Synaptotagmin XV-like protein

Overview
NameSynaptotagmin XV-like protein
Smed IDSMED30035718
Length (bp)1737
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Synaptotagmin XV-like protein (SMED30035718) t-SNE clustered cells

Violin plots show distribution of expression levels for Synaptotagmin XV-like protein (SMED30035718) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035718

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 18

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30035718SMESG000020466.1 Contig3128GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035718SMESG000066997.1 Contig3128GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
X1 cellSMED30035718SMESG000066997.1 SmedASXL_012503SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30035718SMESG000066997.1 SmedASXL_000972SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30035718SMESG000066997.1 SmedASXL_000972SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
oocyteSMED30035718SMESG000066997.1 Contig38054newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30035718SMESG000066997.1 Contig38054uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30035718SMESG000066997.1 Contig38054newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30035718SMESG000066997.1 Contig38054uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30035718SMESG000066997.1 Contig38054newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30035718SMESG000066997.1 Contig38054uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30035718SMESG000066997.1 KY847533.1smed_ncbi_20200123PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
ovarySMED30035718SMESG000066997.1 KY847533.1smed_ncbi_20200123PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
vitelline glandSMED30035718SMESG000066997.1 KY847533.1smed_ncbi_20200123PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
ovarySMED30035718SMESG000066997.1 PL04017B1F10ncbi_smed_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
vitelline glandSMED30035718SMESG000066997.1 PL04017B1F10ncbi_smed_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
neoblastSMED30035718SMESG000066997.1 SMED_06192_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30035718SMESG000066997.1 SMED_06192_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Synaptotagmin XV-like protein vs. Ensembl Fly
Match: Syt1 (gene:FBgn0004242 transcript:FBtr0077728)

HSP 1 Score: 50.447 bits (119), Expect = 3.788e-6
Identity = 74/294 (25.17%), Postives = 123/294 (41.84%), Query Frame = 2
Query:  785 KYGQIIFSLYYDWISKTLEVTVNHAKYLMGFGTKRKNHFYVKVLLKTKSCPQYTSTNSLSGVPDKNINKFQKSLKGSFRTAIKSDFCNPVFNETFKFTNI--TSLLLKECILQMIVKEETPKFLEKNIVLGCVDFAL---DEAQLIDKHESLNEIIRDIKPIGQIEDKGKVILSLQYNRQLTVLTV------NVKELLPGPEQVSDVSVEL-FLRSIDSIMYSRKLELDSNLKSGNSENFDLDSCL--INSVCLVLVFYARIRNCSRTPLGRLVVGPIQFASGARLAQWTEISA 1624
            K G++ F L YD+ S +L VTV  A+ L        +  YVKV L                +PDK         K  F T +     +PVFNETF F ++     + K  +  +    +  +F  K+  +G V   L   D AQ I++   L  +  +    G  E  G +  SL+Y      LTV      N+K++  G   +SD  V++  +++   +   +       L    +E+F  +     I  +CLV+      R  +  P+GR ++G +   +G  L  W+++ A
Sbjct:  190 KLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVYL----------------LPDK---------KKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIF---DFDRF-SKHDQIGEVKVPLCTIDLAQTIEEWRDLVSVEGE----GGQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVG--GLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCM--GTGTELRHWSDMLA 446          
BLAST of Synaptotagmin XV-like protein vs. Ensembl Fly
Match: Syt1 (gene:FBgn0004242 transcript:FBtr0345331)

HSP 1 Score: 50.447 bits (119), Expect = 3.788e-6
Identity = 74/294 (25.17%), Postives = 123/294 (41.84%), Query Frame = 2
Query:  785 KYGQIIFSLYYDWISKTLEVTVNHAKYLMGFGTKRKNHFYVKVLLKTKSCPQYTSTNSLSGVPDKNINKFQKSLKGSFRTAIKSDFCNPVFNETFKFTNI--TSLLLKECILQMIVKEETPKFLEKNIVLGCVDFAL---DEAQLIDKHESLNEIIRDIKPIGQIEDKGKVILSLQYNRQLTVLTV------NVKELLPGPEQVSDVSVEL-FLRSIDSIMYSRKLELDSNLKSGNSENFDLDSCL--INSVCLVLVFYARIRNCSRTPLGRLVVGPIQFASGARLAQWTEISA 1624
            K G++ F L YD+ S +L VTV  A+ L        +  YVKV L                +PDK         K  F T +     +PVFNETF F ++     + K  +  +    +  +F  K+  +G V   L   D AQ I++   L  +  +    G  E  G +  SL+Y      LTV      N+K++  G   +SD  V++  +++   +   +       L    +E+F  +     I  +CLV+      R  +  P+GR ++G +   +G  L  W+++ A
Sbjct:  190 KLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVYL----------------LPDK---------KKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIF---DFDRF-SKHDQIGEVKVPLCTIDLAQTIEEWRDLVSVEGE----GGQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVG--GLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCM--GTGTELRHWSDMLA 446          
BLAST of Synaptotagmin XV-like protein vs. Ensembl Fly
Match: Syt1 (gene:FBgn0004242 transcript:FBtr0077727)

HSP 1 Score: 50.447 bits (119), Expect = 3.788e-6
Identity = 74/294 (25.17%), Postives = 123/294 (41.84%), Query Frame = 2
Query:  785 KYGQIIFSLYYDWISKTLEVTVNHAKYLMGFGTKRKNHFYVKVLLKTKSCPQYTSTNSLSGVPDKNINKFQKSLKGSFRTAIKSDFCNPVFNETFKFTNI--TSLLLKECILQMIVKEETPKFLEKNIVLGCVDFAL---DEAQLIDKHESLNEIIRDIKPIGQIEDKGKVILSLQYNRQLTVLTV------NVKELLPGPEQVSDVSVEL-FLRSIDSIMYSRKLELDSNLKSGNSENFDLDSCL--INSVCLVLVFYARIRNCSRTPLGRLVVGPIQFASGARLAQWTEISA 1624
            K G++ F L YD+ S +L VTV  A+ L        +  YVKV L                +PDK         K  F T +     +PVFNETF F ++     + K  +  +    +  +F  K+  +G V   L   D AQ I++   L  +  +    G  E  G +  SL+Y      LTV      N+K++  G   +SD  V++  +++   +   +       L    +E+F  +     I  +CLV+      R  +  P+GR ++G +   +G  L  W+++ A
Sbjct:  190 KLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVYL----------------LPDK---------KKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIF---DFDRF-SKHDQIGEVKVPLCTIDLAQTIEEWRDLVSVEGE----GGQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVG--GLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCM--GTGTELRHWSDMLA 446          
BLAST of Synaptotagmin XV-like protein vs. Ensembl Fly
Match: Syt1 (gene:FBgn0004242 transcript:FBtr0077726)

