Sodium channel protein

Overview
NameSodium channel protein
Smed IDSMED30035715
Length (bp)5514
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Sodium channel protein (SMED30035715) t-SNE clustered cells

Violin plots show distribution of expression levels for Sodium channel protein (SMED30035715) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Sodium channel protein (SMED30035715) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Sodium channel protein (SMED30035715) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035715

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 18

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30035715SMESG000075430.1 SmedASXL_005407SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30035715SMESG000075430.1 SmedASXL_005406SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30035715SMESG000075431.1 SMESG000075430.1 SmedASXL_015701SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30035715SMESG000075431.1 SMESG000075430.1 dd_Smed_v4_12243_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035715SMESG000075431.1 SMESG000075430.1 dd_Smed_v4_12243_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30035715SMESG000075431.1 SMESG000075430.1 dd_Smed_v4_12243_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30035715SMESG000075430.1 dd_Smed_v4_38612_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035715SMESG000075430.1 dd_Smed_v4_38612_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30035715SMESG000075430.1 dd_Smed_v4_38612_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30035715SMESG000075430.1 dd_Smed_v4_38612_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035715SMESG000075430.1 Contig14513uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035715SMESG000075430.1 Contig14513newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035715SMESG000075430.1 Contig42057uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035715SMESG000075430.1 Contig42057newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30035715SMESG000075431.1 SMESG000075430.1 dd_Smed_v6_12243_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
enteric muscle cellSMED30035715SMESG000075430.1 dd_Smed_v4_38612_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30035715SMESG000075431.1 KJ187192smed_ncbi_20200123PMID:25356635
Cowles et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30035715SMESG000075431.1 KJ187192smed_ncbi_20200123PMID:25356635
Cowles et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Sodium channel protein vs. Ensembl Human
Match: SCN2A (sodium voltage-gated channel alpha subunit 2 [Source:HGNC Symbol;Acc:HGNC:10588])

HSP 1 Score: 388.652 bits (997), Expect = 5.801e-109
Identity = 216/449 (48.11%), Postives = 289/449 (64.37%), Query Frame = 3
Query: 2934 IDEESVNELKGCCCAICYNPFQEKKPFHCCYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSEC---LRQNHT--WANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            ++ E   E + C    C       + F CC      IE   G  W   R     I EH  FE  I+  IL SS  L FEDIY++   T+K  L   + +FTY+F +EM+LK ++ GF+VYFT+ W  LDF IV +SL+SL  + LG+ +E+ A +SLRT+RALRPLRA+SR++GM++VVNAL+ AIPSI NVLLVC++FWLIFSI GV  F GKF+ C++  T E    +VV N SEC   +  N T  W N  +NFDN   G+L+L Q+ATF+GWM+IM  A+DS  + LQPK E+ +  Y YFVIFI+ GSFF LNLFIGVIIDNFN+ K K+ G   D+F+T  Q+ YYN MKKL ++KP+K + RP    QG  +D      F++ I+ILI LNMV MM+E   Q+   TN+L  IN++F  +FT E ++K+  LR++YF   WN
Sbjct: 1159 VEPEESLEPEACFTEDCV------RKFKCCQI---SIEEGKGKLWWNLRKTCYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQVYFTNAWCWLDFLIVDVSLVSLTANALGY-SELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCINYTTGEMFDVSVVNNYSECKALIESNQTARWKNVKVNFDNVGLGYLSLLQVATFKGWMDIMYAAVDSRNVELQPKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQ--DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPANKFQGMVFDFVTKQVFDISIMILICLNMVTMMVETDDQSQEMTNILYWINLVFIVLFTGECVLKLISLRYYYFTIGWN 1595          

HSP 2 Score: 284.648 bits (727), Expect = 1.864e-76
Identity = 154/326 (47.24%), Postives = 228/326 (69.94%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQ-PPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFKQMT 5364
            + E ++  F++PTL RV+R+ RIGR+LRLIK AKGIR LLFAL++SLPALFNIG LL L++FIY+I GMS F  +K+  G+DD+ NFETF  S++ LF++TT+ GW+ +L  +    PP C+     +D    ++  GDCG    GI +  ++I I +L+++NMYIA+ILENF+ A  +    ++EDDFEMFY VWE++DP A+Q+I++A LSDF   LD PL I KPN + L++ DLP+V GD++HCLDIL A  K V+G   +S E   ++ QME ++    P++V    ITTT+KRK+E+++A  +QRA++    ++  K+++
Sbjct: 1611 LAELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKREVGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSGPPDCDPD---KDHPGSSV-KGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYEVWEKFDPDATQFIEFAKLSDFADALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLG---ESGEMDALRIQMEERFMASNPSKVSYEPITTTLKRKQEEVSAIIIQRAYRRYLLKQKVKKVS 1929          

HSP 3 Score: 283.878 bits (725), Expect = 2.802e-76
Identity = 169/417 (40.53%), Postives = 254/417 (60.91%), Query Frame = 3
Query:  219 HRHIDEGKLVDGELKFEVEDFSDNCQPDPELVAGSILLEDKLGEFPEELLGKPLNEIDQN-LKDKSFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPIS---EYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAF-----YYNWTHNPNNW------------IRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
             + I E K    + + + ED  +  +P+ +L AG  L     G+ P E++  PL ++D   +  K+F+V+N   K K I R+SAT +  +  P++ IRKLA+ I  + +F+  IM TIL NCVF+ ++N    +   EY F  IYT E +I++ +RG  +  +T+LRDP+N +D  +I  +Y+   V+        NVS+LRT RVLRALKTI+++PGLKTI  ALI+S+K L +V+IL++FC+S FAL  LQ++ G LRNKC++     +    N ++ F N+       +N T +  NW            +    + L CGN S AG C +     IC+   G NPN+GYT+FD F WA LS+F+L+T D+WEN Y L +RA+G   ++F+++V+F GSFYLINL+LAVV+M+Y
Sbjct:   26 EQRIAEEKAKRPKQERKDEDDENGPKPNSDLEAGKSL-PFIYGDIPPEMVSVPLEDLDPYYINKKTFIVLN---KGKAISRFSATPALYILTPFNPIRKLAIKILVHSLFNMLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKILARGFCLEDFTFLRDPWNWLDFTVITFAYVTEFVDLG------NVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPDNSSFEINITSFFNNSLDGNGTTFNRTVSIFNWDEYIEDKSHFYFLEGQNDALLCGNSSDAGQCPE---GYICV-KAGRNPNYGYTSFDTFSWAFLSLFRLMTQDFWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLINLILAVVAMAY 428          

HSP 4 Score: 200.675 bits (509), Expect = 1.017e-50
Identity = 93/223 (41.70%), Postives = 150/223 (67.26%), Query Frame = 3
Query: 1809 CSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEY-FNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHT---QIFGD-NIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIR-ANSPLCLLIFI 2459
            C  W+  ++ + + V DPF DL I+ CI +NT+ MA EHYP  + +  +L   N++FT I+  E  LKI+A+   Y F  GWNIFD  +V  S+++LG+  V+ LS+ R+FRL RVFKLA+SW T+ +L+ II +++  +GNL++++ +++++FAV+G Q +  +Y     +I  D  +PRW+  DF+HS ++VFR++CGEWIE  +DC+  A   +CL +F+
Sbjct:  742 CKPWLKVKHLVNLVVMDPFVDLAITICIVLNTLFMAMEHYPMTEQFSSVLSVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVSLSLMELGLANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKISNDCELPRWHMHDFFHSFLIVFRVLCGEWIETMWDCMEVAGQTMCLTVFM 964          

HSP 5 Score: 100.138 bits (248), Expect = 3.780e-20
Identity = 63/195 (32.31%), Postives = 114/195 (58.46%), Query Frame = 3
Query: 1827 FQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEV-----DALSIFRAFRLF---RVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFG-DNIPRWNFDDFWHSMILVFRI 2384
            FQ  ++ FVT   FD+ I   I +N + M  E     +   +IL + N++F V++  EC LK+++L   YF +GWNIFDFVVVI SI+ + + E+      + ++FR  RL    R+ +L +  + +R LL  +  ++  + N+ +++ LV++++A+ G  ++   Y  +  G D++  +NF+ F +SMI +F+I
Sbjct: 1520 FQGMVFDFVTKQVFDISIMILICLNMVTMMVETDDQSQEMTNILYWINLVFIVLFTGECVLKLISLRYYYFTIGWNIFDFVVVILSIVGMFLAELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNF--AYVKREVGIDDM--FNFETFGNSMICLFQI 1710          

HSP 6 Score: 69.707 bits (169), Expect = 5.745e-11
Identity = 56/240 (23.33%), Postives = 109/240 (45.42%), Query Frame = 3
Query: 1653 DSEEEKEGKDCDNKAEYEDEVEIGNDTNNTDTAEMNPTIDRNCQCCIKQNVL----CSK----------WVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASE--HYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIID-----LGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYH 2306
            D EE KE  +  + +E    V+IG      +  E+ P      + C  ++ +    C +          W   +   Y  V   +F+ FI F I +++  +A E  +    KT   +L+Y++ +FT I+I+E  LK +A   + YF   W   DF++V  S++      LG  E+ A+   R  R  R  +    ++ MR+++  +   I  + N+ ++ L+   +F+++G   +   ++
Sbjct: 1127 DMEESKEKLNATSSSE-GSTVDIGAPAEG-EQPEVEPEESLEPEACFTEDCVRKFKCCQISIEEGKGKLWWNLRKTCYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQVYFTNAWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFY 1364          

HSP 7 Score: 62.3882 bits (150), Expect = 1.087e-8
Identity = 77/328 (23.48%), Postives = 134/328 (40.85%), Query Frame = 3
Query:  495 WSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDY-----------PISEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGY----TNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNI-------------LFYIIVVFFGSFYLINLMLAVV 1394
            W  +RK    I  +  F+ FI+  IL++   LA  + Y             ++ VF  I+ LEM+++  + G  +    Y  + +  +D LI+ +S + +            + SLRTLR LR L+ ++   G++ + +AL+ ++  +  V+   L C+ F+ +F++                          N F   FY+             INY T        + S  N  S C   I  N    +     NFDN G   LS+ Q+ T   W    +++  A  S N+             L+++I + FGSF+ +NL + V+
Sbjct: 1194 WWNLRKTCYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQV----YFTNAWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVL---LVCLIFWLIFSIM-----------------------GVNLFAGKFYH------------CINYTT----GEMFDVSVVNNYSECKALIESNQTARWKNVKVNFDNVGLGYLSLLQVATFKGW---MDIMYAAVDSRNVELQPKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVI 1472          

HSP 8 Score: 58.151 bits (139), Expect = 1.852e-7
Identity = 48/202 (23.76%), Postives = 97/202 (48.02%), Query Frame = 3
Query:  486 CAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPISE----------YVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAF 1061
            C PW  ++ L  L+  +   D  I + I++N +F+A+ + YP++E           VF  I+T EM +++    + ++ Y Y ++ +N+ D  I+ LS + + +    G     +S LR+ R+LR  K     P L  +   +  S+  L  + ++    +  FA+  +Q++ G    +CV  +     +   H ++F ++F
Sbjct:  742 CKPWLKVKHLVNLVVMDPFVDLAITICIVLNTLFMAMEH-YPMTEQFSSVLSVGNLVFTGIFTAEMFLKI----IAMDPYYYFQEGWNIFDGFIVSLSLMELGLANVEG-----LSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLF-GKSYKECVCKISNDCELPRWHMHDFFHSF 932          

HSP 9 Score: 52.7582 bits (125), Expect = 9.421e-6
Identity = 48/188 (25.53%), Postives = 87/188 (46.28%), Query Frame = 3
Query: 3027 CIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCL 3590
            C++ D    C   W   ++   L+      +  I +CI+ +++ +  E   +         L V N +FT +F  EM LKII++    YF   W I D FIVS+SL+ L          +     LR+ R LR  +    W  + +++  +  ++ ++ N+ LV  +   IF++ G+Q F   + +C+
Sbjct:  736 CLIWD----CCKPWLKVKHLVNLVVMDPFVDLAITICIVLNTLFMAMEHYPMTEQ--FSSVLSVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVSLSLMELGL------ANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECV 911          
BLAST of Sodium channel protein vs. Ensembl Human
Match: SCN2A (sodium voltage-gated channel alpha subunit 2 [Source:HGNC Symbol;Acc:HGNC:10588])

HSP 1 Score: 388.652 bits (997), Expect = 5.801e-109
Identity = 216/449 (48.11%), Postives = 289/449 (64.37%), Query Frame = 3
Query: 2934 IDEESVNELKGCCCAICYNPFQEKKPFHCCYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSEC---LRQNHT--WANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            ++ E   E + C    C       + F CC      IE   G  W   R     I EH  FE  I+  IL SS  L FEDIY++   T+K  L   + +FTY+F +EM+LK ++ GF+VYFT+ W  LDF IV +SL+SL  + LG+ +E+ A +SLRT+RALRPLRA+SR++GM++VVNAL+ AIPSI NVLLVC++FWLIFSI GV  F GKF+ C++  T E    +VV N SEC   +  N T  W N  +NFDN   G+L+L Q+ATF+GWM+IM  A+DS  + LQPK E+ +  Y YFVIFI+ GSFF LNLFIGVIIDNFN+ K K+ G   D+F+T  Q+ YYN MKKL ++KP+K + RP    QG  +D      F++ I+ILI LNMV MM+E   Q+   TN+L  IN++F  +FT E ++K+  LR++YF   WN
Sbjct: 1159 VEPEESLEPEACFTEDCV------RKFKCCQI---SIEEGKGKLWWNLRKTCYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQVYFTNAWCWLDFLIVDVSLVSLTANALGY-SELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCINYTTGEMFDVSVVNNYSECKALIESNQTARWKNVKVNFDNVGLGYLSLLQVATFKGWMDIMYAAVDSRNVELQPKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQ--DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPANKFQGMVFDFVTKQVFDISIMILICLNMVTMMVETDDQSQEMTNILYWINLVFIVLFTGECVLKLISLRYYYFTIGWN 1595          

HSP 2 Score: 284.648 bits (727), Expect = 1.864e-76
Identity = 154/326 (47.24%), Postives = 228/326 (69.94%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQ-PPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFKQMT 5364
            + E ++  F++PTL RV+R+ RIGR+LRLIK AKGIR LLFAL++SLPALFNIG LL L++FIY+I GMS F  +K+  G+DD+ NFETF  S++ LF++TT+ GW+ +L  +    PP C+     +D    ++  GDCG    GI +  ++I I +L+++NMYIA+ILENF+ A  +    ++EDDFEMFY VWE++DP A+Q+I++A LSDF   LD PL I KPN + L++ DLP+V GD++HCLDIL A  K V+G   +S E   ++ QME ++    P++V    ITTT+KRK+E+++A  +QRA++    ++  K+++
Sbjct: 1611 LAELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKREVGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSGPPDCDPD---KDHPGSSV-KGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYEVWEKFDPDATQFIEFAKLSDFADALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLG---ESGEMDALRIQMEERFMASNPSKVSYEPITTTLKRKQEEVSAIIIQRAYRRYLLKQKVKKVS 1929          

HSP 3 Score: 283.878 bits (725), Expect = 2.802e-76
Identity = 169/417 (40.53%), Postives = 254/417 (60.91%), Query Frame = 3
Query:  219 HRHIDEGKLVDGELKFEVEDFSDNCQPDPELVAGSILLEDKLGEFPEELLGKPLNEIDQN-LKDKSFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPIS---EYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAF-----YYNWTHNPNNW------------IRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
             + I E K    + + + ED  +  +P+ +L AG  L     G+ P E++  PL ++D   +  K+F+V+N   K K I R+SAT +  +  P++ IRKLA+ I  + +F+  IM TIL NCVF+ ++N    +   EY F  IYT E +I++ +RG  +  +T+LRDP+N +D  +I  +Y+   V+        NVS+LRT RVLRALKTI+++PGLKTI  ALI+S+K L +V+IL++FC+S FAL  LQ++ G LRNKC++     +    N ++ F N+       +N T +  NW            +    + L CGN S AG C +     IC+   G NPN+GYT+FD F WA LS+F+L+T D+WEN Y L +RA+G   ++F+++V+F GSFYLINL+LAVV+M+Y
Sbjct:   26 EQRIAEEKAKRPKQERKDEDDENGPKPNSDLEAGKSL-PFIYGDIPPEMVSVPLEDLDPYYINKKTFIVLN---KGKAISRFSATPALYILTPFNPIRKLAIKILVHSLFNMLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKILARGFCLEDFTFLRDPWNWLDFTVITFAYVTEFVDLG------NVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPDNSSFEINITSFFNNSLDGNGTTFNRTVSIFNWDEYIEDKSHFYFLEGQNDALLCGNSSDAGQCPE---GYICV-KAGRNPNYGYTSFDTFSWAFLSLFRLMTQDFWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLINLILAVVAMAY 428          

HSP 4 Score: 200.675 bits (509), Expect = 1.017e-50
Identity = 93/223 (41.70%), Postives = 150/223 (67.26%), Query Frame = 3
Query: 1809 CSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEY-FNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHT---QIFGD-NIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIR-ANSPLCLLIFI 2459
            C  W+  ++ + + V DPF DL I+ CI +NT+ MA EHYP  + +  +L   N++FT I+  E  LKI+A+   Y F  GWNIFD  +V  S+++LG+  V+ LS+ R+FRL RVFKLA+SW T+ +L+ II +++  +GNL++++ +++++FAV+G Q +  +Y     +I  D  +PRW+  DF+HS ++VFR++CGEWIE  +DC+  A   +CL +F+
Sbjct:  742 CKPWLKVKHLVNLVVMDPFVDLAITICIVLNTLFMAMEHYPMTEQFSSVLSVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVSLSLMELGLANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKISNDCELPRWHMHDFFHSFLIVFRVLCGEWIETMWDCMEVAGQTMCLTVFM 964          

HSP 5 Score: 100.138 bits (248), Expect = 3.780e-20
Identity = 63/195 (32.31%), Postives = 114/195 (58.46%), Query Frame = 3
Query: 1827 FQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEV-----DALSIFRAFRLF---RVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFG-DNIPRWNFDDFWHSMILVFRI 2384
            FQ  ++ FVT   FD+ I   I +N + M  E     +   +IL + N++F V++  EC LK+++L   YF +GWNIFDFVVVI SI+ + + E+      + ++FR  RL    R+ +L +  + +R LL  +  ++  + N+ +++ LV++++A+ G  ++   Y  +  G D++  +NF+ F +SMI +F+I
Sbjct: 1520 FQGMVFDFVTKQVFDISIMILICLNMVTMMVETDDQSQEMTNILYWINLVFIVLFTGECVLKLISLRYYYFTIGWNIFDFVVVILSIVGMFLAELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNF--AYVKREVGIDDM--FNFETFGNSMICLFQI 1710          

HSP 6 Score: 69.707 bits (169), Expect = 5.745e-11
Identity = 56/240 (23.33%), Postives = 109/240 (45.42%), Query Frame = 3
Query: 1653 DSEEEKEGKDCDNKAEYEDEVEIGNDTNNTDTAEMNPTIDRNCQCCIKQNVL----CSK----------WVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASE--HYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIID-----LGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYH 2306
            D EE KE  +  + +E    V+IG      +  E+ P      + C  ++ +    C +          W   +   Y  V   +F+ FI F I +++  +A E  +    KT   +L+Y++ +FT I+I+E  LK +A   + YF   W   DF++V  S++      LG  E+ A+   R  R  R  +    ++ MR+++  +   I  + N+ ++ L+   +F+++G   +   ++
Sbjct: 1127 DMEESKEKLNATSSSE-GSTVDIGAPAEG-EQPEVEPEESLEPEACFTEDCVRKFKCCQISIEEGKGKLWWNLRKTCYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQVYFTNAWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFY 1364          

HSP 7 Score: 62.3882 bits (150), Expect = 1.087e-8
Identity = 77/328 (23.48%), Postives = 134/328 (40.85%), Query Frame = 3
Query:  495 WSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDY-----------PISEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGY----TNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNI-------------LFYIIVVFFGSFYLINLMLAVV 1394
            W  +RK    I  +  F+ FI+  IL++   LA  + Y             ++ VF  I+ LEM+++  + G  +    Y  + +  +D LI+ +S + +            + SLRTLR LR L+ ++   G++ + +AL+ ++  +  V+   L C+ F+ +F++                          N F   FY+             INY T        + S  N  S C   I  N    +     NFDN G   LS+ Q+ T   W    +++  A  S N+             L+++I + FGSF+ +NL + V+
Sbjct: 1194 WWNLRKTCYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQV----YFTNAWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVL---LVCLIFWLIFSIM-----------------------GVNLFAGKFYH------------CINYTT----GEMFDVSVVNNYSECKALIESNQTARWKNVKVNFDNVGLGYLSLLQVATFKGW---MDIMYAAVDSRNVELQPKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVI 1472          

