATT
GAGTCAGAAATATCTGAATTGACAACCGTTTTTATTCACCAGAAAATGAA
TTTGAAACAAACATTTGCAAATCTGACAAATGATGACATCCTTTATGAGA
GATTTGAGAAGTCTTTAATAGAGCTAATTGAAAAAAAAGATATTGTGGAT
AAATTGGATCAAAGAATAAAGCGGTTAAATGTTTATAGAGACCATGAAAG
CTGGAAGTATGGCAAATACTCGCTATTGAATGAAATTTACTCGGATTTGT
TGAATGAAATGGTAGCCGTACGGAAGTCATTGCGGGCAATGGATGTACAC
GACCTTTGCCAGGAGATTATGGCCGGAGAGGACATGAACGACTTCTCTCA
AAATGTATCAAAACAAGACATATCATTGATGTATCCTCAGATTGGAACAC
AAACTAACCGTAATAAAGCCACATCTATCCAGACAATCAAAAGATTTTCA
TCCAACCCAAACTTGCGTTCATTTTCATCCGGAAAACCTAGTCAAAATGA
AAGAGACTCGTCAGATTCTGGTCCAGTGTTTAGCAGAACTAGTCCGTGTT
TTGCTCAGAAGTTAGTTCAAACTGTCAACGACATCGGAACTCAGCACTCT
AGGCCTTCAAAATCTCACAAAAAATCGATAAACACTTCAAATGAGTACGA
GAAAATTTTAACTAAGGAACAAAAAGATCGGCAGTTCAAACGGTTAAATG
AATTACTGGAAACAGTTAGACAGATTAAAGAACAAATCTCCCTCTCGAAT
TCATCAATGTCGATTCGTAGTAATAGATCTCAACAAATGAAATCAAATAA
TTCACTGCGCAATTCCACTGAATCTATTCGACATAATCTTCTACAGCCGA
AAAACAAAAGAAAGAAATCCCCACAAAAAAATAATCAAATGCGGAGTTCA
GTTGAATCATTGGGTAAACGGCCGTCCCCTACCGGTTGCACTACCCCAAT
TTCCTTTCATAGAGAATCACCAAGGAAAATGCGTAGCAGTCCAAGGAAAT
CTCCAGCAAAGCGCAATTCAAAAATTGCACAATTTGCAAATTAATAATAT
TTACAATGACTCTCAATTGAGAGGGTTACACTCAGATTTTATTTATATTA
CTGACAATAATATTTTAACATATTTTTTTAATTATTTTTATAAACATATA
AAATGATAATTTGTGCACGATTTAGTAAAGAAATAT
back to top

protein sequence of SMED30035723-orf-1

>SMED30035723-orf-1 ID=SMED30035723-orf-1|Name=SMED30035723-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=922bp
MSNKFSVNRFQIFQNPPSRVPRIYVDSIKSRINIISDKCPELSAYFELFG
LFRAATDKHLELQNKIKFLKSGFESFQILVDKYEELKSLVHGEDTESLKV
HLKQISESSSKIVKGFISKDISRQMILNQTNQKINDVVKSTLKEIEDILS
NQNSLLNKWKKYNEKKDDLIKWISQAKSALKLDKSKRDEFFAANFKLNYQ
SFVEEKNHFSSSDPDCIRFIENEFEMINESWNSIVKEIELKRQFENIFTL
KKEYNERIERIENWMSKSETIADRKTTCERAELEENLDILEAAAKNFETV
KIDLQKAAKIGESMFKSNLMESDTEEILGKLQIHKDRFVIVRDKINKKLK
ILKKLILVMTVFRRNSAELNKWLESAENNLLCNFETGNDEDFHDWISEHE
KCFEGNYHLVLDGKINENAKILQRILEQVEEDVDTKLIEDEMENLTERVQ
ICFKNSLGIRNQKEFEHFRDKLKKLLNETRDQIMEEETQLNLNKDFSQVL
FMHENYFDNGKIQTKCNELLNSLKLVNIHLINGGKGSLPVDYHNERNNME