HSP 1 Score: 50.0618 bits (118), Expect = 3.866e-6
Identity = 74/294 (25.17%), Postives = 123/294 (41.84%), Query Frame = 2
Query:  785 KYGQIIFSLYYDWISKTLEVTVNHAKYLMGFGTKRKNHFYVKVLLKTKSCPQYTSTNSLSGVPDKNINKFQKSLKGSFRTAIKSDFCNPVFNETFKFTNI--TSLLLKECILQMIVKEETPKFLEKNIVLGCVDFAL---DEAQLIDKHESLNEIIRDIKPIGQIEDKGKVILSLQYNRQLTVLTV------NVKELLPGPEQVSDVSVEL-FLRSIDSIMYSRKLELDSNLKSGNSENFDLDSCL--INSVCLVLVFYARIRNCSRTPLGRLVVGPIQFASGARLAQWTEISA 1624
            K G++ F L YD+ S +L VTV  A+ L        +  YVKV L                +PDK         K  F T +     +PVFNETF F ++     + K  +  +    +  +F  K+  +G V   L   D AQ I++   L  +  +    G  E  G +  SL+Y      LTV      N+K++  G   +SD  V++  +++   +   +       L    +E+F  +     I  +CLV+      R  +  P+GR ++G +   +G  L  W+++ A
Sbjct:  192 KLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVYL----------------LPDK---------KKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIF---DFDRF-SKHDQIGEVKVPLCTIDLAQTIEEWRDLVSVEGE----GGQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVG--GLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCM--GTGTELRHWSDMLA 448          
BLAST of Synaptotagmin XV-like protein vs. Ensembl Fly
Match: Syt1 (gene:FBgn0004242 transcript:FBtr0332218)

HSP 1 Score: 49.6766 bits (117), Expect = 5.317e-6
Identity = 71/305 (23.28%), Postives = 117/305 (38.36%), Query Frame = 2
Query:  785 KYGQIIFSLYYDWISKTLEVTVNHAKYLMGFGTKRKNHFYVKVLLKTKSCPQYTSTNSLSGVPDKNINKFQKSLKGSFRTAIKSDFCNPVFNETFKFTNITSLLLKECILQMIVKEETPKFLEKNIVLGCVDFALDEAQLIDKHESLNEI---------------IRDIKPI-GQIEDKGKVILSLQYNRQLTVLTV------NVKELLPGPEQVSDVSVEL-FLRSIDSIMYSRKLELDSNLKSGNSENFDLDSCL--INSVCLVLVFYARIRNCSRTPLGRLVVGPIQFASGARLAQWTEISA 1624
            K G++ F L YD+ S +L VTV  A+ L        +  YVKV L                +PDK         K  F T +     +PVFNETF F ++                     + K +V    DF         KH+ + E+                RD+  + G+    G +  SL+Y      LTV      N+K++  G   +SD  V++  +++   +   +       L    +E+F  +     I  +CLV+      R  +  P+GR ++G +   +G  L  W+++ A
Sbjct:  192 KLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVYL----------------LPDK---------KKKFETKVHRKTLSPVFNETFTFKSLPYA----------------DAMNKTLVFAIFDF-----DRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVSVEGEGGQLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVG--GLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCM--GTGTELRHWSDMLA 446          
BLAST of Synaptotagmin XV-like protein vs. Ensembl Mouse
Match: Syt15 (synaptotagmin XV [Source:MGI Symbol;Acc:MGI:2442166])

HSP 1 Score: 52.373 bits (124), Expect = 1.012e-6
Identity = 61/221 (27.60%), Postives = 96/221 (43.44%), Query Frame = 2
Query: 1016 FRTAIKSDFCNPVFNETFKFTNITSLLLKECILQMIVKEETPKFLEKNIVLGCVDFALDEAQLIDKHESLNEIIRDI--KPIGQIEDKGKVILSLQYNRQLTVLTVNVKELLPGPEQVSDVSVELFLRSIDSIMYSRKL----ELDSNLKSGN-----SENFDLDSCLINSVCLVLVFYARIRNCSRTPLGRLVVGPIQFASGARLAQWTEISAGNEESVK 1645
             ++  K   CNP F+E F F  ++S  + + +L+  V     K   K+ +LG V F L    L   H  +  I RD+  K +    + G +   L YN  L+ LTV V  L     Q+ +    + +    S+M   K        + L S N     + +F +D+  +++  L LV          +PLGR+VVGP  +  G  L  W E+    +E VK
Sbjct:  194 LQSKTKHKICNPQFDENFIF-QVSSKSVTQRVLKFSVYHVNKK--RKHQLLGQVLFPLKNETLAGDHHRI--IWRDLEAKNLEPPSEFGDIQFCLSYNDYLSRLTVVV--LRAKGLQLQEDRSVVSVFVKVSLMNHNKFVKCKRTSAVLGSVNPVYNETFSFKVDTNELDTASLSLVVLQTTEGNKSSPLGRVVVGPYMYTRGKELEHWGEMLRKPKELVK 407          
BLAST of Synaptotagmin XV-like protein vs. UniProt/SwissProt
Match: sp|Q8C6N3|SYT15_MOUSE (Synaptotagmin-15 OS=Mus musculus OX=10090 GN=Syt15 PE=2 SV=1)