HSP 8 Score: 58.151 bits (139), Expect = 1.852e-7
Identity = 48/202 (23.76%), Postives = 97/202 (48.02%), Query Frame = 3
Query:  486 CAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPISE----------YVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAF 1061
            C PW  ++ L  L+  +   D  I + I++N +F+A+ + YP++E           VF  I+T EM +++    + ++ Y Y ++ +N+ D  I+ LS + + +    G     +S LR+ R+LR  K     P L  +   +  S+  L  + ++    +  FA+  +Q++ G    +CV  +     +   H ++F ++F
Sbjct:  742 CKPWLKVKHLVNLVVMDPFVDLAITICIVLNTLFMAMEH-YPMTEQFSSVLSVGNLVFTGIFTAEMFLKI----IAMDPYYYFQEGWNIFDGFIVSLSLMELGLANVEG-----LSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLF-GKSYKECVCKISNDCELPRWHMHDFFHSF 932          

HSP 9 Score: 52.7582 bits (125), Expect = 9.421e-6
Identity = 48/188 (25.53%), Postives = 87/188 (46.28%), Query Frame = 3
Query: 3027 CIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCL 3590
            C++ D    C   W   ++   L+      +  I +CI+ +++ +  E   +         L V N +FT +F  EM LKII++    YF   W I D FIVS+SL+ L          +     LR+ R LR  +    W  + +++  +  ++ ++ N+ LV  +   IF++ G+Q F   + +C+
Sbjct:  736 CLIWD----CCKPWLKVKHLVNLVVMDPFVDLAITICIVLNTLFMAMEHYPMTEQ--FSSVLSVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVSLSLMELGL------ANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECV 911          
BLAST of Sodium channel protein vs. Ensembl Human
Match: SCN2A (sodium voltage-gated channel alpha subunit 2 [Source:HGNC Symbol;Acc:HGNC:10588])

HSP 1 Score: 388.652 bits (997), Expect = 5.801e-109
Identity = 216/449 (48.11%), Postives = 289/449 (64.37%), Query Frame = 3
Query: 2934 IDEESVNELKGCCCAICYNPFQEKKPFHCCYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSEC---LRQNHT--WANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            ++ E   E + C    C       + F CC      IE   G  W   R     I EH  FE  I+  IL SS  L FEDIY++   T+K  L   + +FTY+F +EM+LK ++ GF+VYFT+ W  LDF IV +SL+SL  + LG+ +E+ A +SLRT+RALRPLRA+SR++GM++VVNAL+ AIPSI NVLLVC++FWLIFSI GV  F GKF+ C++  T E    +VV N SEC   +  N T  W N  +NFDN   G+L+L Q+ATF+GWM+IM  A+DS  + LQPK E+ +  Y YFVIFI+ GSFF LNLFIGVIIDNFN+ K K+ G   D+F+T  Q+ YYN MKKL ++KP+K + RP    QG  +D      F++ I+ILI LNMV MM+E   Q+   TN+L  IN++F  +FT E ++K+  LR++YF   WN
Sbjct: 1159 VEPEESLEPEACFTEDCV------RKFKCCQI---SIEEGKGKLWWNLRKTCYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQVYFTNAWCWLDFLIVDVSLVSLTANALGY-SELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCINYTTGEMFDVSVVNNYSECKALIESNQTARWKNVKVNFDNVGLGYLSLLQVATFKGWMDIMYAAVDSRNVELQPKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQ--DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPANKFQGMVFDFVTKQVFDISIMILICLNMVTMMVETDDQSQEMTNILYWINLVFIVLFTGECVLKLISLRYYYFTIGWN 1595          

HSP 2 Score: 284.648 bits (727), Expect = 1.864e-76
Identity = 154/326 (47.24%), Postives = 228/326 (69.94%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQ-PPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFKQMT 5364
            + E ++  F++PTL RV+R+ RIGR+LRLIK AKGIR LLFAL++SLPALFNIG LL L++FIY+I GMS F  +K+  G+DD+ NFETF  S++ LF++TT+ GW+ +L  +    PP C+     +D    ++  GDCG    GI +  ++I I +L+++NMYIA+ILENF+ A  +    ++EDDFEMFY VWE++DP A+Q+I++A LSDF   LD PL I KPN + L++ DLP+V GD++HCLDIL A  K V+G   +S E   ++ QME ++    P++V    ITTT+KRK+E+++A  +QRA++    ++  K+++
Sbjct: 1611 LAELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKREVGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSGPPDCDPD---KDHPGSSV-KGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYEVWEKFDPDATQFIEFAKLSDFADALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLG---ESGEMDALRIQMEERFMASNPSKVSYEPITTTLKRKQEEVSAIIIQRAYRRYLLKQKVKKVS 1929          

HSP 3 Score: 283.878 bits (725), Expect = 2.802e-76
Identity = 169/417 (40.53%), Postives = 254/417 (60.91%), Query Frame = 3
Query:  219 HRHIDEGKLVDGELKFEVEDFSDNCQPDPELVAGSILLEDKLGEFPEELLGKPLNEIDQN-LKDKSFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPIS---EYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAF-----YYNWTHNPNNW------------IRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
             + I E K    + + + ED  +  +P+ +L AG  L     G+ P E++  PL ++D   +  K+F+V+N   K K I R+SAT +  +  P++ IRKLA+ I  + +F+  IM TIL NCVF+ ++N    +   EY F  IYT E +I++ +RG  +  +T+LRDP+N +D  +I  +Y+   V+        NVS+LRT RVLRALKTI+++PGLKTI  ALI+S+K L +V+IL++FC+S FAL  LQ++ G LRNKC++     +    N ++ F N+       +N T +  NW            +    + L CGN S AG C +     IC+   G NPN+GYT+FD F WA LS+F+L+T D+WEN Y L +RA+G   ++F+++V+F GSFYLINL+LAVV+M+Y
Sbjct:   26 EQRIAEEKAKRPKQERKDEDDENGPKPNSDLEAGKSL-PFIYGDIPPEMVSVPLEDLDPYYINKKTFIVLN---KGKAISRFSATPALYILTPFNPIRKLAIKILVHSLFNMLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKILARGFCLEDFTFLRDPWNWLDFTVITFAYVTEFVDLG------NVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPDNSSFEINITSFFNNSLDGNGTTFNRTVSIFNWDEYIEDKSHFYFLEGQNDALLCGNSSDAGQCPE---GYICV-KAGRNPNYGYTSFDTFSWAFLSLFRLMTQDFWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLINLILAVVAMAY 428          

HSP 4 Score: 200.675 bits (509), Expect = 1.017e-50
Identity = 93/223 (41.70%), Postives = 150/223 (67.26%), Query Frame = 3
Query: 1809 CSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEY-FNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHT---QIFGD-NIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIR-ANSPLCLLIFI 2459
            C  W+  ++ + + V DPF DL I+ CI +NT+ MA EHYP  + +  +L   N++FT I+  E  LKI+A+   Y F  GWNIFD  +V  S+++LG+  V+ LS+ R+FRL RVFKLA+SW T+ +L+ II +++  +GNL++++ +++++FAV+G Q +  +Y     +I  D  +PRW+  DF+HS ++VFR++CGEWIE  +DC+  A   +CL +F+
Sbjct:  742 CKPWLKVKHLVNLVVMDPFVDLAITICIVLNTLFMAMEHYPMTEQFSSVLSVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVSLSLMELGLANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKISNDCELPRWHMHDFFHSFLIVFRVLCGEWIETMWDCMEVAGQTMCLTVFM 964          

HSP 5 Score: 100.138 bits (248), Expect = 3.780e-20
Identity = 63/195 (32.31%), Postives = 114/195 (58.46%), Query Frame = 3
Query: 1827 FQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEV-----DALSIFRAFRLF---RVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFG-DNIPRWNFDDFWHSMILVFRI 2384
            FQ  ++ FVT   FD+ I   I +N + M  E     +   +IL + N++F V++  EC LK+++L   YF +GWNIFDFVVVI SI+ + + E+      + ++FR  RL    R+ +L +  + +R LL  +  ++  + N+ +++ LV++++A+ G  ++   Y  +  G D++  +NF+ F +SMI +F+I
Sbjct: 1520 FQGMVFDFVTKQVFDISIMILICLNMVTMMVETDDQSQEMTNILYWINLVFIVLFTGECVLKLISLRYYYFTIGWNIFDFVVVILSIVGMFLAELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNF--AYVKREVGIDDM--FNFETFGNSMICLFQI 1710          

HSP 6 Score: 69.707 bits (169), Expect = 5.745e-11
Identity = 56/240 (23.33%), Postives = 109/240 (45.42%), Query Frame = 3
Query: 1653 DSEEEKEGKDCDNKAEYEDEVEIGNDTNNTDTAEMNPTIDRNCQCCIKQNVL----CSK----------WVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASE--HYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIID-----LGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYH 2306
            D EE KE  +  + +E    V+IG      +  E+ P      + C  ++ +    C +          W   +   Y  V   +F+ FI F I +++  +A E  +    KT   +L+Y++ +FT I+I+E  LK +A   + YF   W   DF++V  S++      LG  E+ A+   R  R  R  +    ++ MR+++  +   I  + N+ ++ L+   +F+++G   +   ++
Sbjct: 1127 DMEESKEKLNATSSSE-GSTVDIGAPAEG-EQPEVEPEESLEPEACFTEDCVRKFKCCQISIEEGKGKLWWNLRKTCYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQVYFTNAWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFY 1364          

HSP 7 Score: 62.3882 bits (150), Expect = 1.087e-8
Identity = 77/328 (23.48%), Postives = 134/328 (40.85%), Query Frame = 3
Query:  495 WSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDY-----------PISEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGY----TNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNI-------------LFYIIVVFFGSFYLINLMLAVV 1394
            W  +RK    I  +  F+ FI+  IL++   LA  + Y             ++ VF  I+ LEM+++  + G  +    Y  + +  +D LI+ +S + +            + SLRTLR LR L+ ++   G++ + +AL+ ++  +  V+   L C+ F+ +F++                          N F   FY+             INY T        + S  N  S C   I  N    +     NFDN G   LS+ Q+ T   W    +++  A  S N+             L+++I + FGSF+ +NL + V+
Sbjct: 1194 WWNLRKTCYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQV----YFTNAWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVL---LVCLIFWLIFSIM-----------------------GVNLFAGKFYH------------CINYTT----GEMFDVSVVNNYSECKALIESNQTARWKNVKVNFDNVGLGYLSLLQVATFKGW---MDIMYAAVDSRNVELQPKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVI 1472          

HSP 8 Score: 58.151 bits (139), Expect = 1.852e-7
Identity = 48/202 (23.76%), Postives = 97/202 (48.02%), Query Frame = 3
Query:  486 CAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPISE----------YVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAF 1061
            C PW  ++ L  L+  +   D  I + I++N +F+A+ + YP++E           VF  I+T EM +++    + ++ Y Y ++ +N+ D  I+ LS + + +    G     +S LR+ R+LR  K     P L  +   +  S+  L  + ++    +  FA+  +Q++ G    +CV  +     +   H ++F ++F
Sbjct:  742 CKPWLKVKHLVNLVVMDPFVDLAITICIVLNTLFMAMEH-YPMTEQFSSVLSVGNLVFTGIFTAEMFLKI----IAMDPYYYFQEGWNIFDGFIVSLSLMELGLANVEG-----LSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLF-GKSYKECVCKISNDCELPRWHMHDFFHSF 932          

HSP 9 Score: 52.7582 bits (125), Expect = 9.421e-6
Identity = 48/188 (25.53%), Postives = 87/188 (46.28%), Query Frame = 3
Query: 3027 CIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCL 3590
            C++ D    C   W   ++   L+      +  I +CI+ +++ +  E   +         L V N +FT +F  EM LKII++    YF   W I D FIVS+SL+ L          +     LR+ R LR  +    W  + +++  +  ++ ++ N+ LV  +   IF++ G+Q F   + +C+
Sbjct:  736 CLIWD----CCKPWLKVKHLVNLVVMDPFVDLAITICIVLNTLFMAMEHYPMTEQ--FSSVLSVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVSLSLMELGL------ANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECV 911          
BLAST of Sodium channel protein vs. Ensembl Human
Match: SCN2A (sodium voltage-gated channel alpha subunit 2 [Source:HGNC Symbol;Acc:HGNC:10588])

HSP 1 Score: 387.882 bits (995), Expect = 5.977e-109
Identity = 216/449 (48.11%), Postives = 289/449 (64.37%), Query Frame = 3
Query: 2934 IDEESVNELKGCCCAICYNPFQEKKPFHCCYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSEC---LRQNHT--WANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            ++ E   E + C    C       + F CC      IE   G  W   R     I EH  FE  I+  IL SS  L FEDIY++   T+K  L   + +FTY+F +EM+LK ++ GF+VYFT+ W  LDF IV +SL+SL  + LG+ +E+ A +SLRT+RALRPLRA+SR++GM++VVNAL+ AIPSI NVLLVC++FWLIFSI GV  F GKF+ C++  T E    +VV N SEC   +  N T  W N  +NFDN   G+L+L Q+ATF+GWM+IM  A+DS  + LQPK E+ +  Y YFVIFI+ GSFF LNLFIGVIIDNFN+ K K+ G   D+F+T  Q+ YYN MKKL ++KP+K + RP    QG  +D      F++ I+ILI LNMV MM+E   Q+   TN+L  IN++F  +FT E ++K+  LR++YF   WN
Sbjct: 1027 VEPEESLEPEACFTEDCV------RKFKCCQI---SIEEGKGKLWWNLRKTCYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQVYFTNAWCWLDFLIVDVSLVSLTANALGY-SELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCINYTTGEMFDVSVVNNYSECKALIESNQTARWKNVKVNFDNVGLGYLSLLQVATFKGWMDIMYAAVDSRNVELQPKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQ--DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPANKFQGMVFDFVTKQVFDISIMILICLNMVTMMVETDDQSQEMTNILYWINLVFIVLFTGECVLKLISLRYYYFTIGWN 1463          

HSP 2 Score: 284.263 bits (726), Expect = 1.881e-76
Identity = 154/326 (47.24%), Postives = 228/326 (69.94%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQ-PPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFKQMT 5364
            + E ++  F++PTL RV+R+ RIGR+LRLIK AKGIR LLFAL++SLPALFNIG LL L++FIY+I GMS F  +K+  G+DD+ NFETF  S++ LF++TT+ GW+ +L  +    PP C+     +D    ++  GDCG    GI +  ++I I +L+++NMYIA+ILENF+ A  +    ++EDDFEMFY VWE++DP A+Q+I++A LSDF   LD PL I KPN + L++ DLP+V GD++HCLDIL A  K V+G   +S E   ++ QME ++    P++V    ITTT+KRK+E+++A  +QRA++    ++  K+++
Sbjct: 1479 LAELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKREVGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSGPPDCDPD---KDHPGSSV-KGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYEVWEKFDPDATQFIEFAKLSDFADALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLG---ESGEMDALRIQMEERFMASNPSKVSYEPITTTLKRKQEEVSAIIIQRAYRRYLLKQKVKKVS 1797          

HSP 3 Score: 237.654 bits (605), Expect = 4.431e-62
Identity = 134/305 (43.93%), Postives = 193/305 (63.28%), Query Frame = 3
Query:  552 FIMLTILVNCVFLALNNDYPIS---EYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAF-----YYNWTHNPNNW------------IRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
             IM TIL NCVF+ ++N    +   EY F  IYT E +I++ +RG  +  +T+LRDP+N +D  +I  +Y+   V+        NVS+LRT RVLRALKTI+++PGLKTI  ALI+S+K L +V+IL++FC+S FAL  LQ++ G LRNKC++     +    N ++ F N+       +N T +  NW            +    + L CGN S AG C +     IC+   G NPN+GYT+FD F WA LS+F+L+T D+WEN Y L +RA+G   ++F+++V+F GSFYLINL+LAVV+M+Y
Sbjct:    2 LIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKILARGFCLEDFTFLRDPWNWLDFTVITFAYVTEFVDLG------NVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPDNSSFEINITSFFNNSLDGNGTTFNRTVSIFNWDEYIEDKSHFYFLEGQNDALLCGNSSDAGQCPE---GYICV-KAGRNPNYGYTSFDTFSWAFLSLFRLMTQDFWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLINLILAVVAMAY 296          

HSP 4 Score: 199.904 bits (507), Expect = 1.320e-50
Identity = 93/223 (41.70%), Postives = 150/223 (67.26%), Query Frame = 3
Query: 1809 CSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEY-FNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHT---QIFGD-NIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIR-ANSPLCLLIFI 2459
            C  W+  ++ + + V DPF DL I+ CI +NT+ MA EHYP  + +  +L   N++FT I+  E  LKI+A+   Y F  GWNIFD  +V  S+++LG+  V+ LS+ R+FRL RVFKLA+SW T+ +L+ II +++  +GNL++++ +++++FAV+G Q +  +Y     +I  D  +PRW+  DF+HS ++VFR++CGEWIE  +DC+  A   +CL +F+
Sbjct:  610 CKPWLKVKHLVNLVVMDPFVDLAITICIVLNTLFMAMEHYPMTEQFSSVLSVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVSLSLMELGLANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKISNDCELPRWHMHDFFHSFLIVFRVLCGEWIETMWDCMEVAGQTMCLTVFM 832          

HSP 5 Score: 99.7525 bits (247), Expect = 4.574e-20
Identity = 63/195 (32.31%), Postives = 114/195 (58.46%), Query Frame = 3
Query: 1827 FQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEV-----DALSIFRAFRLF---RVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFG-DNIPRWNFDDFWHSMILVFRI 2384
            FQ  ++ FVT   FD+ I   I +N + M  E     +   +IL + N++F V++  EC LK+++L   YF +GWNIFDFVVVI SI+ + + E+      + ++FR  RL    R+ +L +  + +R LL  +  ++  + N+ +++ LV++++A+ G  ++   Y  +  G D++  +NF+ F +SMI +F+I
Sbjct: 1388 FQGMVFDFVTKQVFDISIMILICLNMVTMMVETDDQSQEMTNILYWINLVFIVLFTGECVLKLISLRYYYFTIGWNIFDFVVVILSIVGMFLAELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNF--AYVKREVGIDDM--FNFETFGNSMICLFQI 1578          

HSP 6 Score: 69.707 bits (169), Expect = 6.227e-11
Identity = 56/240 (23.33%), Postives = 109/240 (45.42%), Query Frame = 3
Query: 1653 DSEEEKEGKDCDNKAEYEDEVEIGNDTNNTDTAEMNPTIDRNCQCCIKQNVL----CSK----------WVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASE--HYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIID-----LGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYH 2306
            D EE KE  +  + +E    V+IG      +  E+ P      + C  ++ +    C +          W   +   Y  V   +F+ FI F I +++  +A E  +    KT   +L+Y++ +FT I+I+E  LK +A   + YF   W   DF++V  S++      LG  E+ A+   R  R  R  +    ++ MR+++  +   I  + N+ ++ L+   +F+++G   +   ++
Sbjct:  995 DMEESKEKLNATSSSE-GSTVDIGAPAEG-EQPEVEPEESLEPEACFTEDCVRKFKCCQISIEEGKGKLWWNLRKTCYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQVYFTNAWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFY 1232          

HSP 7 Score: 62.7734 bits (151), Expect = 9.092e-9
Identity = 77/328 (23.48%), Postives = 134/328 (40.85%), Query Frame = 3
Query:  495 WSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDY-----------PISEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGY----TNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNI-------------LFYIIVVFFGSFYLINLMLAVV 1394
            W  +RK    I  +  F+ FI+  IL++   LA  + Y             ++ VF  I+ LEM+++  + G  +    Y  + +  +D LI+ +S + +            + SLRTLR LR L+ ++   G++ + +AL+ ++  +  V+   L C+ F+ +F++                          N F   FY+             INY T        + S  N  S C   I  N    +     NFDN G   LS+ Q+ T   W    +++  A  S N+             L+++I + FGSF+ +NL + V+
Sbjct: 1062 WWNLRKTCYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQV----YFTNAWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVL---LVCLIFWLIFSIM-----------------------GVNLFAGKFYH------------CINYTT----GEMFDVSVVNNYSECKALIESNQTARWKNVKVNFDNVGLGYLSLLQVATFKGW---MDIMYAAVDSRNVELQPKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVI 1340          