YEVDLVFERVATIHSSLLTIPHMLKEFDNLLSNLVDWMSKVEDLSSQLEI
YDPMSHHDSTDCNNSIDIENNITFEEYDKTLTEFQRLYDFTETHLKDGEH
LTKLLSDIQKASPYLSLEDEKLNLDIALSKCNEIEPKISNTQKIAPIIAE
SIAFKAKQMKVKKRLLQIKMDLEKIEEEEICEIENIYEKEQILQQTFAVE
TPNIIREIEKEQKIVADFETINLKPVLSKVLEEEWKMLNELKEEKLEKLK
EAKEMLVEIESNSNNLQADIANFEGELKLLKEEIPAQFDFDGSVEKLKGF
LENFEDKIDNKVFHYESSVNEAHKTLHLGKDIELDKERVKLKSIINSIKE
SASKEINNLHLKKEIIINQIK*
back to top

protein sequence of SMED30035723-orf-2

>SMED30035723-orf-2 ID=SMED30035723-orf-2|Name=SMED30035723-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=4855bp
MKSKYSLLDLLKTDDLEEDSIFEKVNQIVEKIMKDSKDSEDIVHTLQKNI
QIYHENFNKILERQQNLGERTKLLLENVKGFKSFNFTVVQWESLNRKNIL
NPFQNELKILQTEIHEKLEREVLNLHPPNQAVLFNFDSLISDLKFIGNLI
NEENENIENGSNFLSKNRDIQIGFAQSIKSISDHFSECRLDRMSTFEKQI
FNFENIKDGIIEALQFNENQQMKIDQENITFNPSTLNQMKSEIINNANHL
QRNLDECIELIDSRQTQRHSMDNILDQLLQQVKEIENFETFVKDLKIIFG
ESSIIENQLIQIKNDLNSINKPKIEKLSKSIDSLLKLTKDENLVQSKNQV
KDLQTKLESIERQVNENFDFNKWSESVYRFFSEIITELENNNKNFLQISE
SNIRNSKQNLVHLNKKIDELKKFLKSRKTFLKLHDKNTEEIVDLFEKLGN
LEKEVKNLSERMAKEEKLFDKANRNWKEFEQKKKALEAAIDKNVLKINSM
TVKYLTVPGLQFLDKELEGIEHSTIELNSELDCLQATIERLYEGKTVKCQ
QPENCLDSILRNYKDLSMILSEKRNSFNFLSHNVSEIESCWLRISNLIKN
SKDAFKPKTPFSSLYEMEMFFENSKQNFQNTKELLDKNLNSLEEGLDNLK
QITYCDMKAFNSISTNQNRVKGEVESFSCLMNQFMEKFFIELKRFQDLNE
KVIKLTNETNSLYENLHTISNGRSFSETTQSSIDDEEERLNSLQNYQLTI
KDLLKESFQFCSIKPFQDQLNVSINTSKDCQNIIQLLKEKRKKIEKEKEN
ISTNVQLLSMNLNKISNNLQNNSLYHWNDDCSQLGEVKNYEENLQLISND
LENYQKLSKNLFLQCEDKELENLISKITDLMEKATGVGANVDLVKRDINR
RISQNFNLAKDEHERWISSTVSKINASKSPSQFPKDIASDLQTVNELISS
LDTGEKLVEETIIQSRAYRQLDSGNTTIGVEREDADKRSLRERFQSIVSE
IFLQKSDLEVALNEVNKQQDSLHSIGTAVDNNRKRFSAVTKPAVSDVESK
HVNLKFMETIQLANNDDIERLTRIKSETKDISVKNNANELERVLKEFDFD
IQDKTSRLLKDIKLHESLLFDLRLIEGETRAKTDQIHAIKSTLLVDSIYI
MNLKQKFQELENFTENILSRQNTCVKNCESISIEGVFPNDIVEHIKAVQI
NIQHLNKQMSVIEQECQSCEKNFDEWNKIYTESKDLMNQIECSIEEESRA
SENLIEKEQKYNLALSNKDRLESYKINILNLESIANHLKGNQYRVQIDEI
KNRYKQAIKHNSNNISLLNKYYQRHRNYISKITDINNSFSFFAIDNCEEI
HSKSLKNSMKKLKTLKAKLIEINSEIKKLKSEKDILAKETTERGKEILDK