HSP 1 Score: 52.373 bits (124), Expect = 7.079e-6
Identity = 61/221 (27.60%), Postives = 96/221 (43.44%), Query Frame = 2
Query: 1016 FRTAIKSDFCNPVFNETFKFTNITSLLLKECILQMIVKEETPKFLEKNIVLGCVDFALDEAQLIDKHESLNEIIRDI--KPIGQIEDKGKVILSLQYNRQLTVLTVNVKELLPGPEQVSDVSVELFLRSIDSIMYSRKL----ELDSNLKSGN-----SENFDLDSCLINSVCLVLVFYARIRNCSRTPLGRLVVGPIQFASGARLAQWTEISAGNEESVK 1645
             ++  K   CNP F+E F F  ++S  + + +L+  V     K   K+ +LG V F L    L   H  +  I RD+  K +    + G +   L YN  L+ LTV V  L     Q+ +    + +    S+M   K        + L S N     + +F +D+  +++  L LV          +PLGR+VVGP  +  G  L  W E+    +E VK
Sbjct:  194 LQSKTKHKICNPQFDENFIF-QVSSKSVTQRVLKFSVYHVNKK--RKHQLLGQVLFPLKNETLAGDHHRI--IWRDLEAKNLEPPSEFGDIQFCLSYNDYLSRLTVVV--LRAKGLQLQEDRSVVSVFVKVSLMNHNKFVKCKRTSAVLGSVNPVYNETFSFKVDTNELDTASLSLVVLQTTEGNKSSPLGRVVVGPYMYTRGKELEHWGEMLRKPKELVK 407          
BLAST of Synaptotagmin XV-like protein vs. TrEMBL
Match: A0A1W6I193 (Synaptotagmin XV-like protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 467.618 bits (1202), Expect = 8.308e-161
Identity = 229/234 (97.86%), Postives = 230/234 (98.29%), Query Frame = 2
Query:  653 MPESGPSTEINSRQNSNDKDFERRTTKKYSIYNDNDFFPIKEISKYGQIIFSLYYDWISKTLEVTVNHAKYLMGFGTKRKNHFYVKVLLKTKSCPQYTSTNSLSGVPDKNINKFQKSLKGSFRTAIKSDFCNPVFNETFKFTNITSLLLKECILQMIVKEETPKFLEKNIVLGCVDFALDEAQLIDKHESLNEIIRDIKPIGQIEDKGKVILSLQYNRQLTVLTVNVKELLPGP 1354
            MPESGPSTEINSRQNSNDKDFERRTTKKYSIYNDNDFFPIKEISKYGQIIFSLYYDWISKTLEVTVNHAKYLMGFGTKRKNHFYVKVLLKTKSCPQYTSTNSLSGV DKNINKFQKSLKGSFRTAIKSDFCNPVF+ETFKFTNITSLLLKECILQMIVKEETPKFLEKNIVLGCVDFALDEAQLIDKHESLNEIIRDIKPIGQIEDKGKVILSLQYNRQLTVLTV VKELL  P
Sbjct:    1 MPESGPSTEINSRQNSNDKDFERRTTKKYSIYNDNDFFPIKEISKYGQIIFSLYYDWISKTLEVTVNHAKYLMGFGTKRKNHFYVKVLLKTKSCPQYTSTNSLSGVLDKNINKFQKSLKGSFRTAIKSDFCNPVFDETFKFTNITSLLLKECILQMIVKEETPKFLEKNIVLGCVDFALDEAQLIDKHESLNEIIRDIKPIGQIEDKGKVILSLQYNRQLTVLTVYVKELLSWP 234          
BLAST of Synaptotagmin XV-like protein vs. TrEMBL
Match: A0A1S3STL1 (synaptotagmin-like protein 4 isoform X1 OS=Salmo salar OX=8030 GN=LOC106611707 PE=4 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 1.250e-6
Identity = 57/191 (29.84%), Postives = 91/191 (47.64%), Query Frame = 2
Query:  740 SIYNDNDFFPIKEISKYGQIIFSLYYDWISKTLEVTVNHAKYLM-GFGTKRKNHFYVKVLLKTKSCPQYTSTNSLSGVPDKNINKFQKSLKGSFRTAIKSDFCNPVFNETFKFTNITSLLLKECILQMIVKEETPKFLEKNIVLGCVDFALDEAQLIDKHESLNEIIRDIKPIGQ---IEDKGKVILSLQY 1300
            SIY++   +   E+S  G I+FSL YD  + +L V V   + L  G  T+++++ YVK  L                +PDK       S  G  +T+IK +  +P +NET KF+   S +L    LQ+ V       L +N  LG V+  LD   L  +HE    ++    P+      + KG++++SL+Y
Sbjct:  375 SIYSEAGDYDCVEVS--GDIVFSLSYDDTTHSLAVLVKECRSLAHGDATRQRSNPYVKCYL----------------LPDK-------SRTGKKKTSIKRNTVDPTYNETLKFSISRSQVLTRS-LQLSVWHH--DRLGRNAFLGEVEVPLDCRDLDSQHEECVALMGKASPLQSSAFSQYKGELVISLKY 537          
BLAST of Synaptotagmin XV-like protein vs. TrEMBL
Match: A0A1S3STK4 (synaptotagmin-like protein 4 isoform X2 OS=Salmo salar OX=8030 GN=LOC106611707 PE=4 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 1.289e-6
Identity = 57/191 (29.84%), Postives = 91/191 (47.64%), Query Frame = 2
Query:  740 SIYNDNDFFPIKEISKYGQIIFSLYYDWISKTLEVTVNHAKYLM-GFGTKRKNHFYVKVLLKTKSCPQYTSTNSLSGVPDKNINKFQKSLKGSFRTAIKSDFCNPVFNETFKFTNITSLLLKECILQMIVKEETPKFLEKNIVLGCVDFALDEAQLIDKHESLNEIIRDIKPIGQ---IEDKGKVILSLQY 1300
            SIY++   +   E+S  G I+FSL YD  + +L V V   + L  G  T+++++ YVK  L                +PDK       S  G  +T+IK +  +P +NET KF+   S +L    LQ+ V       L +N  LG V+  LD   L  +HE    ++    P+      + KG++++SL+Y
Sbjct:  370 SIYSEAGDYDCVEVS--GDIVFSLSYDDTTHSLAVLVKECRSLAHGDATRQRSNPYVKCYL----------------LPDK-------SRTGKKKTSIKRNTVDPTYNETLKFSISRSQVLTRS-LQLSVWHH--DRLGRNAFLGEVEVPLDCRDLDSQHEECVALMGKASPLQSSAFSQYKGELVISLKY 532          
BLAST of Synaptotagmin XV-like protein vs. TrEMBL
Match: A0A4W5PF13 (Synaptotagmin-like 4 OS=Hucho hucho OX=62062 PE=4 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 2.015e-6
Identity = 58/191 (30.37%), Postives = 90/191 (47.12%), Query Frame = 2
Query:  740 SIYNDNDFFPIKEISKYGQIIFSLYYDWISKTLEVTVNHAKYLM-GFGTKRKNHFYVKVLLKTKSCPQYTSTNSLSGVPDKNINKFQKSLKGSFRTAIKSDFCNPVFNETFKFTNITSLLLKECILQMIVKEETPKFLEKNIVLGCVDFALDEAQLIDKHESLNEIIRDIKPIGQ---IEDKGKVILSLQY 1300
            SIY++   +   E+S  G I+FSL YD  + +L V V     L  G  T+++++ YVK  L                +PDK       S  G  +T+IK +  +P +NET KF+   S +L    LQ+ V       L +N  LG V+  LD   L D HE    ++    P+      + KG++++SL+Y
Sbjct:  376 SIYSEAGDYDCVEVS--GDIVFSLSYDDTTHSLAVLVKECHSLAHGDATRQRSNPYVKCYL----------------LPDK-------SRTGKKKTSIKRNTVDPTYNETLKFSISRSQVLTRS-LQLSVWHH--DRLGRNAFLGEVEVPLDCRDLNDLHEECVALMGKASPLQSSAFSQYKGELVISLKY 538          
BLAST of Synaptotagmin XV-like protein vs. TrEMBL
Match: A0A1S3STL3 (synaptotagmin-like protein 4 isoform X3 OS=Salmo salar OX=8030 GN=LOC106611707 PE=4 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 2.393e-6
Identity = 57/191 (29.84%), Postives = 91/191 (47.64%), Query Frame = 2
Query:  740 SIYNDNDFFPIKEISKYGQIIFSLYYDWISKTLEVTVNHAKYLM-GFGTKRKNHFYVKVLLKTKSCPQYTSTNSLSGVPDKNINKFQKSLKGSFRTAIKSDFCNPVFNETFKFTNITSLLLKECILQMIVKEETPKFLEKNIVLGCVDFALDEAQLIDKHESLNEIIRDIKPIGQ---IEDKGKVILSLQY 1300
            SIY++   +   E+S  G I+FSL YD  + +L V V   + L  G  T+++++ YVK  L                +PDK       S  G  +T+IK +  +P +NET KF+   S +L    LQ+ V       L +N  LG V+  LD   L  +HE    ++    P+      + KG++++SL+Y
Sbjct:  323 SIYSEAGDYDCVEVS--GDIVFSLSYDDTTHSLAVLVKECRSLAHGDATRQRSNPYVKCYL----------------LPDK-------SRTGKKKTSIKRNTVDPTYNETLKFSISRSQVLTRS-LQLSVWHH--DRLGRNAFLGEVEVPLDCRDLDSQHEECVALMGKASPLQSSAFSQYKGELVISLKY 485          
BLAST of Synaptotagmin XV-like protein vs. Ensembl Cavefish
Match: syt15 (synaptotagmin XV [Source:ZFIN;Acc:ZDB-GENE-090527-2])