HSP 8 Score: 58.151 bits (139), Expect = 1.804e-7
Identity = 48/202 (23.76%), Postives = 97/202 (48.02%), Query Frame = 3
Query:  486 CAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPISE----------YVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAF 1061
            C PW  ++ L  L+  +   D  I + I++N +F+A+ + YP++E           VF  I+T EM +++    + ++ Y Y ++ +N+ D  I+ LS + + +    G     +S LR+ R+LR  K     P L  +   +  S+  L  + ++    +  FA+  +Q++ G    +CV  +     +   H ++F ++F
Sbjct:  610 CKPWLKVKHLVNLVVMDPFVDLAITICIVLNTLFMAMEH-YPMTEQFSSVLSVGNLVFTGIFTAEMFLKI----IAMDPYYYFQEGWNIFDGFIVSLSLMELGLANVEG-----LSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLF-GKSYKECVCKISNDCELPRWHMHDFFHSF 800          
BLAST of Sodium channel protein vs. Ensembl Human
Match: SCN2A (sodium voltage-gated channel alpha subunit 2 [Source:HGNC Symbol;Acc:HGNC:10588])

HSP 1 Score: 388.652 bits (997), Expect = 6.010e-109
Identity = 216/449 (48.11%), Postives = 289/449 (64.37%), Query Frame = 3
Query: 2934 IDEESVNELKGCCCAICYNPFQEKKPFHCCYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSEC---LRQNHT--WANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            ++ E   E + C    C       + F CC      IE   G  W   R     I EH  FE  I+  IL SS  L FEDIY++   T+K  L   + +FTY+F +EM+LK ++ GF+VYFT+ W  LDF IV +SL+SL  + LG+ +E+ A +SLRT+RALRPLRA+SR++GM++VVNAL+ AIPSI NVLLVC++FWLIFSI GV  F GKF+ C++  T E    +VV N SEC   +  N T  W N  +NFDN   G+L+L Q+ATF+GWM+IM  A+DS  + LQPK E+ +  Y YFVIFI+ GSFF LNLFIGVIIDNFN+ K K+ G   D+F+T  Q+ YYN MKKL ++KP+K + RP    QG  +D      F++ I+ILI LNMV MM+E   Q+   TN+L  IN++F  +FT E ++K+  LR++YF   WN
Sbjct: 1159 VEPEESLEPEACFTEDCV------RKFKCCQI---SIEEGKGKLWWNLRKTCYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQVYFTNAWCWLDFLIVDVSLVSLTANALGY-SELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCINYTTGEMFDVSVVNNYSECKALIESNQTARWKNVKVNFDNVGLGYLSLLQVATFKGWMDIMYAAVDSRNVELQPKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQ--DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPANKFQGMVFDFVTKQVFDISIMILICLNMVTMMVETDDQSQEMTNILYWINLVFIVLFTGECVLKLISLRYYYFTIGWN 1595          

HSP 2 Score: 284.648 bits (727), Expect = 1.665e-76
Identity = 170/417 (40.77%), Postives = 254/417 (60.91%), Query Frame = 3
Query:  219 HRHIDEGKLVDGELKFEVEDFSDNCQPDPELVAGSILLEDKLGEFPEELLGKPLNEIDQN-LKDKSFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPIS---EYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAF-----YYNWTHNPNNW------------IRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
             + I E K    + + + ED  +  +P+ +L AG  L     G+ P E++  PL ++D   +  K+F+V+N   K K I R+SAT +  +  P++ IRKLA+ I  + +F+  IM TIL NCVF+ ++N    +   EY F  IYT E +I++ +RG  +  +T+LRDP+N +D  +I  +Y+   V      N  NVS+LRT RVLRALKTI+++PGLKTI  ALI+S+K L +V+IL++FC+S FAL  LQ++ G LRNKC++     +    N ++ F N+       +N T +  NW            +    + L CGN S AG C +     IC+   G NPN+GYT+FD F WA LS+F+L+T D+WEN Y L +RA+G   ++F+++V+F GSFYLINL+LAVV+M+Y
Sbjct:   26 EQRIAEEKAKRPKQERKDEDDENGPKPNSDLEAGKSL-PFIYGDIPPEMVSVPLEDLDPYYINKKTFIVLN---KGKAISRFSATPALYILTPFNPIRKLAIKILVHSLFNMLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKILARGFCLEDFTFLRDPWNWLDFTVITFAYVTEFV------NLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPDNSSFEINITSFFNNSLDGNGTTFNRTVSIFNWDEYIEDKSHFYFLEGQNDALLCGNSSDAGQCPE---GYICV-KAGRNPNYGYTSFDTFSWAFLSLFRLMTQDFWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLINLILAVVAMAY 428          

HSP 3 Score: 284.263 bits (726), Expect = 1.945e-76
Identity = 154/326 (47.24%), Postives = 228/326 (69.94%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQ-PPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFKQMT 5364
            + E ++  F++PTL RV+R+ RIGR+LRLIK AKGIR LLFAL++SLPALFNIG LL L++FIY+I GMS F  +K+  G+DD+ NFETF  S++ LF++TT+ GW+ +L  +    PP C+     +D    ++  GDCG    GI +  ++I I +L+++NMYIA+ILENF+ A  +    ++EDDFEMFY VWE++DP A+Q+I++A LSDF   LD PL I KPN + L++ DLP+V GD++HCLDIL A  K V+G   +S E   ++ QME ++    P++V    ITTT+KRK+E+++A  +QRA++    ++  K+++
Sbjct: 1611 LAELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKREVGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSGPPDCDPD---KDHPGSSV-KGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYEVWEKFDPDATQFIEFAKLSDFADALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLG---ESGEMDALRIQMEERFMASNPSKVSYEPITTTLKRKQEEVSAIIIQRAYRRYLLKQKVKKVS 1929          

HSP 4 Score: 200.29 bits (508), Expect = 1.025e-50
Identity = 93/223 (41.70%), Postives = 150/223 (67.26%), Query Frame = 3
Query: 1809 CSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEY-FNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHT---QIFGD-NIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIR-ANSPLCLLIFI 2459
            C  W+  ++ + + V DPF DL I+ CI +NT+ MA EHYP  + +  +L   N++FT I+  E  LKI+A+   Y F  GWNIFD  +V  S+++LG+  V+ LS+ R+FRL RVFKLA+SW T+ +L+ II +++  +GNL++++ +++++FAV+G Q +  +Y     +I  D  +PRW+  DF+HS ++VFR++CGEWIE  +DC+  A   +CL +F+
Sbjct:  742 CKPWLKVKHLVNLVVMDPFVDLAITICIVLNTLFMAMEHYPMTEQFSSVLSVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVSLSLMELGLANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKISNDCELPRWHMHDFFHSFLIVFRVLCGEWIETMWDCMEVAGQTMCLTVFM 964          

HSP 5 Score: 100.138 bits (248), Expect = 3.685e-20
Identity = 63/195 (32.31%), Postives = 114/195 (58.46%), Query Frame = 3
Query: 1827 FQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEV-----DALSIFRAFRLF---RVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFG-DNIPRWNFDDFWHSMILVFRI 2384
            FQ  ++ FVT   FD+ I   I +N + M  E     +   +IL + N++F V++  EC LK+++L   YF +GWNIFDFVVVI SI+ + + E+      + ++FR  RL    R+ +L +  + +R LL  +  ++  + N+ +++ LV++++A+ G  ++   Y  +  G D++  +NF+ F +SMI +F+I
Sbjct: 1520 FQGMVFDFVTKQVFDISIMILICLNMVTMMVETDDQSQEMTNILYWINLVFIVLFTGECVLKLISLRYYYFTIGWNIFDFVVVILSIVGMFLAELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNF--AYVKREVGIDDM--FNFETFGNSMICLFQI 1710          

HSP 6 Score: 70.0922 bits (170), Expect = 5.555e-11
Identity = 56/240 (23.33%), Postives = 109/240 (45.42%), Query Frame = 3
Query: 1653 DSEEEKEGKDCDNKAEYEDEVEIGNDTNNTDTAEMNPTIDRNCQCCIKQNVL----CSK----------WVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASE--HYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIID-----LGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYH 2306
            D EE KE  +  + +E    V+IG      +  E+ P      + C  ++ +    C +          W   +   Y  V   +F+ FI F I +++  +A E  +    KT   +L+Y++ +FT I+I+E  LK +A   + YF   W   DF++V  S++      LG  E+ A+   R  R  R  +    ++ MR+++  +   I  + N+ ++ L+   +F+++G   +   ++
Sbjct: 1127 DMEESKEKLNATSSSE-GSTVDIGAPAEG-EQPEVEPEESLEPEACFTEDCVRKFKCCQISIEEGKGKLWWNLRKTCYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQVYFTNAWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFY 1364          

HSP 7 Score: 62.3882 bits (150), Expect = 1.078e-8
Identity = 77/328 (23.48%), Postives = 134/328 (40.85%), Query Frame = 3
Query:  495 WSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDY-----------PISEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGY----TNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNI-------------LFYIIVVFFGSFYLINLMLAVV 1394
            W  +RK    I  +  F+ FI+  IL++   LA  + Y             ++ VF  I+ LEM+++  + G  +    Y  + +  +D LI+ +S + +            + SLRTLR LR L+ ++   G++ + +AL+ ++  +  V+   L C+ F+ +F++                          N F   FY+             INY T        + S  N  S C   I  N    +     NFDN G   LS+ Q+ T   W    +++  A  S N+             L+++I + FGSF+ +NL + V+
Sbjct: 1194 WWNLRKTCYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQV----YFTNAWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVL---LVCLIFWLIFSIM-----------------------GVNLFAGKFYH------------CINYTT----GEMFDVSVVNNYSECKALIESNQTARWKNVKVNFDNVGLGYLSLLQVATFKGW---MDIMYAAVDSRNVELQPKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVI 1472          

HSP 8 Score: 58.151 bits (139), Expect = 1.900e-7
Identity = 48/202 (23.76%), Postives = 97/202 (48.02%), Query Frame = 3
Query:  486 CAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPISE----------YVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAF 1061
            C PW  ++ L  L+  +   D  I + I++N +F+A+ + YP++E           VF  I+T EM +++    + ++ Y Y ++ +N+ D  I+ LS + + +    G     +S LR+ R+LR  K     P L  +   +  S+  L  + ++    +  FA+  +Q++ G    +CV  +     +   H ++F ++F
Sbjct:  742 CKPWLKVKHLVNLVVMDPFVDLAITICIVLNTLFMAMEH-YPMTEQFSSVLSVGNLVFTGIFTAEMFLKI----IAMDPYYYFQEGWNIFDGFIVSLSLMELGLANVEG-----LSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLF-GKSYKECVCKISNDCELPRWHMHDFFHSF 932          

HSP 9 Score: 52.7582 bits (125), Expect = 9.342e-6
Identity = 48/188 (25.53%), Postives = 87/188 (46.28%), Query Frame = 3
Query: 3027 CIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCL 3590
            C++ D    C   W   ++   L+      +  I +CI+ +++ +  E   +         L V N +FT +F  EM LKII++    YF   W I D FIVS+SL+ L          +     LR+ R LR  +    W  + +++  +  ++ ++ N+ LV  +   IF++ G+Q F   + +C+
Sbjct:  736 CLIWD----CCKPWLKVKHLVNLVVMDPFVDLAITICIVLNTLFMAMEHYPMTEQ--FSSVLSVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVSLSLMELGL------ANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECV 911          
BLAST of Sodium channel protein vs. Ensembl Celegans
Match: egl-19 (Voltage-dependent L-type calcium channel subunit alpha [Source:UniProtKB/TrEMBL;Acc:W6RY76])

HSP 1 Score: 194.897 bits (494), Expect = 1.843e-49
Identity = 127/411 (30.90%), Postives = 212/411 (51.58%), Query Frame = 3
Query: 3060 SRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLD------SNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGL--------RWHYF 4250
            S  ++FR    ++  H  F   +L CIL SS  L  ED  L  N T    L   +Y FT +F +E+ LK+I  G   +  SF       +  + +   +   +     M+  + LR +R LRPLRAI+R +G+K VV  +I A+ +I N++LV  +   +F+I GVQ FKG FF C D      +  R         + ++ + +   W+N++ NFDN  +  ++L+ ++TFEGW +++  AIDS   +  P   ++ A   +F+ FI+V +FF++N+F+G +I  F   +N+ E  Y +  L  +QR        L  +  R+ +  P+  +Q   +    S  FE VI ++I +N V +  +HY  +  F + LD+ N++F+ +F  EA++KI  L        RW+ F
Sbjct:  782 SHTNSFRVFCNMVVNHSYFTNAVLFCILVSSAMLAAEDP-LQANSTRNMILNYFDYFFTSVFTVEITLKVIVFGLVFHKGSFCRNAFNLLDILVVAVSLTSFVLRTDAMSVVKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIMLVTFMLQFMFAIIGVQLFKGTFFLCNDLSKMTEAECRGEYIHYEDGDPTKPVSKKRVWSNNDFNFDNVGDAMISLFVVSTFEGWPQLLYVAIDSNEEDKGPIHNSRQAVALFFIAFIIVIAFFMMNIFVGFVIVTF---QNEGEREYENCELDKNQRKCIEF--ALKAKPHRRYI--PRNRLQYRVWWFVTSRAFEYVIFLIIVMNTVSLACKHYPSSRGFEDFLDVFNLIFTGVFAFEAVLKIVALNPKNYISDRWNVF 1184          

HSP 2 Score: 137.117 bits (344), Expect = 8.066e-32
Identity = 93/338 (27.51%), Postives = 172/338 (50.89%), Query Frame = 3
Query:  465 ATKSFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPIS------------EYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIG-----------PNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASG-SWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
            + +S L  +  + IRKL + I   + F++ I+  I  NC+ LA+   YP              EYVF+ ++T+E V+++ + G + +   YLR+ +N++D +I+++  +  I+ K   Q   +V +LR  RVLR L+ ++ +P L+ + +A+++++  L  + +L LF +  +A+  L+++ G L + C+                           +P        +   CG D+  G+  K  P S  L ++G           P PN G TNFDNFG A+L++FQ ++L+ W +    V  A G  W  ++++ +V  GSF+++NL+L V+S  +
Sbjct:   64 SERSLLCLSLNNPIRKLCISIVEWKPFEFLILFMICANCIALAIYQPYPAQDSDYKNTLLETIEYVFIVVFTIECVLKIVAMGFMFHPSAYLRNAWNILDFIIVVIGLVSTILSKMSIQ-GFDVKALRAFRVLRPLRLVSGVPSLQVVLNAILRAMIPLLHIALLVLFVILIYAIIGLELFCGKLHSTCI---------------------------DPATGQLAQKDPTPCGTDTE-GSAFKCQP-SDSLTNMGVRWECSSNTTWPGPNNGITNFDNFGLAMLTVFQCVSLEGWTDVMYWVNDAVGREWPWIYFVTLVILGSFFVLNLVLGVLSGEF 371          

HSP 3 Score: 110.923 bits (276), Expect = 7.338e-24
Identity = 96/323 (29.72%), Postives = 147/323 (45.51%), Query Frame = 3
Query: 3054 CGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQAL-RVINYIFTYLFCIEMILKIISLGF----KVYFTSFWTXX---XXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFK-CLDSNT--------------RERLAATVVPNKS--------ECLRQNHTWANSN---INFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNK 3920
            C S  +  R   + I E + FE  IL  I A+ I L     Y   +   K  L   I Y+F  +F IE +LKI+++GF      Y  + W IL      I  +S +     I GF       ++LR  R LRPLR +S    +++V+NA++ A+  + ++ L+ +   LI++I G++ F GK    C+D  T               E  A    P+ S        EC   N TW   N    NFDN     L ++Q  + EGW ++M    D+ G             + YFV  +++GSFF+LNL +GV+   F++ + K
Sbjct:   70 CLSLNNPIRKLCISIVEWKPFEFLILFMICANCIALAIYQPYPAQDSDYKNTLLETIEYVFIVVFTIECVLKIVAMGFMFHPSAYLRNAWNILDFIIVVIGLVSTILSKMSIQGFDV-----KALRAFRVLRPLRLVSGVPSLQVVLNAILRAMIPLLHIALLVLFVILIYAIIGLELFCGKLHSTCIDPATGQLAQKDPTPCGTDTEGSAFKCQPSDSLTNMGVRWEC-SSNTTWPGPNNGITNFDNFGLAMLTVFQCVSLEGWTDVMYWVNDAVGREWP---------WIYFVTLVILGSFFVLNLVLGVLSGEFSKEREK 377          

HSP 4 Score: 107.071 bits (266), Expect = 1.166e-22
Identity = 72/239 (30.13%), Postives = 126/239 (52.72%), Query Frame = 3
Query: 1758 NPTIDRNCQCCIKQNVLCSKWVAF------QNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIIDL-------GVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTY---HTQIFGDNIPRWNFDDFWHSMILVFRIICGE-WIEPSFDC 2420
            N  +D+N + CI+  +       +      Q R++ FVT   F+  I   I +NT+ +A +HYPS + ++D L   N+IFT ++  E  LKI+AL+ K Y +  WN+FD +VV+ S ID+       G   + +++ FR FR+ R+ KL    + +R LL     +   +  ++++++L+ +++AVIG Q +        T I  +N    NF  F  +++++FR   GE W +    C
Sbjct: 1077 NCELDKNQRKCIEFALKAKPHRRYIPRNRLQYRVWWFVTSRAFEYVIFLIIVMNTVSLACKHYPSSRGFEDFLDVFNLIFTGVFAFEAVLKIVALNPKNYISDRWNVFDLLVVVGSFIDITYGKLNPGGTNLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFMKSFQALPYVALLIVLLFFIYAVIGMQFFGKVALDDSTSIHRNN----NFHSFPAAILVLFRSATGEAWQDIMLSC 1311          

HSP 5 Score: 90.8929 bits (224), Expect = 9.789e-18
Identity = 81/272 (29.78%), Postives = 141/272 (51.84%), Query Frame = 1
Query: 4444 RIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLV------NFETFERSILLLFRLTTAGGWNDILEAMFIQPPYCNNTHVLR-----DGVYK-AISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPK--PNMIA---LVSFDLPIVEGDKMHCLD-ILIALVK-----HVIGDIEDSEE 5190
            R+FR+ R+++L+   +GIR LL+  + S  AL  +  L++L+ FIY+++GM  FG +     LDD        NF +F  +IL+LFR  T   W DI+ +       C++   +R     D  +K  ++   CG   F   Y  +F  +C  ++IN+++A+I++NF+       + +     E F  +W  YDP A   IK+ ++   + ++  PLG  K  P+ +A   LVS ++P+   D   C +  L ALV+     +  G+I+++ E
Sbjct: 1215 RLFRVMRLVKLLSRGEGIRTLLWTFMKSFQALPYVALLIVLLFFIYAVIGMQFFGKV----ALDDSTSIHRNNNFHSFPAAILVLFRSATGEAWQDIMLS-------CSDREDVRCDPMSDDYHKGGLNESRCGNN-FAYPYFISFFMLCSFLVINLFVAVIMDNFDYLTRDWSI-LGPHHLEEFVRLWSEYDPDAKGRIKHLDVVTLLRKISPPLGFGKLCPHRLACKRLVSMNMPL-NSDGTVCFNATLFALVRTNLKIYTEGNIDEANE 1472          

HSP 6 Score: 87.4261 bits (215), Expect = 9.761e-17
Identity = 74/285 (25.96%), Postives = 134/285 (47.02%), Query Frame = 3
Query: 3108 RAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXG-FGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMA------------YYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKY 3923
            RAFE  I + I+ +++ L  +  +  ++   +  L V N IFT +F  E +LKI++L  K Y +  W + D  +V  S + +    L   GT + +    R  R +R ++ +SR +G++ ++   + +  ++  V L+ ++ + I+++ G+QFF GK    LD +T                       + N NF +     L L++ AT E W +IM    D   +   P  ++                Y YF+ F ++ SF ++NLF+ VI+DNF+ L   +
Sbjct: 1117 RAFEYVIFLIIVMNTVSLACK--HYPSSRGFEDFLDVFNLIFTGVFAFEAVLKIVALNPKNYISDRWNVFDLLVVVGSFIDITYGKLNPGGTNLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFMKSFQALPYVALLIVLLFFIYAVIGMQFF-GKV--ALDDSTS---------------------IHRNNNFHSFPAAILVLFRSATGEAWQDIMLSCSDREDVRCDPMSDDYHKGGLNESRCGNNFAYPYFISFFMLCSFLVINLFVAVIMDNFDYLTRDW 1375          