EFLELNDKLMKLNSNCDGEIERINSQSISLDNAKKLLKQIKNWLIERKRL
LNPFAAWNVDDGISARKLNEIQTLMLEFDPKLNQLLEIDNVCNFSFIEAN
ELIFNKNELQIEFSEMKRTMEKLFADGKEIQQLTCQCKEQLKSLKESQEN
IKSKLNRSEIISKLENEMEYFLNLSRTVDEFDESINRPREILRTLSQFEL
ASEIFKGLSMDLEKIETNHRFHRDQIKSKMESLNEKQKIGELFKAQMKVV
SKSMDTVLLMCNSIGEKETPTGKLEKLEEILNKILDIKPDIDGLKSLAVD
SGYSTYLDSANNMVQQYDRLLQNIRKDESVCQDQQEICDRYVHSLDQIVA
EMDANSFIISDLCSKGFNDIENVSKSKLKAEEIRKLISKNQDQLLRLNQS
FEKKNNPFLATLNKDESSQSLSVKMNKNHQMLNEYIDKCNEELDLVSQYT
KKSEELETLINFINLNLINIERSGDFSETNLNKIKDLKSSAIVSESLLEE
LKNISDSSNLLKRRSNLKVDHNKCDSRLIEIKDQSSRLYSKLTRQIAAME
SLEKLNQNFSEKVQELHERINKSNGKILNTGLVNTLGKTHQDLSSIQDKL
GEILKNDIDKHNDRYLELTGSHRNRTKQIQMLEKDLFECQRKLNHQIESM
SKFNSHKTLIEDSIKNLEIKFQSLTNPDDFVFLQTNETCLRTLLFHCEEI
ELKLNDLRNESLDNKISNYSTNLLDFSHQFNTKLDLIKNEIQVELKSYKM
AIDELKEHQYIIQSVKQFLHQSQQKLTNISISSDNIHQLEHELQKIQDLH
DSFNKNYFLIVDCSKLDTSKLRCLSDKAIETFQQEIDQINHFFQQLKESI
ENTKDILVKKLKDIKEKVKREDRFKLWLKKEERTLKINDHIFSEHEIDGE
IQRLHGILTELVTKQNEVSFVSSTSEGIPEIINPDIKELCENFSDNAKKR
IVLLEKLSKDFDVFNKLLKTWTNWYENIAVKRKQMLSMPDSSGRDFVKYL
LNEKTHYFDLILSIASNGESFLPYLTAEGRDVVKSTMKRMKEQWHEIFDD
LLTLLERFEEKIKKLESFNENYENCRKQFETINLSLIQEIETREPVKLNF
PIGIENKERQLQRLCEFKQNLNALNNSIQRLEYILESDIDGILTAEVNAL
VIEFHLSKEIVDKAKEMSLKSYQNHQTFEASYLQVQDYVAMMNKNVSICK
TLDGTTNSIEARMERIQTVLMKELMDMEHQANHVINQLTRSFNSVLSTSC
VVEQKIFRERFETIIKEKKMSDDLLKSTRTILEMAYKNLEKFKTKFGSLS
SEVSNLTKEIQSIDDCEILVIEKLTDATKSLSKSYKDLHDEALEIFQATK
NQYPLEMCKSIENQLEKCSRMLEKNRWKLDQLSVLRNQFDVEEKDFSDIL
NSSLSKFSSTQYQFDLCGDLKDFSIVATNLSEIEVQIRDSESSIESLKLL
FHEIGRQFPNYSKKIVNNFSSLKQNYEKFLRDFNGFKTHFQSIFGASNEI
NERLAEFKSEFDLIDLSQFHFVPDEKVKKFKNVNDLNTLKMHLISIIGEI
NEVDIRSISHQKIKEKFEKIKTTQLKSFEELMFDADCRLKTVNDVLINQE
QLENFIVSSKESLNSIEYSKDRIVVDFSVDKTHFDEKMKEIDANLSSLQV
IKRSIEENLSNKVPGCLSEIGELKTLEKEREKLKVDLVEFKKRLSSDFEY
FMALEDRIGNTRKRMNDQNEEILDLNENGMSIEDKRSRLDKAFSLKKKIS
EIAIEIDDIKEILSTKTSDPIFNETLIRTIKGLETQNKEQLEKTEKIIKH
QSLSVEVEEKFESLYQDLIKELRKVKCLFSNFDSNQTDPFDLPTLDDLQD
SILILNDLGRESKLYSSASWKENIAKKLGHIDENWKKLESTQIQLTKKIE