HSP 1 Score: 50.447 bits (119), Expect = 3.656e-6
Identity = 65/254 (25.59%), Postives = 113/254 (44.49%), Query Frame = 2
Query:  932 CPQYTSTNSLSGVPDKNINKFQKSLKGSFRTAIKSDFCNPVFNETFKFTNITSLLLKECILQMIVKEETPKFLEKNIVLGCVDFALDEAQLIDKHESLNEII-RDIKPIG--QIEDKGKVILSLQYNRQLTVLTVNVKELLPGPEQVSD---VSVELFLRSIDSIMYSRKLELDSNLKSGNSE--NFDLDSCLINSVCLVLVFYARI----RNCSRTP-------LGRLVVGPIQFASGARLAQWTEISAGNEE 1636
            C   T+   L  +P ++  + Q   +G          C P FN++F F  ++++ + +C L M V   +   L+K+  +G V F L   +L D  E+  +++ RD++      +   G + +SL YN+ L  LTV V  L     Q S    V V++ L+    ++ ++   +    +   +E   F L    +++ CL L            C  TP       LG +V+GP  +A G  L  WTE++ G +E
Sbjct:  170 CQACTTLIKLQLLPSEDRRQRQAKARG--------KGCQPQFNDSFVF-QVSNISVGQCTLSMSVY--SVDRLKKHHTVGRVLFPL---RLSDLREAAGKVLWRDLETESDLALSKHGDIQVSLNYNQSLQRLTVVV--LRARGLQCSSNAGVCVQVSLQIHTQVVKTKWTSVAKGSEPIFNEKLTFRLHPRQLDTTCLSLEVQQPATEEPSECQPTPRTTAPMSLGVVVIGPFMYARGRELEHWTEMALGIDE 407          
BLAST of Synaptotagmin XV-like protein vs. Ensembl Cavefish
Match: sytl4 (synaptotagmin like 4 [Source:NCBI gene;Acc:103045066])

HSP 1 Score: 49.6766 bits (117), Expect = 8.278e-6
Identity = 54/192 (28.12%), Postives = 87/192 (45.31%), Query Frame = 2
Query:  740 SIYNDNDFFPIKEISKYGQIIFSLYYDWISKTLEVTVNHAKYLM-GFGTKRKNHFYVKVLLKTKSCPQYTSTNSLSGVPDKNINKFQKSLKGSFRTAIKSDFCNPVFNETFKFTNITSLLLKECILQMIVKEETPKFLEKNIVLGCVDFALDEAQLIDKHESL----NEIIRDIKPIGQIEDKGKVILSLQY 1300
            S+Y++   + I ++S  G+I+FSL+YD  +++L V V   + L      K+K + YVK  L                +PDK       S +   +TA KS   NP +NET K++   S L+    LQ+ V         +N  LG V   LD   +   HE       +    + P    + KG++++SL+Y
Sbjct:  398 SVYSEAGDYDIVDVS--GEIVFSLHYDETAQSLAVMVKECRGLAYADAAKKKCNPYVKSYL----------------LPDK-------SRQSKKKTATKSKTINPTYNETLKYSISRSQLMTR-TLQLSVWHY--DRFGRNAFLGEVQLPLDCHDIDSAHEECVILRGKAAGSLAPSAFAQYKGELVISLKY 561          
BLAST of Synaptotagmin XV-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006493.1 (pep scaffold:Pmarinus_7.0:GL476457:113922:122135:1 gene:ENSPMAG00000005868.1 transcript:ENSPMAT00000006493.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.9802 bits (110), Expect = 1.965e-6
Identity = 51/176 (28.98%), Postives = 76/176 (43.18%), Query Frame = 2
Query:  791 GQIIFSLYYDWISKTLEVTVNHAKYLMGFGTKRKNHFYVKVLLKTKSCPQYTSTNSLSGVPDKNINKFQKSLKGSFRTAIKSDFCNPVFNETFKFTNITSLLLKECILQMIVKEETPKFLEKNIVLGCVDFALDEAQL---IDKHESLN-EIIRDIKPIGQIED--KGKVILSLQY 1300
            G I FS+ YD+    L +T+   + L  +G +R           TK C  Y     L   PDK       S +G  +T IK +  NPVFNET K+    + L   C+   +   ++      N  LG     LD   L    D+  +L   + R+  P   I +  KG++IL+L+Y
Sbjct:    3 GDINFSVSYDYRVGVLSLTLRQCRNL-AYGEER-----------TKRCDPYVKVYLL---PDK-------SRQGKRKTKIKKNTINPVFNETLKYAISHTQLEVRCVHLSVWHHDS---FRHNSFLGQASLPLDCCDLERGDDRWCALQPRVTRN--PFAAINNKYKGELILALKY 151          
BLAST of Synaptotagmin XV-like protein vs. Ensembl Nematostella
Match: EDO33088 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST77])