HSP 7 Score: 70.4774 bits (171), Expect = 1.249e-11
Identity = 55/243 (22.63%), Postives = 115/243 (47.33%), Query Frame = 3
Query: 1650 MDSEEEKEGKDCDNKAE---YEDEVEIG------NDTNNTDTAEMNPTIDRNCQCCIKQNVLCSKWVAFQNRLYIFVTD-PFFDLFISFCIFINTIIMA-SEHYPSEKT--WDDILKYSNIIFTVIYIIECSLKIMALS-----KEYFNVGWNIFDFVVVIASIID-----LGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHT 2309
            M S E++E    D +     ++  ++         D      A+  P    N     ++++LC        +L I + +   F+  I F I  N I +A  + YP++ +   + +L+    +F V++ IEC LKI+A+        Y    WNI DF++V+  ++      + ++  D  ++ RAFR+ R  +L     +++++L  I   +  + +++++VL V+ ++A+IG + +    H+
Sbjct:    8 MSSGEDEEQAAADEQERTDLWQQTLQAAVAASSSQDATKKRPAQRKPLRQTNVVERSERSLLCLSLNNPIRKLCISIVEWKPFEFLILFMICANCIALAIYQPYPAQDSDYKNTLLETIEYVFIVVFTIECVLKIVAMGFMFHPSAYLRNAWNILDFIIVVIGLVSTILSKMSIQGFDVKAL-RAFRVLRPLRLVSGVPSLQVVLNAILRAMIPLLHIALLVLFVILIYAIIGLELFCGKLHS 249          

HSP 8 Score: 67.781 bits (164), Expect = 9.346e-11
Identity = 48/167 (28.74%), Postives = 93/167 (55.69%), Query Frame = 3
Query: 1914 ASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIIDLGVEEVD-----ALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRIICGE 2396
             SEHY   +  D     +N+ F +++ +E  LK+ +L    Y    +N FD  VVI+SI++  +   D      +S+ R+ RL R+FK+ + W ++R L++ + +++  + +L +++ L + +FA++G Q +   ++        PR NFD F  +++ VF+I+ GE
Sbjct:  491 TSEHYGQSEWLDHFQTMANLFFVILFSMEMLLKMYSLGFTTYTTSQFNRFDCFVVISSILEFVLVYFDLMKPLGVSVLRSARLLRIFKVTKYWTSLRNLVSSLLNSLRSIISLLLLLFLFIVIFALLGMQVFGGKFNFNP-QQPKPRANFDTFVQALLTVFQILTGE 656          

HSP 9 Score: 62.003 bits (149), Expect = 4.650e-9
Identity = 37/160 (23.12%), Postives = 84/160 (52.50%), Query Frame = 3
Query: 1851 VTDPFFDLFISFCIFINTIIMASEH-YPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-----KEYFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQS---WQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTY 2303
            V   +F   + FCI +++ ++A+E    +  T + IL Y +  FT ++ +E +LK++          +    +N+ D +VV  S+    V   DA+S+ +  R+ RV +  ++    + ++ ++  +   +  +GN+ ++  ++ +MFA+IG Q ++ T+
Sbjct:  795 VNHSYFTNAVLFCILVSSAMLAAEDPLQANSTRNMILNYFDYFFTSVFTVEITLKVIVFGLVFHKGSFCRNAFNLLDILVVAVSLTSF-VLRTDAMSVVKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIMLVTFMLQFMFAIIGVQLFKGTF 953          

HSP 10 Score: 57.3806 bits (137), Expect = 1.219e-7
Identity = 60/275 (21.82%), Postives = 125/275 (45.45%), Query Frame = 3
Query:  618 EYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGT--LRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRA----------SGSWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
            +Y F +++T+E+ +++   G++ +  ++ R+ +NL+DIL++ +S     V +    + V +  LR LRVLR L+ I    GLK +   +I ++K +  +++++      FA+  +Q+++GT  L N   KM + +      H  +                                G+ +K     +    +  N +F   NFDN G A++S+F + T + W     + I +          S     LF+I  +   +F+++N+ +  V +++
Sbjct:  835 DYFFTSVFTVEITLKVIVFGLVFHKGSFCRNAFNLLDILVVAVSLTSF-VLRTDAMSVVKI--LRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIMLVTFMLQFMFAIIGVQLFKGTFFLCNDLSKMTEAECRGEYIHYED--------------------------------GDPTK----PVSKKRVWSNNDF---NFDNVGDAMISLFVVSTFEGWPQLLYVAIDSNEEDKGPIHNSRQAVALFFIAFIIVIAFFMMNIFVGFVIVTF 1067          

HSP 11 Score: 56.225 bits (134), Expect = 3.376e-7
Identity = 62/227 (27.31%), Postives = 104/227 (45.81%), Query Frame = 3
Query: 3222 NYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNF 3902
            N  F  LF +EM+LK+ SLGF  Y TS +   D F+V  S+L  +         +     LR+ R LR  +    W  ++ +V++L+ ++ SI ++LL+  +F +IF++ G+Q F GKF                          N        NFD      L ++QI T E W  +M   I+S G          +    Y+++  + G++ +LN+F+ + +DN 
Sbjct:  509 NLFFVILFSMEMLLKMYSLGFTTYTTSQFNRFDCFVVISSILEFVLVYFDLMKPL-GVSVLRSARLLRIFKVTKYWTSLRNLVSSLLNSLRSIISLLLLLFLFIVIFALLGMQVFGGKF------------------------NFNPQQPKPRANFDTFVQALLTVFQILTGEDWNTVMYHGIESFG----GVGTLGVIVCIYYIVLFICGNYILLNVFLAIAVDNL 706          
BLAST of Sodium channel protein vs. Ensembl Celegans
Match: egl-19 (Voltage-dependent L-type calcium channel subunit alpha [Source:UniProtKB/TrEMBL;Acc:W6RY76])

HSP 1 Score: 194.897 bits (494), Expect = 2.106e-49
Identity = 127/411 (30.90%), Postives = 212/411 (51.58%), Query Frame = 3
Query: 3060 SRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLD------SNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGL--------RWHYF 4250
            S  ++FR    ++  H  F   +L CIL SS  L  ED  L  N T    L   +Y FT +F +E+ LK+I  G   +  SF       +  + +   +   +     M+  + LR +R LRPLRAI+R +G+K VV  +I A+ +I N++LV  +   +F+I GVQ FKG FF C D      +  R         + ++ + +   W+N++ NFDN  +  ++L+ ++TFEGW +++  AIDS   +  P   ++ A   +F+ FI+V +FF++N+F+G +I  F   +N+ E  Y +  L  +QR        L  +  R+ +  P+  +Q   +    S  FE VI ++I +N V +  +HY  +  F + LD+ N++F+ +F  EA++KI  L        RW+ F
Sbjct:  782 SHTNSFRVFCNMVVNHSYFTNAVLFCILVSSAMLAAEDP-LQANSTRNMILNYFDYFFTSVFTVEITLKVIVFGLVFHKGSFCRNAFNLLDILVVAVSLTSFVLRTDAMSVVKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIMLVTFMLQFMFAIIGVQLFKGTFFLCNDLSKMTEAECRGEYIHYEDGDPTKPVSKKRVWSNNDFNFDNVGDAMISLFVVSTFEGWPQLLYVAIDSNEEDKGPIHNSRQAVALFFIAFIIVIAFFMMNIFVGFVIVTF---QNEGEREYENCELDKNQRKCIEF--ALKAKPHRRYI--PRNRLQYRVWWFVTSRAFEYVIFLIIVMNTVSLACKHYPSSRGFEDFLDVFNLIFTGVFAFEAVLKIVALNPKNYISDRWNVF 1184          

HSP 2 Score: 137.117 bits (344), Expect = 8.709e-32
Identity = 93/338 (27.51%), Postives = 172/338 (50.89%), Query Frame = 3
Query:  465 ATKSFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPIS------------EYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIG-----------PNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASG-SWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
            + +S L  +  + IRKL + I   + F++ I+  I  NC+ LA+   YP              EYVF+ ++T+E V+++ + G + +   YLR+ +N++D +I+++  +  I+ K   Q   +V +LR  RVLR L+ ++ +P L+ + +A+++++  L  + +L LF +  +A+  L+++ G L + C+                           +P        +   CG D+  G+  K  P S  L ++G           P PN G TNFDNFG A+L++FQ ++L+ W +    V  A G  W  ++++ +V  GSF+++NL+L V+S  +
Sbjct:   64 SERSLLCLSLNNPIRKLCISIVEWKPFEFLILFMICANCIALAIYQPYPAQDSDYKNTLLETIEYVFIVVFTIECVLKIVAMGFMFHPSAYLRNAWNILDFIIVVIGLVSTILSKMSIQ-GFDVKALRAFRVLRPLRLVSGVPSLQVVLNAILRAMIPLLHIALLVLFVILIYAIIGLELFCGKLHSTCI---------------------------DPATGQLAQKDPTPCGTDTE-GSAFKCQP-SDSLTNMGVRWECSSNTTWPGPNNGITNFDNFGLAMLTVFQCVSLEGWTDVMYWVNDAVGREWPWIYFVTLVILGSFFVLNLVLGVLSGEF 371          

HSP 3 Score: 110.923 bits (276), Expect = 7.733e-24
Identity = 96/323 (29.72%), Postives = 147/323 (45.51%), Query Frame = 3
Query: 3054 CGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQAL-RVINYIFTYLFCIEMILKIISLGF----KVYFTSFWTXX---XXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFK-CLDSNT--------------RERLAATVVPNKS--------ECLRQNHTWANSN---INFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNK 3920
            C S  +  R   + I E + FE  IL  I A+ I L     Y   +   K  L   I Y+F  +F IE +LKI+++GF      Y  + W IL      I  +S +     I GF       ++LR  R LRPLR +S    +++V+NA++ A+  + ++ L+ +   LI++I G++ F GK    C+D  T               E  A    P+ S        EC   N TW   N    NFDN     L ++Q  + EGW ++M    D+ G             + YFV  +++GSFF+LNL +GV+   F++ + K
Sbjct:   70 CLSLNNPIRKLCISIVEWKPFEFLILFMICANCIALAIYQPYPAQDSDYKNTLLETIEYVFIVVFTIECVLKIVAMGFMFHPSAYLRNAWNILDFIIVVIGLVSTILSKMSIQGFDV-----KALRAFRVLRPLRLVSGVPSLQVVLNAILRAMIPLLHIALLVLFVILIYAIIGLELFCGKLHSTCIDPATGQLAQKDPTPCGTDTEGSAFKCQPSDSLTNMGVRWEC-SSNTTWPGPNNGITNFDNFGLAMLTVFQCVSLEGWTDVMYWVNDAVGREWP---------WIYFVTLVILGSFFVLNLVLGVLSGEFSKEREK 377          

HSP 4 Score: 107.071 bits (266), Expect = 9.696e-23
Identity = 72/239 (30.13%), Postives = 126/239 (52.72%), Query Frame = 3
Query: 1758 NPTIDRNCQCCIKQNVLCSKWVAF------QNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIIDL-------GVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTY---HTQIFGDNIPRWNFDDFWHSMILVFRIICGE-WIEPSFDC 2420
            N  +D+N + CI+  +       +      Q R++ FVT   F+  I   I +NT+ +A +HYPS + ++D L   N+IFT ++  E  LKI+AL+ K Y +  WN+FD +VV+ S ID+       G   + +++ FR FR+ R+ KL    + +R LL     +   +  ++++++L+ +++AVIG Q +        T I  +N    NF  F  +++++FR   GE W +    C
Sbjct: 1077 NCELDKNQRKCIEFALKAKPHRRYIPRNRLQYRVWWFVTSRAFEYVIFLIIVMNTVSLACKHYPSSRGFEDFLDVFNLIFTGVFAFEAVLKIVALNPKNYISDRWNVFDLLVVVGSFIDITYGKLNPGGTNLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFMKSFQALPYVALLIVLLFFIYAVIGMQFFGKVALDDSTSIHRNN----NFHSFPAAILVLFRSATGEAWQDIMLSC 1311          

HSP 5 Score: 90.5077 bits (223), Expect = 1.108e-17
Identity = 81/272 (29.78%), Postives = 141/272 (51.84%), Query Frame = 1
Query: 4444 RIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLV------NFETFERSILLLFRLTTAGGWNDILEAMFIQPPYCNNTHVLR-----DGVYK-AISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPK--PNMIA---LVSFDLPIVEGDKMHCLD-ILIALVK-----HVIGDIEDSEE 5190
            R+FR+ R+++L+   +GIR LL+  + S  AL  +  L++L+ FIY+++GM  FG +     LDD        NF +F  +IL+LFR  T   W DI+ +       C++   +R     D  +K  ++   CG   F   Y  +F  +C  ++IN+++A+I++NF+       + +     E F  +W  YDP A   IK+ ++   + ++  PLG  K  P+ +A   LVS ++P+   D   C +  L ALV+     +  G+I+++ E
Sbjct: 1215 RLFRVMRLVKLLSRGEGIRTLLWTFMKSFQALPYVALLIVLLFFIYAVIGMQFFGKV----ALDDSTSIHRNNNFHSFPAAILVLFRSATGEAWQDIMLS-------CSDREDVRCDPMSDDYHKGGLNESRCGNN-FAYPYFISFFMLCSFLVINLFVAVIMDNFDYLTRDWSI-LGPHHLEEFVRLWSEYDPDAKGRIKHLDVVTLLRKISPPLGFGKLCPHRLACKRLVSMNMPL-NSDGTVCFNATLFALVRTNLKIYTEGNIDEANE 1472          

HSP 6 Score: 87.4261 bits (215), Expect = 9.644e-17
Identity = 74/285 (25.96%), Postives = 134/285 (47.02%), Query Frame = 3
Query: 3108 RAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXG-FGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMA------------YYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKY 3923
            RAFE  I + I+ +++ L  +  +  ++   +  L V N IFT +F  E +LKI++L  K Y +  W + D  +V  S + +    L   GT + +    R  R +R ++ +SR +G++ ++   + +  ++  V L+ ++ + I+++ G+QFF GK    LD +T                       + N NF +     L L++ AT E W +IM    D   +   P  ++                Y YF+ F ++ SF ++NLF+ VI+DNF+ L   +
Sbjct: 1117 RAFEYVIFLIIVMNTVSLACK--HYPSSRGFEDFLDVFNLIFTGVFAFEAVLKIVALNPKNYISDRWNVFDLLVVVGSFIDITYGKLNPGGTNLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFMKSFQALPYVALLIVLLFFIYAVIGMQFF-GKV--ALDDSTS---------------------IHRNNNFHSFPAAILVLFRSATGEAWQDIMLSCSDREDVRCDPMSDDYHKGGLNESRCGNNFAYPYFISFFMLCSFLVINLFVAVIMDNFDYLTRDW 1375          

HSP 7 Score: 70.8626 bits (172), Expect = 1.093e-11
Identity = 55/243 (22.63%), Postives = 115/243 (47.33%), Query Frame = 3
Query: 1650 MDSEEEKEGKDCDNKAE---YEDEVEIG------NDTNNTDTAEMNPTIDRNCQCCIKQNVLCSKWVAFQNRLYIFVTD-PFFDLFISFCIFINTIIMA-SEHYPSEKT--WDDILKYSNIIFTVIYIIECSLKIMALS-----KEYFNVGWNIFDFVVVIASIID-----LGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHT 2309
            M S E++E    D +     ++  ++         D      A+  P    N     ++++LC        +L I + +   F+  I F I  N I +A  + YP++ +   + +L+    +F V++ IEC LKI+A+        Y    WNI DF++V+  ++      + ++  D  ++ RAFR+ R  +L     +++++L  I   +  + +++++VL V+ ++A+IG + +    H+
Sbjct:    8 MSSGEDEEQAAADEQERTDLWQQTLQAAVAASSSQDATKKRPAQRKPLRQTNVVERSERSLLCLSLNNPIRKLCISIVEWKPFEFLILFMICANCIALAIYQPYPAQDSDYKNTLLETIEYVFIVVFTIECVLKIVAMGFMFHPSAYLRNAWNILDFIIVVIGLVSTILSKMSIQGFDVKAL-RAFRVLRPLRLVSGVPSLQVVLNAILRAMIPLLHIALLVLFVILIYAIIGLELFCGKLHS 249          

HSP 8 Score: 67.781 bits (164), Expect = 8.527e-11
Identity = 48/167 (28.74%), Postives = 93/167 (55.69%), Query Frame = 3
Query: 1914 ASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIIDLGVEEVD-----ALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRIICGE 2396
             SEHY   +  D     +N+ F +++ +E  LK+ +L    Y    +N FD  VVI+SI++  +   D      +S+ R+ RL R+FK+ + W ++R L++ + +++  + +L +++ L + +FA++G Q +   ++        PR NFD F  +++ VF+I+ GE
Sbjct:  491 TSEHYGQSEWLDHFQTMANLFFVILFSMEMLLKMYSLGFTTYTTSQFNRFDCFVVISSILEFVLVYFDLMKPLGVSVLRSARLLRIFKVTKYWTSLRNLVSSLLNSLRSIISLLLLLFLFIVIFALLGMQVFGGKFNFNPQQPK-PRANFDTFVQALLTVFQILTGE 656          

HSP 9 Score: 62.3882 bits (150), Expect = 3.799e-9
Identity = 37/162 (22.84%), Postives = 85/162 (52.47%), Query Frame = 3
Query: 1845 IFVTDPFFDLFISFCIFINTIIMASEH-YPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-----KEYFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQS---WQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTY 2303
            + V   +F   + FCI +++ ++A+E    +  T + IL Y +  FT ++ +E +LK++          +    +N+ D +VV  S+    V   DA+S+ +  R+ RV +  ++    + ++ ++  +   +  +GN+ ++  ++ +MFA+IG Q ++ T+
Sbjct:  793 MVVNHSYFTNAVLFCILVSSAMLAAEDPLQANSTRNMILNYFDYFFTSVFTVEITLKVIVFGLVFHKGSFCRNAFNLLDILVVAVSLTSF-VLRTDAMSVVKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIMLVTFMLQFMFAIIGVQLFKGTF 953          

HSP 10 Score: 57.3806 bits (137), Expect = 1.370e-7
Identity = 61/275 (22.18%), Postives = 126/275 (45.82%), Query Frame = 3
Query:  618 EYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGT--LRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRA----------SGSWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
            +Y F +++T+E+ +++   G++ +  ++ R+ +NL+DIL++ +S     V +    + V +  LR LRVLR L+ I    GLK +   +I ++K +  +++++      FA+  +Q+++GT  L N   KM +           E++   +Y                          +   T P  +    +  N +F   NFDN G A++S+F + T + W     + I +          S     LF+I  +   +F+++N+ +  V +++
Sbjct:  835 DYFFTSVFTVEITLKVIVFGLVFHKGSFCRNAFNLLDILVVAVSLTSF-VLRTDAMSVVKI--LRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIMLVTFMLQFMFAIIGVQLFKGTFFLCNDLSKMTE------AECRGEYI---HYE-------------------------DGDPTKP--VSKKRVWSNNDF---NFDNVGDAMISLFVVSTFEGWPQLLYVAIDSNEEDKGPIHNSRQAVALFFIAFIIVIAFFMMNIFVGFVIVTF 1067          

HSP 11 Score: 55.8398 bits (133), Expect = 3.858e-7
Identity = 62/227 (27.31%), Postives = 104/227 (45.81%), Query Frame = 3
Query: 3222 NYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNF 3902
            N  F  LF +EM+LK+ SLGF  Y TS +   D F+V  S+L  +         +     LR+ R LR  +    W  ++ +V++L+ ++ SI ++LL+  +F +IF++ G+Q F GKF                          N        NFD      L ++QI T E W  +M   I+S G          +    Y+++  + G++ +LN+F+ + +DN 
Sbjct:  509 NLFFVILFSMEMLLKMYSLGFTTYTTSQFNRFDCFVVISSILEFVLVYFDLMKPL-GVSVLRSARLLRIFKVTKYWTSLRNLVSSLLNSLRSIISLLLLLFLFIVIFALLGMQVFGGKF------------------------NFNPQQPKPRANFDTFVQALLTVFQILTGEDWNTVMYHGIESFG----GVGTLGVIVCIYYIVLFICGNYILLNVFLAIAVDNL 706          
BLAST of Sodium channel protein vs. Ensembl Celegans
Match: cca-1 (Voltage-dependent T-type calcium channel subunit alpha [Source:UniProtKB/TrEMBL;Acc:A0A0K3ASP4])