QINLKIVESKTQRKNLIESLESLKENSTTFLTDKPFTVVKIQHKIFQLKN
IQSQLKEWRKEMNSMKDSKSVDNGNELMKKFRKIQDEIHFEILETKLALE
FLLDFDKEIDDFTSWSLTMENRILVVPRFDSSADQIGLRLKDGDSILSQL
SDGRNKVLHIKAISENLLSHLSKEGQGFIQETLTRVSDNYQHLQETLKDK
LKTLELEKTRFEEYESKFKEFLNWLVSYENLYNTKVSSSSLEDKQTSLAQ
FQSNLQNIFEHKSNLNELIEKGAKFPLNFSIKYNTKDIQIRYPILLKSAQ
NRIEYLAKSVENHEIYEKDKSTFQTFCQKFNYELKSLKEEKMEIGNLKEI
FAKLTAMDIEIRKMEQSRSALEVGFNVVLVETSEIGKKELSSQHLGLLKS
FEKFLIDYDEFKSLISKEKKTENNFIKQLEHFSIGLESLIQTMLNLNPSS
QIHISSLQNCHEGLEKFSEELKRRSSSFDQLITNYDINKSEIVSDLITTI
DTELKSASNSLAEKRAHVNLLLETNQAYQEYFDRLSNWLSNTYSRIQESS
DLYGPQSVISQRSDNLNRIQLSIQTEGETLLKAVIERADELNRIILDRTN
KEKLSDQVSKCQGEFYNVSNKLENIKTKVNDLETQWKNFDTNIKLLNKVN
KVFANRKERFRNMKYSYFLNINAEIEKILDLVKDIEEEKSNLEIFSNQIQ
SLIDVSQEAQLDTIYQDLIDQIDGHEIDCKSLLDMMRQMGNEKSAFDQQV
QNTQLMIDAMKAQLLPIDQLHNIASFNDYQKIFREFQLLESKLIDGDRMV
DECFQMFYKLSVLFDSEKALNDMISLLKKNWDGHKEKFDEVKTRMNRLLN
LWSNLENLRIPIEEWIQTTEKEMEAITCEGYQSTDANLKAFLRVKARKNE
SETIKPKLSKFIELFYKADIYPGFSKTKDPLVLQKVFCENLDKLMKLEKS
LSTTQLNVEKLLREISDAEKWVIEMCLLITSEQQKIPFANSLLDLKDRAK
LCKNLKIQIENFGECTIGLLNKNFQDISRLFIKPSPLKNDIFGKLTSLDQ
GMKQMASLTDKLKASIKDRSSNIKRFGSIIESVEIFLYRKFPEWWIGKEV
VATINPEDCLSQLSDVSAILENVQVLEADFEQVWQDNIRQLHSISPAHSH
NDGRDTFFNDSTSYINSEFTSLDDHLDRVKRDLKQTKDCIERRLEDLQGH
SHEWNQIESEISELTTVFIHQKMNLKQTFANLTNDDILYERFEKSLIELI
EKKDIVDKLDQRIKRLNVYRDHESWKYGKYSLLNEIYSDLLNEMVAVRKS
LRAMDVHDLCQEIMAGEDMNDFSQNVSKQDISLMYPQIGTQTNRNKATSI
QTIKRFSSNPNLRSFSSGKPSQNERDSSDSGPVFSRTSPCFAQKLVQTVN
DIGTQHSRPSKSHKKSINTSNEYEKILTKEQKDRQFKRLNELLETVRQIK
EQISLSNSSMSIRSNRSQQMKSNNSLRNSTESIRHNLLQPKNKRKKSPQK
NNQMRSSVESLGKRPSPTGCTTPISFHRESPRKMRSSPRKSPAKRNSKIA
QFAN*
back to top

protein sequence of SMED30035723-orf-3

>SMED30035723-orf-3 ID=SMED30035723-orf-3|Name=SMED30035723-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=465bp
MLIRTRGRQIRNEHEHIQKKTFTKWINNLLSKKHPEEKIQNLYVDLCDGI
RLLELLQILTKQKLTIEKRKHMQRVHCLANMCSLIGFLKDTMHIKLINIH
AADIVDGRPNIILGLVWQIILNFQIKSENMFKLIAQRDSNPTRRENLVKG
NPREALLAWSDKVITENYGISINDFHSSWKDGKAFNAIIHNINPNLVDWD