HSP 1 Score: 48.9062 bits (115), Expect = 2.280e-6
Identity = 55/212 (25.94%), Postives = 96/212 (45.28%), Query Frame = 2
Query: 1007 KGSFRTAIKSDFCNPVFNETFKFTNITSLLLKECILQMIVKEETPKFLEKNIVLGCVDFALDEAQLIDKHESLNEIIRDIKPIGQIEDKGKVILSLQYNRQLTVLTVNVKELLPGPEQVSDVSVELFLRSIDSIMYSRKLEL--------DSNLKSGNSENFDLDSCLINSVCLVLVFYARIRNCSRTPLGRLVVGPIQFASGARLAQWTEI 1618
            K    + +K    +P F+ETF F  + +  +KE  L+  V + T   L K   +G   F+L    L    +    + R IKP  Q+ ++G++ LSL YN   + L V V++     +       E F++ I  I  +RK++         D++    +  +F++ +  ++  CLVL           T +GR+V+GP  F SG   + W  +
Sbjct:   60 KPVLESYVKQSTWDPNFDETFVF-KLNTNEVKEKTLRFSVYDCT--RLHKLCPIGHTLFSLKGQDL----DGTMAVERAIKPQCQV-NRGEISLSLTYNPGTSRLVVGVRQARNILQFEGHAHKEYFVK-ISRIHLNRKVKTKRTPSTDGDASPIFKHDMSFNIPTEQLSDSCLVLSLMNHGVVRGSTTIGRVVLGPYVFGSGNERSHWGRM 262          
BLAST of Synaptotagmin XV-like protein vs. Ensembl Medaka
Match: sytl4 (synaptotagmin like 4 [Source:NCBI gene;Acc:101163586])

HSP 1 Score: 60.077 bits (144), Expect = 5.012e-9
Identity = 57/207 (27.54%), Postives = 95/207 (45.89%), Query Frame = 2
Query:  740 SIYNDNDFFPIKEISKYGQIIFSLYYDWISKTLEVTVNHAKYLM-GFGTKRKNHFYVKVLLKTKSCPQYTSTNSLSGVPDKNINKFQKSLKGSFRTAIKSDFCNPVFNETFKFTNITSLLLKECILQMIVKEETPKFLEKNIVLGCVDFALDEAQLIDKHES----LNEIIRDIKPIGQIEDKGKVILSLQYNRQLTVLTVNVKELL 1345
            SIY+D   +   E+S  GQ++F+L YD  +++L+V +   + L  G  +++ ++ YVK  L             L G   +N  K          T+IK +  NPVF+ET K++   S LL + +   +        L +N+ LG V   LD A L   HE     + ++  D+         G++++SL+Y       T  VK +L
Sbjct:  375 SIYSDAGDYGTVEVS--GQVVFALRYDEHTQSLQVFIKECQGLAHGDASRKLSNPYVKCYL-------------LHGKTRQNKKK----------TSIKKNTINPVFSETLKYSMSRSELLGQSVSISVWHHGR---LSRNVFLGEVTIPLDSANLDTPHEECLHLMGKMSSDVPDAAFERCSGELVISLKYVPPNKTTTEKVKGIL 553          
BLAST of Synaptotagmin XV-like protein vs. Ensembl Medaka
Match: sytl4 (synaptotagmin like 4 [Source:NCBI gene;Acc:101163586])

HSP 1 Score: 59.6918 bits (143), Expect = 5.364e-9
Identity = 53/192 (27.60%), Postives = 90/192 (46.88%), Query Frame = 2
Query:  740 SIYNDNDFFPIKEISKYGQIIFSLYYDWISKTLEVTVNHAKYLM-GFGTKRKNHFYVKVLLKTKSCPQYTSTNSLSGVPDKNINKFQKSLKGSFRTAIKSDFCNPVFNETFKFTNITSLLLKECILQMIVKEETPKFLEKNIVLGCVDFALDEAQLIDKHES----LNEIIRDIKPIGQIEDKGKVILSLQY 1300
            SIY+D   +   E+S  GQ++F+L YD  +++L+V +   + L  G  +++ ++ YVK  L             L G   +N  K          T+IK +  NPVF+ET K++   S LL + +   +        L +N+ LG V   LD A L   HE     + ++  D+         G++++SL+Y
Sbjct:  375 SIYSDAGDYGTVEVS--GQVVFALRYDEHTQSLQVFIKECQGLAHGDASRKLSNPYVKCYL-------------LHGKTRQNKKK----------TSIKKNTINPVFSETLKYSMSRSELLGQSVSISVWHH---GRLSRNVFLGEVTIPLDSANLDTPHEECLHLMGKMSSDVPDAAFERCSGELVISLKY 538          
BLAST of Synaptotagmin XV-like protein vs. Planmine SMEST
Match: SMESG000066997.1 (SMESG000066997.1)