HSP 1 Score: 162.54 bits (410), Expect = 1.276e-39
Identity = 127/413 (30.75%), Postives = 211/413 (51.09%), Query Frame = 3
Query: 3075 FRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIIS----LGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLR---AISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQ-NHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMK-KLSNRKPRKTVRR------PKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRW-HYFRYMWN 4265
             R + L  T+ + F+ T+L  I  + I L  E   +  +   +Q L +  YIFT +F  EM++K+I+    +G   YF   W ILD  +V ISL+++  ++L  G     F  +R +R LR LR    I+R  G+K+VV  LI ++  I N++L+C  F++IF I GVQ FKG  + C+            V  K++C+    + W N   NFDN     ++L+ +++ +GW+ IM   ID+ G+++QP +        YF+ F+L+  FF+LN+F+GV+++NF++ K   E    +       +      K + S    RK + R           + F + +  S  F+L I  +I +N++ M +E Y        VL  +N  F+ +FTLEA +K+  L +  +F   WN
Sbjct: 1107 LRIKCLQTTQKKWFDYTVLFFIGINCITLAMERPSIPPDSFERQFLHISGYIFTVIFTGEMMMKVIANGCFIGQAAYFKDGWNILDGILVVISLINIAFELLATGDSPKIFGVIRVLRLLRALRPLRVINRAPGVKLVVMTLISSLKPIGNIVLICCTFFIIFGILGVQLFKGMMYHCIGPEVGN------VTTKADCIEDYRNKWVNHRYNFDNLGQALMSLFVLSSKDGWVSIMYQGIDAVGVDVQPIENYNEWRMIYFISFLLLVGFFVLNMFVGVVVENFHKCKEALEKEMREKEKEKRLKRKLKRQKFEESMAGKRKKMERNYPYYHDYGHTRLFLHGIVTSKYFDLAIAAVIGINVISMAMEFYMMPMGLKYVLKALNYFFTAVFTLEAAMKLIALGFKRFFIEKWN 1513          

HSP 2 Score: 105.916 bits (263), Expect = 2.650e-22
Identity = 88/343 (25.66%), Postives = 162/343 (47.23%), Query Frame = 3
Query:  507 RKLALLISTNQIFDYFIMLTILVNCVFLALN---NDYP-----------ISEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSA-GNCSKTNP-------------------NSICL---------PHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
            RK AL +  +  FD   M  I++NCV L +     D P           I +      +  EMVI++ + G       Y+ D +N +D  I++      ++ +  G  N+N++++RT+RVLR L+ +  +P ++ + + L+ +L ML  V++L  F    F +  +Q++ G LRN+CV  ++    +SEN S  F N     + + P +     + Y+    D++    CS   P                   N  C+           +  NP  G  +FDN G+A +++F +I+L+ W +    V  A   WN +++++++  G+F++INL L V++  +
Sbjct:  120 RKWALQMVMSPWFDRITMAVIMINCVTLGMYRPCEDGPDCDTYRCQILDIIDNCIFVYFAFEMVIKIMALG-FYGPAAYMSDTWNRLDFFIVMAGIAEFVLHEYLG-GNINLTAIRTVRVLRPLRAVNRIPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCV--INLPKTISENQSALFNNVKLTRF-YIPED---TSLEYICSQPDANGLHTCSNLPPYTVDGVKCNLTLDEYDKVTNDSCINWNIYYNECQVMQRNPFQGSVSFDNIGFAWVAIFLVISLEGWTDIMYYVQDAHSFWNWIYFVLLIVIGAFFMINLCLVVIATQF 454          

HSP 3 Score: 85.5001 bits (210), Expect = 3.665e-16
Identity = 64/237 (27.00%), Postives = 112/237 (47.26%), Query Frame = 3
Query: 1794 KQNVLCSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSK-EYFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIG-----------KQSYRNTYHTQIFGD--NIPRWNFDDFWHSMILVFRIICGE-WIEPSFDCIRANSPLCLLIFI 2459
            K+    SK   F+ ++  FV    F   I   I +NT+ M  E++   +    IL+YSN+ FT ++ +E  LKI+A     Y   G+N+FD  +V  S+++L  E    LS+ R FRL R+ KL +    +R  L ++  T+  +     +++L +++F+ +G             +       Q+        R NFD+F  + + VF+I+  E W    F+ +   +P   L F+
Sbjct:  631 KKKSTPSKLWWFREKIQKFVICDHFTRGILVAILVNTLSMGVEYHQQPEILTVILEYSNLFFTALFALEMLLKIIASGLFGYLADGFNLFDGGIVALSVLELFQEGKGGLSVLRTFRLLRILKLVRFMPALRYQLVVMLRTMDNVTVFFGLLVLFIFIFSTLGMVLFGCKFCNHPDTGLQCTSAQVISSICECDRMNFDNFLFATVTVFQILTQEDWNMVLFNGMAQTNPWAALYFV 867          

HSP 4 Score: 77.0258 bits (188), Expect = 1.617e-13
Identity = 59/201 (29.35%), Postives = 97/201 (48.26%), Query Frame = 3
Query: 1839 LYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIIDLGVEEVDALS---------IFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYM-----FAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRIICGE 2396
            L+  VT  +FDL I+  I IN I MA E Y        +LK  N  FT ++ +E ++K++AL  K +F   WN  D  +VI SI  +  EE +AL          + R  R+ RV KL +  + +R LL  +   + ++GNL  +  L+ ++       + GK      +     G++    +F +F  + + +FRI  G+
Sbjct: 1441 LHGIVTSKYFDLAIAAVIGINVISMAMEFYMMPMGLKYVLKALNYFFTAVFTLEAAMKLIALGFKRFFIEKWNRLDMFIVILSIAGIIFEEFEALELPINPTIIRVMRVLRIARVLKLLKMAKGIRSLLDTVGEALPQVGNLGSLFFLLFFIFAALGVELFGKLECSEDHPCDGLGEHA---HFKNFGMAFLTLFRIATGD 1638          

HSP 5 Score: 76.2554 bits (186), Expect = 2.383e-13
Identity = 44/107 (41.12%), Postives = 71/107 (66.36%), Query Frame = 1
Query: 4417 ITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKT-----GGLDDLVNFETFERSILLLFRLTTAGGWNDILE 4722
            I PT++RV+R+ RI RVL+L+K+AKGIR LL  +  +LP + N+G+L  L+ FI++ +G+ +FG L+ +      GL +  +F+ F  + L LFR+ T   WN I++
Sbjct: 1539 INPTIIRVMRVLRIARVLKLLKMAKGIRSLLDTVGEALPQVGNLGSLFFLLFFIFAALGVELFGKLECSEDHPCDGLGEHAHFKNFGMAFLTLFRIATGDNWNGIMK 1645          

HSP 6 Score: 70.4774 bits (171), Expect = 1.300e-11
Identity = 83/291 (28.52%), Postives = 136/291 (46.74%), Query Frame = 3
Query: 3048 TPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNK 3920
            TP    W   + +  +I +H  F   ILV IL +++ +  E  Y      L   L   N  FT LF +EM+LKII+ G   Y    + + D  IV++S+L L  +  G  + +  FR LR ++ +R + A+ R+Q   +VV        ++F  LLV  +F  IFS  G+  F  KF    D+   +  +A V+ +  EC R         +NFDN     + ++QI T E W  ++ + +  T         N  A   YFV  +  G++ + NL + ++++ F   K +
Sbjct:  635 TPSKLWWFREKIQKFVICDH--FTRGILVAILVNTLSMGVE--YHQQPEILTVILEYSNLFFTALFALEMLLKIIASGLFGYLADGFNLFDGGIVALSVLELFQEGKGGLSVLRTFRLLRILKLVRFMPAL-RYQ---LVVMLRTMDNVTVFFGLLVLFIF--IFSTLGMVLFGCKFCNHPDTGL-QCTSAQVISSICECDR---------MNFDNFLFATVTVFQILTQEDWNMVLFNGMAQT---------NPWAAL-YFVALMTFGNYVLFNLLVAILVEGFQESKEE 895          

HSP 7 Score: 68.9366 bits (167), Expect = 3.663e-11
Identity = 82/338 (24.26%), Postives = 143/338 (42.31%), Query Frame = 3
Query:  474 SFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNND-----------YPISEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSL----RTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFAL---QIYQGTLRN---KCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASG----------SWNILFYIIVVFFGSFYLINLMLAVV 1394
            S  L  P + +R   L  +  + FDY ++  I +NC+ LA+                IS Y+F  I+T EM++++ + G  I    Y +D +N++D +++++S I I  E     ++  +  +    R LR LR L+ I   PG+K +   LI SLK +  ++   L C +FF +F +   Q+++G + +     V  V  K    E++ N++VN  Y                                                   NFDN G AL+S+F L + D W +     I A G           W ++++I  +    F+++N+ + VV
Sbjct: 1097 SLFLMGPKNPLRIKCLQTTQKKWFDYTVLFFIGINCITLAMERPSIPPDSFERQFLHISGYIFTVIFTGEMMMKVIANGCFIGQAAYFKDGWNILDGILVVISLINIAFELLATGDSPKIFGVIRVLRLLRALRPLRVINRAPGVKLVVMTLISSLKPIGNIV---LICCTFFIIFGILGVQLFKGMMYHCIGPEVGNVTTKADCIEDYRNKWVNHRY---------------------------------------------------NFDNLGQALMSLFVLSSKDGWVSIMYQGIDAVGVDVQPIENYNEWRMIYFISFLLLVGFFVLNMFVGVV 1380          

HSP 8 Score: 61.2326 bits (147), Expect = 1.023e-8
Identity = 64/228 (28.07%), Postives = 111/228 (48.68%), Query Frame = 3
Query: 3198 LKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXX---XXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAI----DSTGINLQPKKENQMAYYAYFVIFILVGSF 3860
            LK  L+ +NY FT +F +E  +K+I+LGFK +F   W  LD FIV +S+        + L      T  R +R +R  R L+ +   +G++ +++ +  A+P + N+  +  + + IF+  GV+ F GK  +C + +  + L                     + +F N    FL L++IAT + W  IM+DA+    DS+         + +    +FVIF+L+  F
Sbjct: 1476 LKYVLKALNYFFTAVFTLEAAMKLIALGFKRFFIEKWNRLDMFIVILSIAGIIFEEFEALELPINPTIIRVMRVLRIARVLKLLKMAKGIRSLLDTVGEALPQVGNLGSLFFLLFFIFAALGVELF-GK-LECSEDHPCDGLG-------------------EHAHFKNFGMAFLTLFRIATGDNWNGIMKDALRDDCDSSDHCETNCCVDPILAPCFFVIFVLISQF 1682          

HSP 9 Score: 57.3806 bits (137), Expect = 1.378e-7
Identity = 48/111 (43.24%), Postives = 70/111 (63.06%), Query Frame = 3
Query: 3204 QALRVI-NYIFTYLFCIEMILKIISLGF---KVYFTSFWTXXXXXXXXXXXXX-XXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVC 3521
            Q L +I N IF Y F  EM++KI++LGF     Y +  W  LDFFIV   +   ++++ LG    +TA   +RT+R LRPLRA++R   M+I+VN L+  +P + NVLL+C
Sbjct:  165 QILDIIDNCIFVY-FAFEMVIKIMALGFYGPAAYMSDTWNRLDFFIVMAGIAEFVLHEYLGGNINLTA---IRTVRVLRPLRAVNRIPSMRILVNLLLDTLPMLGNVLLLC 271          

HSP 10 Score: 53.9138 bits (128), Expect = 1.505e-6
Identity = 46/165 (27.88%), Postives = 79/165 (47.88%), Query Frame = 3
Query: 1863 FFDLFISFCIFINTIIMASEH--YPSEKTWDDILKYSNIIFTVIYIIECSLKIMA-----LSKEYFNVGWNIFDFVVVIASIIDLGVEEV---DALSIFRAF------RLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRN-TYH 2306
            +FD  + F I IN I +A E    P +      L  S  IFTVI+  E  +K++A         YF  GWNI D ++V+ S+I++  E +   D+  IF         R  R  ++      ++L++  + S++  +GN+ +I      +F ++G Q ++   YH
Sbjct: 1119 WFDYTVLFFIGINCITLAMERPSIPPDSFERQFLHISGYIFTVIFTGEMMMKVIANGCFIGQAAYFKDGWNILDGILVVISLINIAFELLATGDSPKIFGVIRVLRLLRALRPLRVINRAPGVKLVVMTLISSLKPIGNIVLICCTFFIIFGILGVQLFKGMMYH 1283          
BLAST of Sodium channel protein vs. Ensembl Celegans
Match: cca-1 (Voltage-dependent T-type calcium channel subunit alpha [Source:UniProtKB/TrEMBL;Acc:A0A0K3ASP4])

HSP 1 Score: 162.54 bits (410), Expect = 1.276e-39
Identity = 127/413 (30.75%), Postives = 211/413 (51.09%), Query Frame = 3
Query: 3075 FRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIIS----LGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLR---AISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQ-NHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMK-KLSNRKPRKTVRR------PKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRW-HYFRYMWN 4265
             R + L  T+ + F+ T+L  I  + I L  E   +  +   +Q L +  YIFT +F  EM++K+I+    +G   YF   W ILD  +V ISL+++  ++L  G     F  +R +R LR LR    I+R  G+K+VV  LI ++  I N++L+C  F++IF I GVQ FKG  + C+            V  K++C+    + W N   NFDN     ++L+ +++ +GW+ IM   ID+ G+++QP +        YF+ F+L+  FF+LN+F+GV+++NF++ K   E    +       +      K + S    RK + R           + F + +  S  F+L I  +I +N++ M +E Y        VL  +N  F+ +FTLEA +K+  L +  +F   WN
Sbjct: 1107 LRIKCLQTTQKKWFDYTVLFFIGINCITLAMERPSIPPDSFERQFLHISGYIFTVIFTGEMMMKVIANGCFIGQAAYFKDGWNILDGILVVISLINIAFELLATGDSPKIFGVIRVLRLLRALRPLRVINRAPGVKLVVMTLISSLKPIGNIVLICCTFFIIFGILGVQLFKGMMYHCIGPEVGN------VTTKADCIEDYRNKWVNHRYNFDNLGQALMSLFVLSSKDGWVSIMYQGIDAVGVDVQPIENYNEWRMIYFISFLLLVGFFVLNMFVGVVVENFHKCKEALEKEMREKEKEKRLKRKLKRQKFEESMAGKRKKMERNYPYYHDYGHTRLFLHGIVTSKYFDLAIAAVIGINVISMAMEFYMMPMGLKYVLKALNYFFTAVFTLEAAMKLIALGFKRFFIEKWN 1513          

HSP 2 Score: 105.916 bits (263), Expect = 2.650e-22
Identity = 88/343 (25.66%), Postives = 162/343 (47.23%), Query Frame = 3
Query:  507 RKLALLISTNQIFDYFIMLTILVNCVFLALN---NDYP-----------ISEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSA-GNCSKTNP-------------------NSICL---------PHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
            RK AL +  +  FD   M  I++NCV L +     D P           I +      +  EMVI++ + G       Y+ D +N +D  I++      ++ +  G  N+N++++RT+RVLR L+ +  +P ++ + + L+ +L ML  V++L  F    F +  +Q++ G LRN+CV  ++    +SEN S  F N     + + P +     + Y+    D++    CS   P                   N  C+           +  NP  G  +FDN G+A +++F +I+L+ W +    V  A   WN +++++++  G+F++INL L V++  +
Sbjct:  120 RKWALQMVMSPWFDRITMAVIMINCVTLGMYRPCEDGPDCDTYRCQILDIIDNCIFVYFAFEMVIKIMALG-FYGPAAYMSDTWNRLDFFIVMAGIAEFVLHEYLG-GNINLTAIRTVRVLRPLRAVNRIPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCV--INLPKTISENQSALFNNVKLTRF-YIPED---TSLEYICSQPDANGLHTCSNLPPYTVDGVKCNLTLDEYDKVTNDSCINWNIYYNECQVMQRNPFQGSVSFDNIGFAWVAIFLVISLEGWTDIMYYVQDAHSFWNWIYFVLLIVIGAFFMINLCLVVIATQF 454          

HSP 3 Score: 85.5001 bits (210), Expect = 3.665e-16
Identity = 64/237 (27.00%), Postives = 112/237 (47.26%), Query Frame = 3
Query: 1794 KQNVLCSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSK-EYFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIG-----------KQSYRNTYHTQIFGD--NIPRWNFDDFWHSMILVFRIICGE-WIEPSFDCIRANSPLCLLIFI 2459
            K+    SK   F+ ++  FV    F   I   I +NT+ M  E++   +    IL+YSN+ FT ++ +E  LKI+A     Y   G+N+FD  +V  S+++L  E    LS+ R FRL R+ KL +    +R  L ++  T+  +     +++L +++F+ +G             +       Q+        R NFD+F  + + VF+I+  E W    F+ +   +P   L F+
Sbjct:  631 KKKSTPSKLWWFREKIQKFVICDHFTRGILVAILVNTLSMGVEYHQQPEILTVILEYSNLFFTALFALEMLLKIIASGLFGYLADGFNLFDGGIVALSVLELFQEGKGGLSVLRTFRLLRILKLVRFMPALRYQLVVMLRTMDNVTVFFGLLVLFIFIFSTLGMVLFGCKFCNHPDTGLQCTSAQVISSICECDRMNFDNFLFATVTVFQILTQEDWNMVLFNGMAQTNPWAALYFV 867          

HSP 4 Score: 77.0258 bits (188), Expect = 1.617e-13
Identity = 59/201 (29.35%), Postives = 97/201 (48.26%), Query Frame = 3
Query: 1839 LYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIIDLGVEEVDALS---------IFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYM-----FAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRIICGE 2396
            L+  VT  +FDL I+  I IN I MA E Y        +LK  N  FT ++ +E ++K++AL  K +F   WN  D  +VI SI  +  EE +AL          + R  R+ RV KL +  + +R LL  +   + ++GNL  +  L+ ++       + GK      +     G++    +F +F  + + +FRI  G+
Sbjct: 1441 LHGIVTSKYFDLAIAAVIGINVISMAMEFYMMPMGLKYVLKALNYFFTAVFTLEAAMKLIALGFKRFFIEKWNRLDMFIVILSIAGIIFEEFEALELPINPTIIRVMRVLRIARVLKLLKMAKGIRSLLDTVGEALPQVGNLGSLFFLLFFIFAALGVELFGKLECSEDHPCDGLGEHA---HFKNFGMAFLTLFRIATGD 1638          

HSP 5 Score: 76.2554 bits (186), Expect = 2.383e-13
Identity = 44/107 (41.12%), Postives = 71/107 (66.36%), Query Frame = 1
Query: 4417 ITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKT-----GGLDDLVNFETFERSILLLFRLTTAGGWNDILE 4722
            I PT++RV+R+ RI RVL+L+K+AKGIR LL  +  +LP + N+G+L  L+ FI++ +G+ +FG L+ +      GL +  +F+ F  + L LFR+ T   WN I++
Sbjct: 1539 INPTIIRVMRVLRIARVLKLLKMAKGIRSLLDTVGEALPQVGNLGSLFFLLFFIFAALGVELFGKLECSEDHPCDGLGEHAHFKNFGMAFLTLFRIATGDNWNGIMK 1645          

HSP 6 Score: 70.4774 bits (171), Expect = 1.300e-11
Identity = 83/291 (28.52%), Postives = 136/291 (46.74%), Query Frame = 3
Query: 3048 TPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNK 3920
            TP    W   + +  +I +H  F   ILV IL +++ +  E  Y      L   L   N  FT LF +EM+LKII+ G   Y    + + D  IV++S+L L  +  G  + +  FR LR ++ +R + A+ R+Q   +VV        ++F  LLV  +F  IFS  G+  F  KF    D+   +  +A V+ +  EC R         +NFDN     + ++QI T E W  ++ + +  T         N  A   YFV  +  G++ + NL + ++++ F   K +
Sbjct:  635 TPSKLWWFREKIQKFVICDH--FTRGILVAILVNTLSMGVE--YHQQPEILTVILEYSNLFFTALFALEMLLKIIASGLFGYLADGFNLFDGGIVALSVLELFQEGKGGLSVLRTFRLLRILKLVRFMPAL-RYQ---LVVMLRTMDNVTVFFGLLVLFIF--IFSTLGMVLFGCKFCNHPDTGL-QCTSAQVISSICECDR---------MNFDNFLFATVTVFQILTQEDWNMVLFNGMAQT---------NPWAAL-YFVALMTFGNYVLFNLLVAILVEGFQESKEE 895          

HSP 7 Score: 68.9366 bits (167), Expect = 3.663e-11
Identity = 82/338 (24.26%), Postives = 143/338 (42.31%), Query Frame = 3
Query:  474 SFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNND-----------YPISEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSL----RTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFAL---QIYQGTLRN---KCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASG----------SWNILFYIIVVFFGSFYLINLMLAVV 1394
            S  L  P + +R   L  +  + FDY ++  I +NC+ LA+                IS Y+F  I+T EM++++ + G  I    Y +D +N++D +++++S I I  E     ++  +  +    R LR LR L+ I   PG+K +   LI SLK +  ++   L C +FF +F +   Q+++G + +     V  V  K    E++ N++VN  Y                                                   NFDN G AL+S+F L + D W +     I A G           W ++++I  +    F+++N+ + VV
Sbjct: 1097 SLFLMGPKNPLRIKCLQTTQKKWFDYTVLFFIGINCITLAMERPSIPPDSFERQFLHISGYIFTVIFTGEMMMKVIANGCFIGQAAYFKDGWNILDGILVVISLINIAFELLATGDSPKIFGVIRVLRLLRALRPLRVINRAPGVKLVVMTLISSLKPIGNIV---LICCTFFIIFGILGVQLFKGMMYHCIGPEVGNVTTKADCIEDYRNKWVNHRY---------------------------------------------------NFDNLGQALMSLFVLSSKDGWVSIMYQGIDAVGVDVQPIENYNEWRMIYFISFLLLVGFFVLNMFVGVV 1380          