LIKRRNSRENLEYAFRLAEKYLNIPKLLEPEDVDVDYPDEKSIMTYLSLF
LHNYPDQDIHKNSAPKASHNWIDIKTSEETAMDKISQEEIVKQRSSLKKS
EFNKYTTPTLQSTMTIKRQNQPKPVVNPSVVRQIKNDKKSEEEENKAFND
EFQSLRYQIKTILLEIDSDLKDPQKYKIDSVEENMKSIVPVVEKINQLKE
LQERLENLDSRLDFQERFRNLLNIQWEIESDIDESEPLSNYLNNLRMLEQ
GLFFVTDLTVTDVE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
GO:0005634nucleus
GO:0005730nucleolus
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005886plasma membrane
GO:0005913cell-cell adherens junction
GO:0008091spectrin
GO:0012505endomembrane system
GO:0014069postsynaptic density
GO:0030673axolemma
GO:0030863cortical cytoskeleton
GO:0031430M band
GO:0032437cuticular plate
GO:0043234protein complex
GO:0070062extracellular exosome
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
PLANA:0000464GABAergic neuron
PLANA:0002056medial muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR018159Spectrin/alpha-actinin
IPR001799Ephrin_RBD
IPR001715CH-domain
IPR001589Actinin_actin-bd_CS
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003723RNA binding
GO:0003779actin binding
GO:0005200structural constituent of cytoskeleton
GO:0005516calmodulin binding
GO:0005543phospholipid binding
GO:0030506ankyrin binding
GO:0032403protein complex binding
GO:0045296cadherin binding
GO:0051020GTPase binding
GO:0098641cadherin binding involved in cell-cell adhesion
Vocabulary: biological process
TermDefinition
GO:0000281mitotic cytokinesis
GO:0007009plasma membrane organization
GO:0007010cytoskeleton organization
GO:0007182common-partner SMAD protein phosphorylation
GO:0007184SMAD protein import into nucleus
GO:0043001Golgi to plasma membrane protein transport
GO:0051693actin filament capping
GO:0071709membrane assembly
GO:0072661protein targeting to plasma membrane
GO:0098609cell-cell adhesion
GO:1900042positive regulation of interleukin-2 secretion
GO:1903076regulation of protein localization to plasma membrane
GO:1903078positive regulation of protein localization to plasma membrane