HSP 1 Score: 1017.3 bits (2629), Expect = 0.000e+0
Identity = 504/521 (96.74%), Postives = 506/521 (97.12%), Query Frame = 2
Query:   98 MINLIFYLLLFGIAGFCNCSPIQELQINNDNIIPLIIGISLMGFVIIILLASLCVCFIINKTSPDKKTADGKKAPPENIKLLDFVHKNSMELIEDKNEINKRTVENSEKSIHNLEKFPNKSIIEFSKIHRYRRASVPAVLSTLHEASPSLEASSRKMSLSYNCVHEPQYDTKRNTIAHIDTDDTIMPESGPSTEINSRQNSNDKDFERRTTKKYSIYNDNDFFPIKEISKYGQIIFSLYYDWISKTLEVTVNHAKYLMGFGTKRKNHFYVKVLLKTKSCPQYTSTNSLSGVPDKNINKFQKSLKGSFRTAIKSDFCNPVFNETFKFTNITSLLLKECILQMIVKEETPKFLEKNIVLGCVDFALDEAQLIDKHESLNEIIRDIKPIGQIEDKGKVILSLQYNRQLTVLTVNVKELLPGPEQVSDVSVELFLRSIDSIMYSRKLELDSNLKSGNSENFDLDSCLINSVCLVLVFYARIRNCSRTPLGRLVVGPIQFASGARLAQWTEISAGNEESVKMHEII 1660
            MINLIFYLLLFGIAGFCNCSPIQELQINNDNIIPLIIGISLMGFVIIILLASLCVCFIINKTSPDKKTADGKKAPPENIKLLDFVHKNSMELIEDKNEINKRTVENSEKSIHNLEKFPNKSIIEFSKIHRYRRASVPAVLSTLHEASPSLEASSRKMSLSYNCVHEPQYDTKRNTIAHIDTDDTIMPESGPSTEINSRQNSNDKDFERRTTKKYSIYNDNDFFPIKEIS              +KTLEVTVNHAKYLMGFGTKRKNHFYVKVLLKTKSCPQYTSTNSLSGVPDKNINKFQKSLKGSFRTAIKSDFCNPVF+ETFKFTNITSLLLKECILQMIVKEETPKFLEKNIVLGCVDFALDEAQLIDKHESLNEIIRDIKPIGQIEDKGKVILSLQYNRQLTVLTV VKELLPGPEQVSDVSVELFLRSIDSIMYSRKLELDSNLKSGNSENFDLDSCLINSVCLVLVFYARIRNCSRTPLGRLVVGPIQFASGARLAQWTEISAGNEESVKMHEII
Sbjct:    1 MINLIFYLLLFGIAGFCNCSPIQELQINNDNIIPLIIGISLMGFVIIILLASLCVCFIINKTSPDKKTADGKKAPPENIKLLDFVHKNSMELIEDKNEINKRTVENSEKSIHNLEKFPNKSIIEFSKIHRYRRASVPAVLSTLHEASPSLEASSRKMSLSYNCVHEPQYDTKRNTIAHIDTDDTIMPESGPSTEINSRQNSNDKDFERRTTKKYSIYNDNDFFPIKEIS--------------NKTLEVTVNHAKYLMGFGTKRKNHFYVKVLLKTKSCPQYTSTNSLSGVPDKNINKFQKSLKGSFRTAIKSDFCNPVFDETFKFTNITSLLLKECILQMIVKEETPKFLEKNIVLGCVDFALDEAQLIDKHESLNEIIRDIKPIGQIEDKGKVILSLQYNRQLTVLTVYVKELLPGPEQVSDVSVELFLRSIDSIMYSRKLELDSNLKSGNSENFDLDSCLINSVCLVLVFYARIRNCSRTPLGRLVVGPIQFASGARLAQWTEISAGNEESVKMHEII 507          
BLAST of Synaptotagmin XV-like protein vs. Planmine SMEST
Match: SMESG000066997.1 (SMESG000066997.1)

HSP 1 Score: 838.18 bits (2164), Expect = 0.000e+0
Identity = 415/432 (96.06%), Postives = 417/432 (96.53%), Query Frame = 2
Query:  365 MELIEDKNEINKRTVENSEKSIHNLEKFPNKSIIEFSKIHRYRRASVPAVLSTLHEASPSLEASSRKMSLSYNCVHEPQYDTKRNTIAHIDTDDTIMPESGPSTEINSRQNSNDKDFERRTTKKYSIYNDNDFFPIKEISKYGQIIFSLYYDWISKTLEVTVNHAKYLMGFGTKRKNHFYVKVLLKTKSCPQYTSTNSLSGVPDKNINKFQKSLKGSFRTAIKSDFCNPVFNETFKFTNITSLLLKECILQMIVKEETPKFLEKNIVLGCVDFALDEAQLIDKHESLNEIIRDIKPIGQIEDKGKVILSLQYNRQLTVLTVNVKELLPGPEQVSDVSVELFLRSIDSIMYSRKLELDSNLKSGNSENFDLDSCLINSVCLVLVFYARIRNCSRTPLGRLVVGPIQFASGARLAQWTEISAGNEESVKMHEII 1660
            MELIEDKNEINKRTVENSEKSIHNLEKFPNKSIIEFSKIHRYRRASVPAVLSTLHEASPSLEASSRKMSLSYNCVHEPQYDTKRNTIAHIDTDDTIMPESGPSTEINSRQNSNDKDFERRTTKKYSIYNDNDFFPIKEIS              +KTLEVTVNHAKYLMGFGTKRKNHFYVKVLLKTKSCPQYTSTNSLSGVPDKNINKFQKSLKGSFRTAIKSDFCNPVF+ETFKFTNITSLLLKECILQMIVKEETPKFLEKNIVLGCVDFALDEAQLIDKHESLNEIIRDIKPIGQIEDKGKVILSLQYNRQLTVLTV VKELLPGPEQVSDVSVELFLRSIDSIMYSRKLELDSNLKSGNSENFDLDSCLINSVCLVLVFYARIRNCSRTPLGRLVVGPIQFASGARLAQWTEISAGNEESVKMHEII
Sbjct:    1 MELIEDKNEINKRTVENSEKSIHNLEKFPNKSIIEFSKIHRYRRASVPAVLSTLHEASPSLEASSRKMSLSYNCVHEPQYDTKRNTIAHIDTDDTIMPESGPSTEINSRQNSNDKDFERRTTKKYSIYNDNDFFPIKEIS--------------NKTLEVTVNHAKYLMGFGTKRKNHFYVKVLLKTKSCPQYTSTNSLSGVPDKNINKFQKSLKGSFRTAIKSDFCNPVFDETFKFTNITSLLLKECILQMIVKEETPKFLEKNIVLGCVDFALDEAQLIDKHESLNEIIRDIKPIGQIEDKGKVILSLQYNRQLTVLTVYVKELLPGPEQVSDVSVELFLRSIDSIMYSRKLELDSNLKSGNSENFDLDSCLINSVCLVLVFYARIRNCSRTPLGRLVVGPIQFASGARLAQWTEISAGNEESVKMHEII 418          
BLAST of Synaptotagmin XV-like protein vs. Planmine SMEST
Match: SMESG000036721.1 (SMESG000036721.1)