HSP 8 Score: 61.2326 bits (147), Expect = 1.023e-8
Identity = 64/228 (28.07%), Postives = 111/228 (48.68%), Query Frame = 3
Query: 3198 LKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXX---XXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAI----DSTGINLQPKKENQMAYYAYFVIFILVGSF 3860
            LK  L+ +NY FT +F +E  +K+I+LGFK +F   W  LD FIV +S+        + L      T  R +R +R  R L+ +   +G++ +++ +  A+P + N+  +  + + IF+  GV+ F GK  +C + +  + L                     + +F N    FL L++IAT + W  IM+DA+    DS+         + +    +FVIF+L+  F
Sbjct: 1476 LKYVLKALNYFFTAVFTLEAAMKLIALGFKRFFIEKWNRLDMFIVILSIAGIIFEEFEALELPINPTIIRVMRVLRIARVLKLLKMAKGIRSLLDTVGEALPQVGNLGSLFFLLFFIFAALGVELF-GK-LECSEDHPCDGLG-------------------EHAHFKNFGMAFLTLFRIATGDNWNGIMKDALRDDCDSSDHCETNCCVDPILAPCFFVIFVLISQF 1682          

HSP 9 Score: 57.3806 bits (137), Expect = 1.378e-7
Identity = 48/111 (43.24%), Postives = 70/111 (63.06%), Query Frame = 3
Query: 3204 QALRVI-NYIFTYLFCIEMILKIISLGF---KVYFTSFWTXXXXXXXXXXXXX-XXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVC 3521
            Q L +I N IF Y F  EM++KI++LGF     Y +  W  LDFFIV   +   ++++ LG    +TA   +RT+R LRPLRA++R   M+I+VN L+  +P + NVLL+C
Sbjct:  165 QILDIIDNCIFVY-FAFEMVIKIMALGFYGPAAYMSDTWNRLDFFIVMAGIAEFVLHEYLGGNINLTA---IRTVRVLRPLRAVNRIPSMRILVNLLLDTLPMLGNVLLLC 271          

HSP 10 Score: 53.9138 bits (128), Expect = 1.505e-6
Identity = 46/165 (27.88%), Postives = 79/165 (47.88%), Query Frame = 3
Query: 1863 FFDLFISFCIFINTIIMASEH--YPSEKTWDDILKYSNIIFTVIYIIECSLKIMA-----LSKEYFNVGWNIFDFVVVIASIIDLGVEEV---DALSIFRAF------RLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRN-TYH 2306
            +FD  + F I IN I +A E    P +      L  S  IFTVI+  E  +K++A         YF  GWNI D ++V+ S+I++  E +   D+  IF         R  R  ++      ++L++  + S++  +GN+ +I      +F ++G Q ++   YH
Sbjct: 1119 WFDYTVLFFIGINCITLAMERPSIPPDSFERQFLHISGYIFTVIFTGEMMMKVIANGCFIGQAAYFKDGWNILDGILVVISLINIAFELLATGDSPKIFGVIRVLRLLRALRPLRVINRAPGVKLVVMTLISSLKPIGNIVLICCTFFIIFGILGVQLFKGMMYH 1283          
BLAST of Sodium channel protein vs. Ensembl Celegans
Match: cca-1 (Voltage-dependent T-type calcium channel subunit alpha [Source:UniProtKB/TrEMBL;Acc:A0A0K3ASP4])

HSP 1 Score: 162.54 bits (410), Expect = 1.276e-39
Identity = 127/413 (30.75%), Postives = 211/413 (51.09%), Query Frame = 3
Query: 3075 FRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIIS----LGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLR---AISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQ-NHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMK-KLSNRKPRKTVRR------PKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRW-HYFRYMWN 4265
             R + L  T+ + F+ T+L  I  + I L  E   +  +   +Q L +  YIFT +F  EM++K+I+    +G   YF   W ILD  +V ISL+++  ++L  G     F  +R +R LR LR    I+R  G+K+VV  LI ++  I N++L+C  F++IF I GVQ FKG  + C+            V  K++C+    + W N   NFDN     ++L+ +++ +GW+ IM   ID+ G+++QP +        YF+ F+L+  FF+LN+F+GV+++NF++ K   E    +       +      K + S    RK + R           + F + +  S  F+L I  +I +N++ M +E Y        VL  +N  F+ +FTLEA +K+  L +  +F   WN
Sbjct: 1107 LRIKCLQTTQKKWFDYTVLFFIGINCITLAMERPSIPPDSFERQFLHISGYIFTVIFTGEMMMKVIANGCFIGQAAYFKDGWNILDGILVVISLINIAFELLATGDSPKIFGVIRVLRLLRALRPLRVINRAPGVKLVVMTLISSLKPIGNIVLICCTFFIIFGILGVQLFKGMMYHCIGPEVGN------VTTKADCIEDYRNKWVNHRYNFDNLGQALMSLFVLSSKDGWVSIMYQGIDAVGVDVQPIENYNEWRMIYFISFLLLVGFFVLNMFVGVVVENFHKCKEALEKEMREKEKEKRLKRKLKRQKFEESMAGKRKKMERNYPYYHDYGHTRLFLHGIVTSKYFDLAIAAVIGINVISMAMEFYMMPMGLKYVLKALNYFFTAVFTLEAAMKLIALGFKRFFIEKWN 1513          

HSP 2 Score: 105.916 bits (263), Expect = 2.650e-22
Identity = 88/343 (25.66%), Postives = 162/343 (47.23%), Query Frame = 3
Query:  507 RKLALLISTNQIFDYFIMLTILVNCVFLALN---NDYP-----------ISEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSA-GNCSKTNP-------------------NSICL---------PHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
            RK AL +  +  FD   M  I++NCV L +     D P           I +      +  EMVI++ + G       Y+ D +N +D  I++      ++ +  G  N+N++++RT+RVLR L+ +  +P ++ + + L+ +L ML  V++L  F    F +  +Q++ G LRN+CV  ++    +SEN S  F N     + + P +     + Y+    D++    CS   P                   N  C+           +  NP  G  +FDN G+A +++F +I+L+ W +    V  A   WN +++++++  G+F++INL L V++  +
Sbjct:  120 RKWALQMVMSPWFDRITMAVIMINCVTLGMYRPCEDGPDCDTYRCQILDIIDNCIFVYFAFEMVIKIMALG-FYGPAAYMSDTWNRLDFFIVMAGIAEFVLHEYLG-GNINLTAIRTVRVLRPLRAVNRIPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCV--INLPKTISENQSALFNNVKLTRF-YIPED---TSLEYICSQPDANGLHTCSNLPPYTVDGVKCNLTLDEYDKVTNDSCINWNIYYNECQVMQRNPFQGSVSFDNIGFAWVAIFLVISLEGWTDIMYYVQDAHSFWNWIYFVLLIVIGAFFMINLCLVVIATQF 454          

HSP 3 Score: 85.5001 bits (210), Expect = 3.665e-16
Identity = 64/237 (27.00%), Postives = 112/237 (47.26%), Query Frame = 3
Query: 1794 KQNVLCSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSK-EYFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIG-----------KQSYRNTYHTQIFGD--NIPRWNFDDFWHSMILVFRIICGE-WIEPSFDCIRANSPLCLLIFI 2459
            K+    SK   F+ ++  FV    F   I   I +NT+ M  E++   +    IL+YSN+ FT ++ +E  LKI+A     Y   G+N+FD  +V  S+++L  E    LS+ R FRL R+ KL +    +R  L ++  T+  +     +++L +++F+ +G             +       Q+        R NFD+F  + + VF+I+  E W    F+ +   +P   L F+
Sbjct:  631 KKKSTPSKLWWFREKIQKFVICDHFTRGILVAILVNTLSMGVEYHQQPEILTVILEYSNLFFTALFALEMLLKIIASGLFGYLADGFNLFDGGIVALSVLELFQEGKGGLSVLRTFRLLRILKLVRFMPALRYQLVVMLRTMDNVTVFFGLLVLFIFIFSTLGMVLFGCKFCNHPDTGLQCTSAQVISSICECDRMNFDNFLFATVTVFQILTQEDWNMVLFNGMAQTNPWAALYFV 867          

HSP 4 Score: 77.0258 bits (188), Expect = 1.617e-13
Identity = 59/201 (29.35%), Postives = 97/201 (48.26%), Query Frame = 3
Query: 1839 LYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIIDLGVEEVDALS---------IFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYM-----FAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRIICGE 2396
            L+  VT  +FDL I+  I IN I MA E Y        +LK  N  FT ++ +E ++K++AL  K +F   WN  D  +VI SI  +  EE +AL          + R  R+ RV KL +  + +R LL  +   + ++GNL  +  L+ ++       + GK      +     G++    +F +F  + + +FRI  G+
Sbjct: 1441 LHGIVTSKYFDLAIAAVIGINVISMAMEFYMMPMGLKYVLKALNYFFTAVFTLEAAMKLIALGFKRFFIEKWNRLDMFIVILSIAGIIFEEFEALELPINPTIIRVMRVLRIARVLKLLKMAKGIRSLLDTVGEALPQVGNLGSLFFLLFFIFAALGVELFGKLECSEDHPCDGLGEHA---HFKNFGMAFLTLFRIATGD 1638          

HSP 5 Score: 76.2554 bits (186), Expect = 2.383e-13
Identity = 44/107 (41.12%), Postives = 71/107 (66.36%), Query Frame = 1
Query: 4417 ITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKT-----GGLDDLVNFETFERSILLLFRLTTAGGWNDILE 4722
            I PT++RV+R+ RI RVL+L+K+AKGIR LL  +  +LP + N+G+L  L+ FI++ +G+ +FG L+ +      GL +  +F+ F  + L LFR+ T   WN I++
Sbjct: 1539 INPTIIRVMRVLRIARVLKLLKMAKGIRSLLDTVGEALPQVGNLGSLFFLLFFIFAALGVELFGKLECSEDHPCDGLGEHAHFKNFGMAFLTLFRIATGDNWNGIMK 1645          

HSP 6 Score: 70.4774 bits (171), Expect = 1.300e-11
Identity = 83/291 (28.52%), Postives = 136/291 (46.74%), Query Frame = 3
Query: 3048 TPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNK 3920
            TP    W   + +  +I +H  F   ILV IL +++ +  E  Y      L   L   N  FT LF +EM+LKII+ G   Y    + + D  IV++S+L L  +  G  + +  FR LR ++ +R + A+ R+Q   +VV        ++F  LLV  +F  IFS  G+  F  KF    D+   +  +A V+ +  EC R         +NFDN     + ++QI T E W  ++ + +  T         N  A   YFV  +  G++ + NL + ++++ F   K +
Sbjct:  635 TPSKLWWFREKIQKFVICDH--FTRGILVAILVNTLSMGVE--YHQQPEILTVILEYSNLFFTALFALEMLLKIIASGLFGYLADGFNLFDGGIVALSVLELFQEGKGGLSVLRTFRLLRILKLVRFMPAL-RYQ---LVVMLRTMDNVTVFFGLLVLFIF--IFSTLGMVLFGCKFCNHPDTGL-QCTSAQVISSICECDR---------MNFDNFLFATVTVFQILTQEDWNMVLFNGMAQT---------NPWAAL-YFVALMTFGNYVLFNLLVAILVEGFQESKEE 895          

HSP 7 Score: 68.9366 bits (167), Expect = 3.663e-11
Identity = 82/338 (24.26%), Postives = 143/338 (42.31%), Query Frame = 3
Query:  474 SFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNND-----------YPISEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSL----RTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFAL---QIYQGTLRN---KCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASG----------SWNILFYIIVVFFGSFYLINLMLAVV 1394
            S  L  P + +R   L  +  + FDY ++  I +NC+ LA+                IS Y+F  I+T EM++++ + G  I    Y +D +N++D +++++S I I  E     ++  +  +    R LR LR L+ I   PG+K +   LI SLK +  ++   L C +FF +F +   Q+++G + +     V  V  K    E++ N++VN  Y                                                   NFDN G AL+S+F L + D W +     I A G           W ++++I  +    F+++N+ + VV
Sbjct: 1097 SLFLMGPKNPLRIKCLQTTQKKWFDYTVLFFIGINCITLAMERPSIPPDSFERQFLHISGYIFTVIFTGEMMMKVIANGCFIGQAAYFKDGWNILDGILVVISLINIAFELLATGDSPKIFGVIRVLRLLRALRPLRVINRAPGVKLVVMTLISSLKPIGNIV---LICCTFFIIFGILGVQLFKGMMYHCIGPEVGNVTTKADCIEDYRNKWVNHRY---------------------------------------------------NFDNLGQALMSLFVLSSKDGWVSIMYQGIDAVGVDVQPIENYNEWRMIYFISFLLLVGFFVLNMFVGVV 1380          

HSP 8 Score: 61.2326 bits (147), Expect = 1.023e-8
Identity = 64/228 (28.07%), Postives = 111/228 (48.68%), Query Frame = 3
Query: 3198 LKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXX---XXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAI----DSTGINLQPKKENQMAYYAYFVIFILVGSF 3860
            LK  L+ +NY FT +F +E  +K+I+LGFK +F   W  LD FIV +S+        + L      T  R +R +R  R L+ +   +G++ +++ +  A+P + N+  +  + + IF+  GV+ F GK  +C + +  + L                     + +F N    FL L++IAT + W  IM+DA+    DS+         + +    +FVIF+L+  F
Sbjct: 1476 LKYVLKALNYFFTAVFTLEAAMKLIALGFKRFFIEKWNRLDMFIVILSIAGIIFEEFEALELPINPTIIRVMRVLRIARVLKLLKMAKGIRSLLDTVGEALPQVGNLGSLFFLLFFIFAALGVELF-GK-LECSEDHPCDGLG-------------------EHAHFKNFGMAFLTLFRIATGDNWNGIMKDALRDDCDSSDHCETNCCVDPILAPCFFVIFVLISQF 1682          

HSP 9 Score: 57.3806 bits (137), Expect = 1.378e-7
Identity = 48/111 (43.24%), Postives = 70/111 (63.06%), Query Frame = 3
Query: 3204 QALRVI-NYIFTYLFCIEMILKIISLGF---KVYFTSFWTXXXXXXXXXXXXX-XXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVC 3521
            Q L +I N IF Y F  EM++KI++LGF     Y +  W  LDFFIV   +   ++++ LG    +TA   +RT+R LRPLRA++R   M+I+VN L+  +P + NVLL+C
Sbjct:  165 QILDIIDNCIFVY-FAFEMVIKIMALGFYGPAAYMSDTWNRLDFFIVMAGIAEFVLHEYLGGNINLTA---IRTVRVLRPLRAVNRIPSMRILVNLLLDTLPMLGNVLLLC 271          

HSP 10 Score: 53.9138 bits (128), Expect = 1.505e-6
Identity = 46/165 (27.88%), Postives = 79/165 (47.88%), Query Frame = 3
Query: 1863 FFDLFISFCIFINTIIMASEH--YPSEKTWDDILKYSNIIFTVIYIIECSLKIMA-----LSKEYFNVGWNIFDFVVVIASIIDLGVEEV---DALSIFRAF------RLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRN-TYH 2306
            +FD  + F I IN I +A E    P +      L  S  IFTVI+  E  +K++A         YF  GWNI D ++V+ S+I++  E +   D+  IF         R  R  ++      ++L++  + S++  +GN+ +I      +F ++G Q ++   YH
Sbjct: 1119 WFDYTVLFFIGINCITLAMERPSIPPDSFERQFLHISGYIFTVIFTGEMMMKVIANGCFIGQAAYFKDGWNILDGILVVISLINIAFELLATGDSPKIFGVIRVLRLLRALRPLRVINRAPGVKLVVMTLISSLKPIGNIVLICCTFFIIFGILGVQLFKGMMYH 1283          
BLAST of Sodium channel protein vs. Ensembl Fly
Match: para (gene:FBgn0285944 transcript:FBtr0303681)

HSP 1 Score: 564.303 bits (1453), Expect = 7.083e-168
Identity = 340/875 (38.86%), Postives = 507/875 (57.94%), Query Frame = 3
Query: 1809 CSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQI--FGD-NIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIRANSPLCLLIFIPTXXXX-XXXXXXXXXXXXXXXXXXXXXKNTADEDVSKLKIVIERL--------RNI---YPMSRN--------NPLGINKGNQELDSTETLKDIVVNFGCENAAELQNNHEKMRIIKNCKDLSTSNELVNLLPSTGSLSKGNKLINNAIXXXXXXXXXXGKHLXXXXXXXXXXXXXXIDEESVNE-----------------------LKGCCCAICYNP-FQEKKPFHCC--------YCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            C  W+ FQ  + + V DPF +LFI+ CI +NT+ MA +H+   K  + +LK  N  FT  + IE ++K+MA+S K YF  GWNIFDF++V  S+++LG+E V  LS+ R+FRL RVFKLA+SW T+ LL++I+  T+  +GNL+ ++ +++++FAV+G Q +   YH     F D ++PRWNF DF HS ++VFR++CGEWIE  +DC+      C+  F+ T+V+G   V+      LL N  +S     TAD D +K+     R+        RNI   + + RN         P        EL   E L D ++  G +   +L+        I +  + +   ++ N  P      K +K +NNA D+        G H N   K +  K +    E                            L G      ++    ++ P  CC          +  D ++P    W   R ++  + E++ FE  ++  IL SS+ L  ED++L   P L+  L  ++ IFT +F +EM++K ++LGFKVYFT+ W  LDF IV +SL++L     G   ++ AFRS+RT+RALRPLRA+SRW+GMK+VVNAL+ AIPSIFNVLLVC++FWLIF+I GVQ F GK+FKC D N   +L+  ++PN++ C  +N+TW NS +NFD+  N +L L+Q+ATF+GW++IM DAIDS  ++ QP +E  +  Y YFV FI+ GSFF LNLFIGVIIDNFN  K K  G  +++F+T  Q+ YYN MKK+ ++KP K + RP+   Q   +++    +F+++I++ I LNM  M ++ Y  +  +  VLD +N +F  IF+ E ++KI  LR+HYF   WN
Sbjct:  801 CWVWLKFQEWVSLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFTATFAIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVLRSFRLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMGMQLFGKNYHDHKDRFPDGDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDCMYVGDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSAPTADNDTNKIAEAFNRIGRFKSWVKRNIADCFKLIRNKLTNQISDQPSEHGDNELELGHDEILADGLIKKGIKEQTQLE------VAIGDGMEFTIHGDMKNNKP------KKSKYLNNATDDDTASINSYGSHKNRPFKDESHKGSAETMEGEEKRDASKEDLGLDEELDEEGECEEGPLDGDIIIHAHDEDILDEYPADCCPDSYYKKFPILAGDDDSPFWQGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMLSLINLAAVWSG-ADDVPAFRSMRTLRALRPLRAVSRWEGMKVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKYFKCEDMNG-TKLSHEIIPNRNACESENYTWVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKK-AGGSLEMFMTEDQKKYYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEPWN 1660          

HSP 2 Score: 310.457 bits (794), Expect = 9.853e-85
Identity = 169/393 (43.00%), Postives = 254/393 (64.63%), Query Frame = 3
Query:  255 ELKFEVEDFSDNCQPDPELVAGSILLEDKLGEFPEELLGKPLNEIDQNLKDK-SFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPI--SEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMV----DWKNVMSENHSNEFVNAFYYNWTHNPNNWIRN--GINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
            E++++ ED  +  QPDP L  G  +     G FP EL   PL +ID    +  +FVV++   K K I+R+SA+K+  +  P++ IR++A+ I  + +F  FI+ TILVNC+ + +     +  +E +F  IYT E  +++ +RG I+  +TYLRD +N +D ++I L+Y+ + ++        N+++LRT RVLRALKT+ I+PGLKTI  A+I+S+K L +VIIL++F +S FAL  LQIY G L  KC+K       W N+  EN         Y+N   N +NW     GI++  CGN S AG C   + + +CL   GPNPN+GYT+FD+FGWA LS F+L+T D+WE+ Y LV+RA+G W++LF+I+++F GSFYL+NL+LA+V+MSY
Sbjct:   61 EIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELASTPLEDIDPYYSNVLTFVVVS---KGKDIFRFSASKAMWMLDPFNPIRRVAIYILVHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMARGFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLG------NLAALRTFRVLRALKTVAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQKCIKKFPLDGSWGNLTDENWD-------YHN--RNSSNWYSEDEGISFPLCGNISGAGQC---DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRAAGPWHMLFFIVIIFLGSFYLVNLILAIVAMSY 432          

HSP 3 Score: 242.276 bits (617), Expect = 8.752e-64
Identity = 136/322 (42.24%), Postives = 218/322 (67.70%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQPPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIG----DIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQ 5343
            + + ++  F++PTLLRVVR+ ++GRVLRL+K AKGIR LLFAL +SLPALFNI  LL L++FI++I GMS F ++K+  G++D+ NF+TF +S++LLF+++T+ GW+ +L+A+ I    C+      D  Y     G+CG+A  GI ++ +++ I +LI+INMYIA+ILEN++QA    + G+T+DD++M+Y +W+++DP  +QYI+Y  LS+F+  L+ PL I KPN   ++S D+PI  GD M+C+DIL AL K         IE++ E  +I  +         P+      +++T+ R++E+  A+ +Q AW+  KA+
Sbjct: 1676 LSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGINDVYNFKTFGQSMILLFQMSTSAGWDGVLDAI-INEEACDPPD--NDKGYP----GNCGSATVGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDMYYEIWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPICRGDLMYCVDILDALTKDFFARKGNPIEETGEIGEIAAR---------PDTEGYEPVSSTLWRQREEYCARLIQHAWRKHKAR 1981          

HSP 4 Score: 97.8265 bits (242), Expect = 9.245e-20
Identity = 64/206 (31.07%), Postives = 105/206 (50.97%), Query Frame = 3
Query: 1830 QNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEV--------DALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRIICGEWIEPSFDCI 2423
            Q  ++  VTD  FD+ I   I +N   M  + Y +  T++ +L Y N IF VI+  EC LKI AL   YF   WN+FD VVVI SI+ L + ++          L + R  ++ RV +L +  + +R LL  +  ++  + N+ +++ LV+++FA+ G   + +        D    +NF  F  SMIL+F++      +   D I
Sbjct: 1586 QAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEPWNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGIND---VYNFKTFGQSMILLFQMSTSAGWDGVLDAI 1788          

HSP 5 Score: 67.3958 bits (163), Expect = 1.752e-10
Identity = 48/159 (30.19%), Postives = 80/159 (50.31%), Query Frame = 3
Query: 1839 LYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSK-----EYFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLY---MFAVIGKQSY 2291
            +YI V  P F LFI   I +N I+M     P+       ++ + +IFT IY  E ++K+MA         Y    WN  DFVV+  + + +G++    L    A R FRV +  ++   +  L TI+ + I  + NL  +++L ++   +FA++G Q Y
Sbjct:  147 IYILV-HPLFSLFIITTILVNCILMIMPTTPT-------VESTEVIFTGIYTFESAVKVMARGFILCPFTYLRDAWNWLDFVVIALAYVTMGID----LGNLAALRTFRVLRALKTVAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIY 293          

HSP 6 Score: 62.003 bits (149), Expect = 7.041e-9
Identity = 76/321 (23.68%), Postives = 137/321 (42.68%), Query Frame = 3
Query:  495 WSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDY----PI-------SEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLV----------IRASGSWNILFYIIVVFFGSFYLINLMLAVV 1394
            W  +R     +  N+ F+  ++  IL++ + LAL + +    PI        + +F  I+ LEM+I+  + G  +    Y  + +  +D +I++LS I +        +     S+RTLR LR L+ ++   G+K + +AL++++  +F V+++ L     FA+  +Q++ G    KC  M   K       S+E +          PN   RN               C   N   +              NFD+ G A L +FQ+ T   W    N            IR +  +  L+++  + FGSF+ +NL + V+
Sbjct: 1264 WGNLRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTVIFFLEMLIKWLALGFKV----YFTNAWCWLDFVIVMLSLINLAAVWSGADDVPAFRSMRTLRALRPLRAVSRWEGMKVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKYF-KCEDMNGTK------LSHEII----------PN---RNA--------------CESENYTWVN----------SAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFIIFGSFFTLNLFIGVI 1536          

HSP 7 Score: 56.9954 bits (136), Expect = 2.142e-7
Identity = 64/265 (24.15%), Postives = 116/265 (43.77%), Query Frame = 3
Query: 3183 DNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTX--XXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYA---------YFVIFILVGSFFI-LNLFIGVIIDNFNRLKNKYEGNYID 3941
            D + T    L  +N IF  +F  E +LKI +L +  YF   W +  +   I+SI  L L + I  +    T  R +R  +  R LR +   +G++ ++ AL  ++P++FN+ L+  +   IF+I G+ FF          + +E+                 +  N   NF       + L+Q++T  GW  ++   I+    +     +N   Y            F++  LV SF I +N++I VI++N+++     +    D
Sbjct: 1619 DASDTYNAVLDYLNAIFVVIFSSECLLKIFALRYH-YFIEPWNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFM---------HVKEK-----------------SGINDVYNFKTFGQSMILLFQMSTSAGWDGVLDAIINEEACD---PPDNDKGYPGNCGSATVGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEGLTD 1853          

HSP 8 Score: 54.299 bits (129), Expect = 1.640e-6
Identity = 65/320 (20.31%), Postives = 144/320 (45.00%), Query Frame = 3
Query: 3078 RNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKV----YFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFF-KCL-----------------DSNTR---------ERLAATVVPNKSECLRQNHTW-------ANSN---INFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLK 3914
            R  ++ I  H  F   I+  IL + I +      +   PT++        IFT ++  E  +K+++ GF +    Y    W  LDF +++++ ++        G ++    +LRT R LR L+ ++   G+K +V A+I ++ ++ +V+++ +    +F++ G+Q + G    KC+                 D + R         E ++  +  N S   + +  +        N N    +FD+    FL+ +++ T + W ++ Q  + + G            +  +F++ I +GSF+++NL + ++  +++ L+
Sbjct:  143 RRVAIYILVHPLFSLFIITTILVNCILMI-----MPTTPTVEST----EVIFTGIYTFESAVKVMARGFILCPFTYLRDAWNWLDFVVIALAYVT-------MGIDLGNLAALRTFRVLRALKTVAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQKCIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQCDDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRAAG----------PWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQ 436          
BLAST of Sodium channel protein vs. Ensembl Fly
Match: para (gene:FBgn0285944 transcript:FBtr0303661)

HSP 1 Score: 558.525 bits (1438), Expect = 5.083e-166
Identity = 337/875 (38.51%), Postives = 508/875 (58.06%), Query Frame = 3
Query: 1809 CSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTY--HTQIFGD-NIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIRANSPLCLLIFIPTXXXX-XXXXXXXXXXXXXXXXXXXXXKNTADEDVSKLKIVIERL--------RNI---YPMSRN--------NPLGINKGNQELDSTETLKDIVVNFGCENAAELQNNHEKMRIIKNCKDLSTSNELVNLLPSTGSLSKGNKLINNAIXXXXXXXXXXGKHLXXXXXXXXXXXXXXIDEESVNE-----------------------LKGCCCAICYNP-FQEKKPFHCC--------YCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            C  W+ FQ  + + V DPF +LFI+ CI +NT+ MA +H+   K  + +LK  N  FT  + IE ++K+MA+S K YF  GWNIFDF++V  S+++LG+E V  LS+ R+FRL RVFKLA+SW T+ LL++I+  T+  +GNL+ ++ +++++FAV+G Q +   Y  H   F D ++PRWNF DF HS ++VFR++CGEWIE  +DC+      C+  F+ T+V+G   V+      LL N  +S     TAD D +K+     R+        RNI   + + RN         P        EL   E L D ++  G +   +L+        I +  + +   ++ N  P      K +K +NNA D+        G H N   K +  K +    E                            L G      ++    ++ P  CC          +  D ++P    W   R ++  + E++ FE  ++  IL SS+ L  ED++L   P L+  L  ++ IFT +F +EM++K ++LGFKVYFT+ W  LDF IV +SL++ +  ++G G  + AF+++RT+RALRPLRA+SR QGM++VVNAL+ AIPSIFNVLLVC++FWLIF+I GVQ F GK+FKC D N   +L+  ++PN++ C  +N+TW NS +NFD+  N +L L+Q+ATF+GW++IM DAIDS  ++ QP +E  +  Y YFV FI+ GSFF LNLFIGVIIDNFN  K K  G  +++F+T  Q+ YYN MKK+ ++KP K + RP+   Q   +++    +F+++I++ I LNM  M ++ Y  +  +  VLD +N +F  IF+ E ++KI  LR+HYF   WN
Sbjct:  769 CWVWLKFQEWVSLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFTATFAIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVLRSFRLLRVFKLAKSWPTLNLLISIMGRTVGALGNLTFVLCIIIFIFAVMGMQLFGKNYTDHKDRFPDGDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDCMYVGDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSAPTADNDTNKIAEAFNRIGRFKSWVKRNIADCFKLIRNKLTNQISDQPSEHGDNELELGHDEILADGLIKKGIKEQTQLE------VAIGDGMEFTIHGDMKNNKP------KKSKYLNNATDDDTASINSYGSHKNRPFKDESHKGSAETMEGEEKRDASKEDLGLDEELDEEGECEEGPLDGDIIIHAHDEDILDEYPADCCPDSYYKKFPILAGDDDSPFWQGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLINFVASLVGAGG-IQAFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKYFKCEDMNG-TKLSHEIIPNRNACESENYTWVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKK-AGGSLEMFMTEDQKKYYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEPWN 1628          

HSP 2 Score: 310.457 bits (794), Expect = 8.264e-85
Identity = 169/393 (43.00%), Postives = 254/393 (64.63%), Query Frame = 3
Query:  255 ELKFEVEDFSDNCQPDPELVAGSILLEDKLGEFPEELLGKPLNEIDQNLKDK-SFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPI--SEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMV----DWKNVMSENHSNEFVNAFYYNWTHNPNNWIRN--GINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
            E++++ ED  +  QPDP L  G  +     G FP EL   PL +ID    +  +FVV++   K K I+R+SA+K+  +  P++ IR++A+ I  + +F  FI+ TILVNC+ + +     +  +E +F  IYT E  +++ +RG I+  +TYLRD +N +D ++I L+Y+ + ++        N+++LRT RVLRALKT+ I+PGLKTI  A+I+S+K L +VIIL++F +S FAL  LQIY G L  KC+K       W N+  EN         Y+N   N +NW     GI++  CGN S AG C   + + +CL   GPNPN+GYT+FD+FGWA LS F+L+T D+WE+ Y LV+RA+G W++LF+I+++F GSFYL+NL+LA+V+MSY
Sbjct:   61 EIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELASTPLEDIDPYYSNVLTFVVVS---KGKDIFRFSASKAMWMLDPFNPIRRVAIYILVHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMARGFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLG------NLAALRTFRVLRALKTVAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQKCIKKFPLDGSWGNLTDENWD-------YHN--RNSSNWYSEDEGISFPLCGNISGAGQC---DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRAAGPWHMLFFIVIIFLGSFYLVNLILAIVAMSY 432          

HSP 3 Score: 242.276 bits (617), Expect = 8.386e-64
Identity = 136/322 (42.24%), Postives = 218/322 (67.70%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQPPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIG----DIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQ 5343
            + + ++  F++PTLLRVVR+ ++GRVLRL+K AKGIR LLFAL +SLPALFNI  LL L++FI++I GMS F ++K+  G++D+ NF+TF +S++LLF+++T+ GW+ +L+A+ I    C+      D  Y     G+CG+A  GI ++ +++ I +LI+INMYIA+ILEN++QA    + G+T+DD++M+Y +W+++DP  +QYI+Y  LS+F+  L+ PL I KPN   ++S D+PI  GD M+C+DIL AL K         IE++ E  +I  +         P+      +++T+ R++E+  A+ +Q AW+  KA+
Sbjct: 1644 LSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGINDVYNFKTFGQSMILLFQMSTSAGWDGVLDAI-INEEACDPPD--NDKGYP----GNCGSATVGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDMYYEIWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPICRGDLMYCVDILDALTKDFFARKGNPIEETGEIGEIAAR---------PDTEGYEPVSSTLWRQREEYCARLIQHAWRKHKAR 1949          

HSP 4 Score: 97.8265 bits (242), Expect = 7.913e-20
Identity = 64/206 (31.07%), Postives = 105/206 (50.97%), Query Frame = 3
Query: 1830 QNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEV--------DALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRIICGEWIEPSFDCI 2423
            Q  ++  VTD  FD+ I   I +N   M  + Y +  T++ +L Y N IF VI+  EC LKI AL   YF   WN+FD VVVI SI+ L + ++          L + R  ++ RV +L +  + +R LL  +  ++  + N+ +++ LV+++FA+ G   + +        D    +NF  F  SMIL+F++      +   D I
Sbjct: 1554 QAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEPWNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGIND---VYNFKTFGQSMILLFQMSTSAGWDGVLDAI 1756          

HSP 5 Score: 67.3958 bits (163), Expect = 1.778e-10
Identity = 48/159 (30.19%), Postives = 80/159 (50.31%), Query Frame = 3
Query: 1839 LYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSK-----EYFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLY---MFAVIGKQSY 2291
            +YI V  P F LFI   I +N I+M     P+       ++ + +IFT IY  E ++K+MA         Y    WN  DFVV+  + + +G++    L    A R FRV +  ++   +  L TI+ + I  + NL  +++L ++   +FA++G Q Y
Sbjct:  147 IYILV-HPLFSLFIITTILVNCILMIMPTTPT-------VESTEVIFTGIYTFESAVKVMARGFILCPFTYLRDAWNWLDFVVIALAYVTMGID----LGNLAALRTFRVLRALKTVAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIY 293          

HSP 6 Score: 57.3806 bits (137), Expect = 1.885e-7
Identity = 64/265 (24.15%), Postives = 116/265 (43.77%), Query Frame = 3
Query: 3183 DNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTX--XXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYA---------YFVIFILVGSFFI-LNLFIGVIIDNFNRLKNKYEGNYID 3941
            D + T    L  +N IF  +F  E +LKI +L +  YF   W +  +   I+SI  L L + I  +    T  R +R  +  R LR +   +G++ ++ AL  ++P++FN+ L+  +   IF+I G+ FF          + +E+                 +  N   NF       + L+Q++T  GW  ++   I+    +     +N   Y            F++  LV SF I +N++I VI++N+++     +    D
Sbjct: 1587 DASDTYNAVLDYLNAIFVVIFSSECLLKIFALRYH-YFIEPWNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFM---------HVKEK-----------------SGINDVYNFKTFGQSMILLFQMSTSAGWDGVLDAIINEEACD---PPDNDKGYPGNCGSATVGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEGLTD 1821          

HSP 7 Score: 54.299 bits (129), Expect = 1.431e-6
Identity = 74/324 (22.84%), Postives = 139/324 (42.90%), Query Frame = 3
Query:  495 WSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDY----PI-------SEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRA---LKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLV----------IRASGSWNILFYIIVVFFGSFYLINLMLAVV 1394
            W  +R     +  N+ F+  ++  IL++ + LAL + +    PI        + +F  I+ LEM+I+  + G  +    Y  + +  +D +I+++S I   V    G   +   + +T+R LRA   L+ ++ + G++ + +AL++++  +F V+++ L     FA+  +Q++ G    KC  M   K       S+E +          PN   RN               C   N   +              NFD+ G A L +FQ+ T   W    N            IR +  +  L+++  + FGSF+ +NL + V+
Sbjct: 1232 WGNLRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTVIFFLEMLIKWLALGFKV----YFTNAWCWLDFVIVMVSLINF-VASLVGAGGIQ--AFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKYF-KCEDMNGTK------LSHEII----------PN---RNA--------------CESENYTWVN----------SAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFIIFGSFFTLNLFIGVI 1504          

HSP 8 Score: 54.299 bits (129), Expect = 1.531e-6
Identity = 65/320 (20.31%), Postives = 144/320 (45.00%), Query Frame = 3
Query: 3078 RNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKV----YFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFF-KCL-----------------DSNTR---------ERLAATVVPNKSECLRQNHTW-------ANSN---INFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLK 3914
            R  ++ I  H  F   I+  IL + I +      +   PT++        IFT ++  E  +K+++ GF +    Y    W  LDF +++++ ++        G ++    +LRT R LR L+ ++   G+K +V A+I ++ ++ +V+++ +    +F++ G+Q + G    KC+                 D + R         E ++  +  N S   + +  +        N N    +FD+    FL+ +++ T + W ++ Q  + + G            +  +F++ I +GSF+++NL + ++  +++ L+
Sbjct:  143 RRVAIYILVHPLFSLFIITTILVNCILMI-----MPTTPTVEST----EVIFTGIYTFESAVKVMARGFILCPFTYLRDAWNWLDFVVIALAYVT-------MGIDLGNLAALRTFRVLRALKTVAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQKCIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQCDDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRAAG----------PWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQ 436          
BLAST of Sodium channel protein vs. Ensembl Fly
Match: para (gene:FBgn0285944 transcript:FBtr0303660)

HSP 1 Score: 558.91 bits (1439), Expect = 5.971e-166
Identity = 337/875 (38.51%), Postives = 508/875 (58.06%), Query Frame = 3
Query: 1809 CSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTY--HTQIFGD-NIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIRANSPLCLLIFIPTXXXX-XXXXXXXXXXXXXXXXXXXXXKNTADEDVSKLKIVIERL--------RNI---YPMSRN--------NPLGINKGNQELDSTETLKDIVVNFGCENAAELQNNHEKMRIIKNCKDLSTSNELVNLLPSTGSLSKGNKLINNAIXXXXXXXXXXGKHLXXXXXXXXXXXXXXIDEESVNE-----------------------LKGCCCAICYNP-FQEKKPFHCC--------YCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            C  W+ FQ  + + V DPF +LFI+ CI +NT+ MA +H+   K  + +LK  N  FT  + IE ++K+MA+S K YF  GWNIFDF++V  S+++LG+E V  LS+ R+FRL RVFKLA+SW T+ LL++I+  T+  +GNL+ ++ +++++FAV+G Q +   Y  H   F D ++PRWNF DF HS ++VFR++CGEWIE  +DC+      C+  F+ T+V+G   V+      LL N  +S     TAD D +K+     R+        RNI   + + RN         P        EL   E L D ++  G +   +L+        I +  + +   ++ N  P      K +K +NNA D+        G H N   K +  K +    E                            L G      ++    ++ P  CC          +  D ++P    W   R ++  + E++ FE  ++  IL SS+ L  ED++L   P L+  L  ++ IFT +F +EM++K ++LGFKVYFT+ W  LDF IV +SL++ +  ++G G  + AF+++RT+RALRPLRA+SR QGM++VVNAL+ AIPSIFNVLLVC++FWLIF+I GVQ F GK+FKC D N   +L+  ++PN++ C  +N+TW NS +NFD+  N +L L+Q+ATF+GW++IM DAIDS  ++ QP +E  +  Y YFV FI+ GSFF LNLFIGVIIDNFN  K K  G  +++F+T  Q+ YYN MKK+ ++KP K + RP+   Q   +++    +F+++I++ I LNM  M ++ Y  +  +  VLD +N +F  IF+ E ++KI  LR+HYF   WN
Sbjct:  793 CWVWLKFQEWVSLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFTATFAIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVLRSFRLLRVFKLAKSWPTLNLLISIMGRTVGALGNLTFVLCIIIFIFAVMGMQLFGKNYTDHKDRFPDGDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDCMYVGDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSAPTADNDTNKIAEAFNRIGRFKSWVKRNIADCFKLIRNKLTNQISDQPSEHGDNELELGHDEILADGLIKKGIKEQTQLE------VAIGDGMEFTIHGDMKNNKP------KKSKYLNNATDDDTASINSYGSHKNRPFKDESHKGSAETMEGEEKRDASKEDLGLDEELDEEGECEEGPLDGDIIIHAHDEDILDEYPADCCPDSYYKKFPILAGDDDSPFWQGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLINFVASLVGAGG-IQAFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKYFKCEDMNG-TKLSHEIIPNRNACESENYTWVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKK-AGGSLEMFMTEDQKKYYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEPWN 1652          