HSP 1 Score: 58.151 bits (139), Expect = 1.053e-8
Identity = 84/321 (26.17%), Postives = 138/321 (42.99%), Query Frame = 2
Query:  764 FPIKEISKYGQIIFSLYYDWISKTLEVTVNHAKYLMGFGTKRKNHFYVKVLLKTKSCPQYTSTNSLSGVPDKNINKFQKSLKGSFRTAIKSDFCNPVFNETFKFTNITSLLLKECILQMIVKEETPKFLEKNIVLGCVDFALDEAQLIDKHESLNEIIRDIK-PIGQIEDKGKVILSLQYNRQLT--VLTVNVKELLPGPEQVSDVSVELFLRSIDSIMYSRKLELDSN--LKSGNS---------------ENFDLDSCLINSVCLVLVFYARIRNCSRTPLGRLVVGPIQFASG-ARLAQWTE-ISAGNEESVKMHEII 1660
            + I  +   G++ FS+ Y+     L VT+N A YL    T     FYVKV L                +  +N  K Q   K    TA K    NP+F +TF F  +T   L    LQ  VK+   K ++KN  LG   F LD  ++I+  E   E+ RD++  + +   +G++++SL Y+   +   L+VN+             +  L +R  D+ +++R   L  N  +K+  S                 F++D   I  V +V+   +R +      LG+L++G + +    + L  W + IS  N    K H I+
Sbjct:  169 YEILNLYGQGKLCFSIVYNEHISRLYVTINKAVYLNSSKTNNLAGFYVKVYL----------------LNTENDMKLQMH-KSEIVTANK----NPMFEQTFSFL-LTKSSLVSIKLQFKVKQAHIK-VKKNEYLGGFMFHLDNNEIINNPELFQELWRDLRGDLRKDTRRGEILISLMYSEHQSSAFLSVNLHR-----------AKNLQIRQHDNSVFARCTMLVGNKPIKTKRSITVKQDISAPYVDLESVFNVDKLNIMEVGVVIHICSRSKIGFSHLLGKLILGSVMYTDDKSVLIHWKDMISYQNRTVTKWHTIM 455          
BLAST of Synaptotagmin XV-like protein vs. Planmine SMEST
Match: SMESG000058817.1 (SMESG000058817.1)

HSP 1 Score: 54.299 bits (129), Expect = 1.798e-7
Identity = 60/215 (27.91%), Postives = 102/215 (47.44%), Query Frame = 2
Query: 1019 RTAIKSDFCNPVFNETFKFTNITSLLLKECILQMIVKEETPKFLEKNIVLGCVDFAL-----DEAQLIDKHESLNEIIRDIKPIGQIEDKGKVILSLQYNR----QLTVLTVNVKELLPGPEQVSDVSVELFLRSIDSIMYSRKLELDSNLKSGNSEN-------FDLDSCLINSVCLVLVFYARIRNCSRTPLGRLVVGPIQFASGARLAQWTE 1615
            R++  +   NP+FN+TF F +ITS+  +   LQ+ VKE   + LE N V+G V F L     D   +I   E   EI  + K   +   +G V+++L+ +     ++ V     + L+   + +S V V   L     ++ ++K +      S  S N        + D  +++  C++L F +R R      +GR ++G IQ+  G  L QWTE
Sbjct:  255 RSSCVTSMGNPMFNQTFTF-HITSIPQQ---LQLTVKE--VRKLESNRVIGYVWFDLSCMLKDNRAMITSQEISREIFGENKLYCR---RGDVLVNLKVSANDSIEINVCVAEARNLIVRNQNIS-VYVRASLLIKHKVVQTKKGQPVKRSISSPSFNDRFKFVITNKDISILDECCIILCFCSRSRVRFSHLIGRCIIGNIQYTEGEGLLQWTE 459          
The following BLAST results are available for this feature:
BLAST of Synaptotagmin XV-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Synaptotagmin XV-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Synaptotagmin XV-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Syt13.788e-625.17gene:FBgn0004242 transcript:FBtr0077728[more]
Syt13.788e-625.17gene:FBgn0004242 transcript:FBtr0345331[more]
Syt13.788e-625.17gene:FBgn0004242 transcript:FBtr0077727[more]
Syt13.866e-625.17gene:FBgn0004242 transcript:FBtr0077726[more]
Syt15.317e-623.28gene:FBgn0004242 transcript:FBtr0332218[more]
back to top
BLAST of Synaptotagmin XV-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Synaptotagmin XV-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Synaptotagmin XV-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Syt151.012e-627.60synaptotagmin XV [Source:MGI Symbol;Acc:MGI:244216... [more]
back to top
BLAST of Synaptotagmin XV-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q8C6N3|SYT15_MOUSE7.079e-627.60Synaptotagmin-15 OS=Mus musculus OX=10090 GN=Syt15... [more]
back to top
BLAST of Synaptotagmin XV-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1W6I1938.308e-16197.86Synaptotagmin XV-like protein OS=Schmidtea mediter... [more]
A0A1S3STL11.250e-629.84synaptotagmin-like protein 4 isoform X1 OS=Salmo s... [more]
A0A1S3STK41.289e-629.84synaptotagmin-like protein 4 isoform X2 OS=Salmo s... [more]
A0A4W5PF132.015e-630.37Synaptotagmin-like 4 OS=Hucho hucho OX=62062 PE=4 ... [more]
A0A1S3STL32.393e-629.84synaptotagmin-like protein 4 isoform X3 OS=Salmo s... [more]
back to top
BLAST of Synaptotagmin XV-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
syt153.656e-625.59synaptotagmin XV [Source:ZFIN;Acc:ZDB-GENE-090527-... [more]
sytl48.278e-628.13synaptotagmin like 4 [Source:NCBI gene;Acc:1030450... [more]
back to top
BLAST of Synaptotagmin XV-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000006493.11.965e-628.98pep scaffold:Pmarinus_7.0:GL476457:113922:122135:1... [more]
back to top
BLAST of Synaptotagmin XV-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Synaptotagmin XV-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO330882.280e-625.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Synaptotagmin XV-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
sytl45.012e-927.54synaptotagmin like 4 [Source:NCBI gene;Acc:1011635... [more]
sytl45.364e-927.60synaptotagmin like 4 [Source:NCBI gene;Acc:1011635... [more]
back to top
BLAST of Synaptotagmin XV-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000066997.10.000e+096.74SMESG000066997.1[more]
SMESG000066997.10.000e+096.06SMESG000066997.1[more]
SMESG000036721.11.053e-826.17SMESG000036721.1[more]
SMESG000058817.11.798e-727.91SMESG000058817.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035718 ID=SMED30035718|Name=Synaptotagmin XV-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1737bp
GTGATTGTGTGCCTCGAAATCCTTCATTGCCATTGGATATTAGGACTCGA
AATTCAGTTAAAGTGTGCGCACACATATTTCAACTGTAACTGTTACAATG
ATCAACCTGATATTTTATCTACTTCTATTTGGAATTGCTGGATTTTGCAA
TTGTTCGCCGATTCAAGAGTTACAAATAAACAACGATAATATTATACCAT
TAATTATCGGTATAAGCCTAATGGGATTTGTTATTATCATATTATTGGCC
TCGTTGTGTGTTTGTTTCATTATTAACAAGACTTCTCCAGACAAAAAAAC
AGCTGATGGTAAAAAAGCTCCGCCGGAAAACATAAAATTATTAGATTTTG
TTCATAAAAATTCAATGGAATTGATTGAGGATAAAAATGAAATAAACAAA
CGAACTGTAGAAAATAGTGAAAAATCGATACATAATTTGGAAAAGTTTCC
AAACAAGTCTATAATAGAATTTTCTAAAATTCATCGCTATAGGCGAGCAA
GTGTTCCTGCTGTTTTATCAACTTTGCACGAAGCTTCTCCGTCTTTGGAA
GCGAGTAGTAGAAAAATGTCACTGTCATACAACTGTGTCCATGAGCCCCA
ATATGATACCAAAAGGAATACAATAGCACACATTGATACTGATGATACTA
TAATGCCAGAGAGTGGGCCTAGCACAGAAATAAATTCAAGGCAAAATTCA
AACGATAAAGATTTTGAACGACGGACGACAAAAAAGTATTCGATATATAA
TGACAATGATTTCTTTCCAATCAAGGAGATATCGAAGTACGGGCAAATAA
TATTCTCCCTCTATTACGATTGGATTAGTAAGACTCTCGAAGTTACGGTA
AATCATGCAAAATATTTAATGGGATTTGGGACAAAACGCAAAAACCATTT
CTATGTCAAAGTTCTTTTAAAAACTAAAAGTTGTCCTCAATACACTAGCA
CCAATTCATTGTCTGGTGTGCCTGACAAAAATATCAATAAGTTCCAAAAA
AGTTTGAAAGGTTCTTTCAGAACTGCCATAAAATCTGATTTTTGCAATCC
TGTATTCAACGAAACCTTTAAATTTACCAACATTACTTCTTTACTGTTGA
AAGAATGTATTTTGCAAATGATAGTGAAAGAAGAAACACCAAAATTTCTG
GAGAAAAATATTGTTCTTGGTTGCGTTGATTTTGCTTTGGACGAGGCGCA
ACTGATTGACAAGCATGAATCTCTGAATGAGATTATCCGAGATATCAAGC
CAATTGGACAAATTGAGGATAAAGGCAAAGTTATCCTTTCCCTTCAATAC
AATCGACAGTTGACAGTACTGACGGTTAATGTAAAAGAGCTACTTCCTGG
CCCTGAACAGGTTTCCGATGTTTCAGTGGAATTATTTCTGCGCTCAATCG
ACTCTATCATGTATTCGAGGAAATTAGAATTAGACAGCAACCTAAAATCT
GGAAACAGCGAAAATTTTGATTTAGATAGTTGTTTAATAAATTCTGTTTG
CTTGGTGCTGGTGTTCTATGCCCGGATTCGGAACTGTTCCAGGACTCCAT
TGGGACGTCTGGTTGTCGGTCCTATACAATTTGCAAGTGGCGCTCGACTG
GCCCAATGGACCGAAATCAGTGCTGGAAATGAGGAGTCCGTAAAAATGCA
CGAAATCATTTAGATTTGTTTAATTTATCAACTGGTTCTTTGTTTATTTG
AATTAATTTAATGACGAATAAATATCTTTCACCTGGC
back to top

protein sequence of SMED30035718-orf-1

>SMED30035718-orf-1 ID=SMED30035718-orf-1|Name=SMED30035718-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=522bp
MINLIFYLLLFGIAGFCNCSPIQELQINNDNIIPLIIGISLMGFVIIILL
ASLCVCFIINKTSPDKKTADGKKAPPENIKLLDFVHKNSMELIEDKNEIN
KRTVENSEKSIHNLEKFPNKSIIEFSKIHRYRRASVPAVLSTLHEASPSL
EASSRKMSLSYNCVHEPQYDTKRNTIAHIDTDDTIMPESGPSTEINSRQN
SNDKDFERRTTKKYSIYNDNDFFPIKEISKYGQIIFSLYYDWISKTLEVT
VNHAKYLMGFGTKRKNHFYVKVLLKTKSCPQYTSTNSLSGVPDKNINKFQ
KSLKGSFRTAIKSDFCNPVFNETFKFTNITSLLLKECILQMIVKEETPKF
LEKNIVLGCVDFALDEAQLIDKHESLNEIIRDIKPIGQIEDKGKVILSLQ
YNRQLTVLTVNVKELLPGPEQVSDVSVELFLRSIDSIMYSRKLELDSNLK
SGNSENFDLDSCLINSVCLVLVFYARIRNCSRTPLGRLVVGPIQFASGAR
LAQWTEISAGNEESVKMHEII*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000074oocyte
PLANA:0000204ovary
PLANA:0000231vitelline gland
PLANA:0000429neoblast
PLANA:0002089reproductive organ
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR035892C2_domain_sf
IPR030539SYT15
IPR000008C2_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005509calcium ion binding
GO:0005544calcium-dependent phospholipid binding
GO:0019905syntaxin binding
GO:0030276clathrin binding
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0019898extrinsic component of membrane
GO:0098793presynapse
Vocabulary: biological process
TermDefinition
GO:0006906vesicle fusion
GO:0017158regulation of calcium ion-dependent exocytosis
GO:0048791calcium ion-regulated exocytosis of neurotransmitter
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000008C2 domainSMARTSM00239C2_3ccoord: 246..376
e-value: 2.3E-6
score: 37.1
IPR000008C2 domainPFAMPF00168C2coord: 246..372
e-value: 0.0013
score: 19.0
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 225..381
e-value: 2.4E-15
score: 58.5
NoneNo IPR availablePANTHERPTHR10024SYNAPTOTAGMINcoord: 308..516
NoneNo IPR availableSIGNALP_EUKSignalP-TMSignalP-TMcoord: 1..19
score: 0.824
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 222..366
NoneNo IPR availableTMHMMTMhelixcoord: 37..59
NoneNo IPR availableTMHMMTMhelixcoord: 5..27
IPR030539Synaptotagmin-15PANTHERPTHR10024:SF234SYNAPTOTAGMIN-15coord: 308..516