HSP 2 Score: 310.842 bits (795), Expect = 7.695e-85
Identity = 169/393 (43.00%), Postives = 254/393 (64.63%), Query Frame = 3
Query:  255 ELKFEVEDFSDNCQPDPELVAGSILLEDKLGEFPEELLGKPLNEIDQNLKDK-SFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPI--SEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMV----DWKNVMSENHSNEFVNAFYYNWTHNPNNWIRN--GINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
            E++++ ED  +  QPDP L  G  +     G FP EL   PL +ID    +  +FVV++   K K I+R+SA+K+  +  P++ IR++A+ I  + +F  FI+ TILVNC+ + +     +  +E +F  IYT E  +++ +RG I+  +TYLRD +N +D ++I L+Y+ + ++        N+++LRT RVLRALKT+ I+PGLKTI  A+I+S+K L +VIIL++F +S FAL  LQIY G L  KC+K       W N+  EN         Y+N   N +NW     GI++  CGN S AG C   + + +CL   GPNPN+GYT+FD+FGWA LS F+L+T D+WE+ Y LV+RA+G W++LF+I+++F GSFYL+NL+LA+V+MSY
Sbjct:   61 EIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELASTPLEDIDPYYSNVLTFVVVS---KGKDIFRFSASKAMWMLDPFNPIRRVAIYILVHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMARGFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLG------NLAALRTFRVLRALKTVAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQKCIKKFPLDGSWGNLTDENWD-------YHN--RNSSNWYSEDEGISFPLCGNISGAGQC---DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRAAGPWHMLFFIVIIFLGSFYLVNLILAIVAMSY 432          

HSP 3 Score: 242.276 bits (617), Expect = 8.282e-64
Identity = 136/322 (42.24%), Postives = 218/322 (67.70%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQPPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIG----DIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQ 5343
            + + ++  F++PTLLRVVR+ ++GRVLRL+K AKGIR LLFAL +SLPALFNI  LL L++FI++I GMS F ++K+  G++D+ NF+TF +S++LLF+++T+ GW+ +L+A+ I    C+      D  Y     G+CG+A  GI ++ +++ I +LI+INMYIA+ILEN++QA    + G+T+DD++M+Y +W+++DP  +QYI+Y  LS+F+  L+ PL I KPN   ++S D+PI  GD M+C+DIL AL K         IE++ E  +I  +         P+      +++T+ R++E+  A+ +Q AW+  KA+
Sbjct: 1668 LSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGINDVYNFKTFGQSMILLFQMSTSAGWDGVLDAI-INEEACDPPD--NDKGYP----GNCGSATVGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDMYYEIWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPICRGDLMYCVDILDALTKDFFARKGNPIEETGEIGEIAAR---------PDTEGYEPVSSTLWRQREEYCARLIQHAWRKHKAR 1973          

HSP 4 Score: 98.2117 bits (243), Expect = 7.114e-20
Identity = 64/206 (31.07%), Postives = 105/206 (50.97%), Query Frame = 3
Query: 1830 QNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEV--------DALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRIICGEWIEPSFDCI 2423
            Q  ++  VTD  FD+ I   I +N   M  + Y +  T++ +L Y N IF VI+  EC LKI AL   YF   WN+FD VVVI SI+ L + ++          L + R  ++ RV +L +  + +R LL  +  ++  + N+ +++ LV+++FA+ G   + +        D    +NF  F  SMIL+F++      +   D I
Sbjct: 1578 QAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEPWNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGIND---VYNFKTFGQSMILLFQMSTSAGWDGVLDAI 1780          

HSP 5 Score: 67.3958 bits (163), Expect = 1.651e-10
Identity = 48/159 (30.19%), Postives = 80/159 (50.31%), Query Frame = 3
Query: 1839 LYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSK-----EYFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLY---MFAVIGKQSY 2291
            +YI V  P F LFI   I +N I+M     P+       ++ + +IFT IY  E ++K+MA         Y    WN  DFVV+  + + +G++    L    A R FRV +  ++   +  L TI+ + I  + NL  +++L ++   +FA++G Q Y
Sbjct:  147 IYILV-HPLFSLFIITTILVNCILMIMPTTPT-------VESTEVIFTGIYTFESAVKVMARGFILCPFTYLRDAWNWLDFVVIALAYVTMGID----LGNLAALRTFRVLRALKTVAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIY 293          

HSP 6 Score: 56.9954 bits (136), Expect = 1.985e-7
Identity = 64/265 (24.15%), Postives = 116/265 (43.77%), Query Frame = 3
Query: 3183 DNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTX--XXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYA---------YFVIFILVGSFFI-LNLFIGVIIDNFNRLKNKYEGNYID 3941
            D + T    L  +N IF  +F  E +LKI +L +  YF   W +  +   I+SI  L L + I  +    T  R +R  +  R LR +   +G++ ++ AL  ++P++FN+ L+  +   IF+I G+ FF          + +E+                 +  N   NF       + L+Q++T  GW  ++   I+    +     +N   Y            F++  LV SF I +N++I VI++N+++     +    D
Sbjct: 1611 DASDTYNAVLDYLNAIFVVIFSSECLLKIFALRYH-YFIEPWNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFM---------HVKEK-----------------SGINDVYNFKTFGQSMILLFQMSTSAGWDGVLDAIINEEACD---PPDNDKGYPGNCGSATVGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEGLTD 1845          

HSP 7 Score: 54.299 bits (129), Expect = 1.445e-6
Identity = 74/324 (22.84%), Postives = 139/324 (42.90%), Query Frame = 3
Query:  495 WSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDY----PI-------SEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRA---LKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLV----------IRASGSWNILFYIIVVFFGSFYLINLMLAVV 1394
            W  +R     +  N+ F+  ++  IL++ + LAL + +    PI        + +F  I+ LEM+I+  + G  +    Y  + +  +D +I+++S I   V    G   +   + +T+R LRA   L+ ++ + G++ + +AL++++  +F V+++ L     FA+  +Q++ G    KC  M   K       S+E +          PN   RN               C   N   +              NFD+ G A L +FQ+ T   W    N            IR +  +  L+++  + FGSF+ +NL + V+
Sbjct: 1256 WGNLRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTVIFFLEMLIKWLALGFKV----YFTNAWCWLDFVIVMVSLINF-VASLVGAGGIQ--AFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKYF-KCEDMNGTK------LSHEII----------PN---RNA--------------CESENYTWVN----------SAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFIIFGSFFTLNLFIGVI 1528          

HSP 8 Score: 54.299 bits (129), Expect = 1.585e-6
Identity = 65/320 (20.31%), Postives = 144/320 (45.00%), Query Frame = 3
Query: 3078 RNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKV----YFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFF-KCL-----------------DSNTR---------ERLAATVVPNKSECLRQNHTW-------ANSN---INFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLK 3914
            R  ++ I  H  F   I+  IL + I +      +   PT++        IFT ++  E  +K+++ GF +    Y    W  LDF +++++ ++        G ++    +LRT R LR L+ ++   G+K +V A+I ++ ++ +V+++ +    +F++ G+Q + G    KC+                 D + R         E ++  +  N S   + +  +        N N    +FD+    FL+ +++ T + W ++ Q  + + G            +  +F++ I +GSF+++NL + ++  +++ L+
Sbjct:  143 RRVAIYILVHPLFSLFIITTILVNCILMI-----MPTTPTVEST----EVIFTGIYTFESAVKVMARGFILCPFTYLRDAWNWLDFVVIALAYVT-------MGIDLGNLAALRTFRVLRALKTVAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQKCIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQCDDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRAAG----------PWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQ 436          
BLAST of Sodium channel protein vs. Ensembl Fly
Match: para (gene:FBgn0285944 transcript:FBtr0303656)

HSP 1 Score: 558.91 bits (1439), Expect = 5.972e-166
Identity = 337/875 (38.51%), Postives = 508/875 (58.06%), Query Frame = 3
Query: 1809 CSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTY--HTQIFGD-NIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIRANSPLCLLIFIPTXXXX-XXXXXXXXXXXXXXXXXXXXXKNTADEDVSKLKIVIERL--------RNI---YPMSRN--------NPLGINKGNQELDSTETLKDIVVNFGCENAAELQNNHEKMRIIKNCKDLSTSNELVNLLPSTGSLSKGNKLINNAIXXXXXXXXXXGKHLXXXXXXXXXXXXXXIDEESVNE-----------------------LKGCCCAICYNP-FQEKKPFHCC--------YCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            C  W+ FQ  + + V DPF +LFI+ CI +NT+ MA +H+   K  + +LK  N  FT  + IE ++K+MA+S K YF  GWNIFDF++V  S+++LG+E V  LS+ R+FRL RVFKLA+SW T+ LL++I+  T+  +GNL+ ++ +++++FAV+G Q +   Y  H   F D ++PRWNF DF HS ++VFR++CGEWIE  +DC+      C+  F+ T+V+G   V+      LL N  +S     TAD D +K+     R+        RNI   + + RN         P        EL   E L D ++  G +   +L+        I +  + +   ++ N  P      K +K +NNA D+        G H N   K +  K +    E                            L G      ++    ++ P  CC          +  D ++P    W   R ++  + E++ FE  ++  IL SS+ L  ED++L   P L+  L  ++ IFT +F +EM++K ++LGFKVYFT+ W  LDF IV +SL++ +  ++G G  + AF+++RT+RALRPLRA+SR QGM++VVNAL+ AIPSIFNVLLVC++FWLIF+I GVQ F GK+FKC D N   +L+  ++PN++ C  +N+TW NS +NFD+  N +L L+Q+ATF+GW++IM DAIDS  ++ QP +E  +  Y YFV FI+ GSFF LNLFIGVIIDNFN  K K  G  +++F+T  Q+ YYN MKK+ ++KP K + RP+   Q   +++    +F+++I++ I LNM  M ++ Y  +  +  VLD +N +F  IF+ E ++KI  LR+HYF   WN
Sbjct:  801 CWVWLKFQEWVSLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFTATFAIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVLRSFRLLRVFKLAKSWPTLNLLISIMGRTVGALGNLTFVLCIIIFIFAVMGMQLFGKNYTDHKDRFPDGDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDCMYVGDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSAPTADNDTNKIAEAFNRIGRFKSWVKRNIADCFKLIRNKLTNQISDQPSEHGDNELELGHDEILADGLIKKGIKEQTQLE------VAIGDGMEFTIHGDMKNNKP------KKSKYLNNATDDDTASINSYGSHKNRPFKDESHKGSAETMEGEEKRDASKEDLGLDEELDEEGECEEGPLDGDIIIHAHDEDILDEYPADCCPDSYYKKFPILAGDDDSPFWQGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLINFVASLVGAGG-IQAFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKYFKCEDMNG-TKLSHEIIPNRNACESENYTWVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKK-AGGSLEMFMTEDQKKYYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEPWN 1660          

HSP 2 Score: 310.457 bits (794), Expect = 8.815e-85
Identity = 169/393 (43.00%), Postives = 254/393 (64.63%), Query Frame = 3
Query:  255 ELKFEVEDFSDNCQPDPELVAGSILLEDKLGEFPEELLGKPLNEIDQNLKDK-SFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPI--SEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMV----DWKNVMSENHSNEFVNAFYYNWTHNPNNWIRN--GINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
            E++++ ED  +  QPDP L  G  +     G FP EL   PL +ID    +  +FVV++   K K I+R+SA+K+  +  P++ IR++A+ I  + +F  FI+ TILVNC+ + +     +  +E +F  IYT E  +++ +RG I+  +TYLRD +N +D ++I L+Y+ + ++        N+++LRT RVLRALKT+ I+PGLKTI  A+I+S+K L +VIIL++F +S FAL  LQIY G L  KC+K       W N+  EN         Y+N   N +NW     GI++  CGN S AG C   + + +CL   GPNPN+GYT+FD+FGWA LS F+L+T D+WE+ Y LV+RA+G W++LF+I+++F GSFYL+NL+LA+V+MSY
Sbjct:   61 EIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELASTPLEDIDPYYSNVLTFVVVS---KGKDIFRFSASKAMWMLDPFNPIRRVAIYILVHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMARGFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLG------NLAALRTFRVLRALKTVAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQKCIKKFPLDGSWGNLTDENWD-------YHN--RNSSNWYSEDEGISFPLCGNISGAGQC---DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRAAGPWHMLFFIVIIFLGSFYLVNLILAIVAMSY 432          

HSP 3 Score: 242.276 bits (617), Expect = 8.108e-64
Identity = 136/322 (42.24%), Postives = 218/322 (67.70%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQPPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIG----DIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQ 5343
            + + ++  F++PTLLRVVR+ ++GRVLRL+K AKGIR LLFAL +SLPALFNI  LL L++FI++I GMS F ++K+  G++D+ NF+TF +S++LLF+++T+ GW+ +L+A+ I    C+      D  Y     G+CG+A  GI ++ +++ I +LI+INMYIA+ILEN++QA    + G+T+DD++M+Y +W+++DP  +QYI+Y  LS+F+  L+ PL I KPN   ++S D+PI  GD M+C+DIL AL K         IE++ E  +I  +         P+      +++T+ R++E+  A+ +Q AW+  KA+
Sbjct: 1676 LSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGINDVYNFKTFGQSMILLFQMSTSAGWDGVLDAI-INEEACDPPD--NDKGYP----GNCGSATVGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDMYYEIWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPICRGDLMYCVDILDALTKDFFARKGNPIEETGEIGEIAAR---------PDTEGYEPVSSTLWRQREEYCARLIQHAWRKHKAR 1981          

HSP 4 Score: 98.2117 bits (243), Expect = 7.681e-20
Identity = 64/206 (31.07%), Postives = 105/206 (50.97%), Query Frame = 3
Query: 1830 QNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEV--------DALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRIICGEWIEPSFDCI 2423
            Q  ++  VTD  FD+ I   I +N   M  + Y +  T++ +L Y N IF VI+  EC LKI AL   YF   WN+FD VVVI SI+ L + ++          L + R  ++ RV +L +  + +R LL  +  ++  + N+ +++ LV+++FA+ G   + +        D    +NF  F  SMIL+F++      +   D I
Sbjct: 1586 QAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEPWNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGIND---VYNFKTFGQSMILLFQMSTSAGWDGVLDAI 1788          

HSP 5 Score: 67.3958 bits (163), Expect = 1.708e-10
Identity = 48/159 (30.19%), Postives = 80/159 (50.31%), Query Frame = 3
Query: 1839 LYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSK-----EYFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLY---MFAVIGKQSY 2291
            +YI V  P F LFI   I +N I+M     P+       ++ + +IFT IY  E ++K+MA         Y    WN  DFVV+  + + +G++    L    A R FRV +  ++   +  L TI+ + I  + NL  +++L ++   +FA++G Q Y
Sbjct:  147 IYILV-HPLFSLFIITTILVNCILMIMPTTPT-------VESTEVIFTGIYTFESAVKVMARGFILCPFTYLRDAWNWLDFVVIALAYVTMGID----LGNLAALRTFRVLRALKTVAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIY 293          

HSP 6 Score: 56.9954 bits (136), Expect = 2.089e-7
Identity = 64/265 (24.15%), Postives = 116/265 (43.77%), Query Frame = 3
Query: 3183 DNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTX--XXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYA---------YFVIFILVGSFFI-LNLFIGVIIDNFNRLKNKYEGNYID 3941
            D + T    L  +N IF  +F  E +LKI +L +  YF   W +  +   I+SI  L L + I  +    T  R +R  +  R LR +   +G++ ++ AL  ++P++FN+ L+  +   IF+I G+ FF          + +E+                 +  N   NF       + L+Q++T  GW  ++   I+    +     +N   Y            F++  LV SF I +N++I VI++N+++     +    D
Sbjct: 1619 DASDTYNAVLDYLNAIFVVIFSSECLLKIFALRYH-YFIEPWNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFM---------HVKEK-----------------SGINDVYNFKTFGQSMILLFQMSTSAGWDGVLDAIINEEACD---PPDNDKGYPGNCGSATVGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEGLTD 1853          

HSP 7 Score: 54.299 bits (129), Expect = 1.375e-6
Identity = 74/324 (22.84%), Postives = 139/324 (42.90%), Query Frame = 3
Query:  495 WSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDY----PI-------SEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRA---LKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLV----------IRASGSWNILFYIIVVFFGSFYLINLMLAVV 1394
            W  +R     +  N+ F+  ++  IL++ + LAL + +    PI        + +F  I+ LEM+I+  + G  +    Y  + +  +D +I+++S I   V    G   +   + +T+R LRA   L+ ++ + G++ + +AL++++  +F V+++ L     FA+  +Q++ G    KC  M   K       S+E +          PN   RN               C   N   +              NFD+ G A L +FQ+ T   W    N            IR +  +  L+++  + FGSF+ +NL + V+
Sbjct: 1264 WGNLRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTVIFFLEMLIKWLALGFKV----YFTNAWCWLDFVIVMVSLINF-VASLVGAGGIQ--AFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKYF-KCEDMNGTK------LSHEII----------PN---RNA--------------CESENYTWVN----------SAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFIIFGSFFTLNLFIGVI 1536          

HSP 8 Score: 54.299 bits (129), Expect = 1.521e-6
Identity = 65/320 (20.31%), Postives = 144/320 (45.00%), Query Frame = 3
Query: 3078 RNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKV----YFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFF-KCL-----------------DSNTR---------ERLAATVVPNKSECLRQNHTW-------ANSN---INFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLK 3914
            R  ++ I  H  F   I+  IL + I +      +   PT++        IFT ++  E  +K+++ GF +    Y    W  LDF +++++ ++        G ++    +LRT R LR L+ ++   G+K +V A+I ++ ++ +V+++ +    +F++ G+Q + G    KC+                 D + R         E ++  +  N S   + +  +        N N    +FD+    FL+ +++ T + W ++ Q  + + G            +  +F++ I +GSF+++NL + ++  +++ L+
Sbjct:  143 RRVAIYILVHPLFSLFIITTILVNCILMI-----MPTTPTVEST----EVIFTGIYTFESAVKVMARGFILCPFTYLRDAWNWLDFVVIALAYVT-------MGIDLGNLAALRTFRVLRALKTVAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQKCIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQCDDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRAAG----------PWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQ 436          
BLAST of Sodium channel protein vs. Ensembl Fly
Match: para (gene:FBgn0285944 transcript:FBtr0303662)

HSP 1 Score: 558.525 bits (1438), Expect = 6.217e-166
Identity = 337/875 (38.51%), Postives = 508/875 (58.06%), Query Frame = 3
Query: 1809 CSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTY--HTQIFGD-NIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIRANSPLCLLIFIPTXXXX-XXXXXXXXXXXXXXXXXXXXXKNTADEDVSKLKIVIERL--------RNI---YPMSRN--------NPLGINKGNQELDSTETLKDIVVNFGCENAAELQNNHEKMRIIKNCKDLSTSNELVNLLPSTGSLSKGNKLINNAIXXXXXXXXXXGKHLXXXXXXXXXXXXXXIDEESVNE-----------------------LKGCCCAICYNP-FQEKKPFHCC--------YCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            C  W+ FQ  + + V DPF +LFI+ CI +NT+ MA +H+   K  + +LK  N  FT  + IE ++K+MA+S K YF  GWNIFDF++V  S+++LG+E V  LS+ R+FRL RVFKLA+SW T+ LL++I+  T+  +GNL+ ++ +++++FAV+G Q +   Y  H   F D ++PRWNF DF HS ++VFR++CGEWIE  +DC+      C+  F+ T+V+G   V+      LL N  +S     TAD D +K+     R+        RNI   + + RN         P        EL   E L D ++  G +   +L+        I +  + +   ++ N  P      K +K +NNA D+        G H N   K +  K +    E                            L G      ++    ++ P  CC          +  D ++P    W   R ++  + E++ FE  ++  IL SS+ L  ED++L   P L+  L  ++ IFT +F +EM++K ++LGFKVYFT+ W  LDF IV +SL++ +  ++G G  + AF+++RT+RALRPLRA+SR QGM++VVNAL+ AIPSIFNVLLVC++FWLIF+I GVQ F GK+FKC D N   +L+  ++PN++ C  +N+TW NS +NFD+  N +L L+Q+ATF+GW++IM DAIDS  ++ QP +E  +  Y YFV FI+ GSFF LNLFIGVIIDNFN  K K  G  +++F+T  Q+ YYN MKK+ ++KP K + RP+   Q   +++    +F+++I++ I LNM  M ++ Y  +  +  VLD +N +F  IF+ E ++KI  LR+HYF   WN
Sbjct:  780 CWVWLKFQEWVSLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFTATFAIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVLRSFRLLRVFKLAKSWPTLNLLISIMGRTVGALGNLTFVLCIIIFIFAVMGMQLFGKNYTDHKDRFPDGDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDCMYVGDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSAPTADNDTNKIAEAFNRIGRFKSWVKRNIADCFKLIRNKLTNQISDQPSEHGDNELELGHDEILADGLIKKGIKEQTQLE------VAIGDGMEFTIHGDMKNNKP------KKSKYLNNATDDDTASINSYGSHKNRPFKDESHKGSAETMEGEEKRDASKEDLGLDEELDEEGECEEGPLDGDIIIHAHDEDILDEYPADCCPDSYYKKFPILAGDDDSPFWQGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLINFVASLVGAGG-IQAFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKYFKCEDMNG-TKLSHEIIPNRNACESENYTWVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKK-AGGSLEMFMTEDQKKYYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEPWN 1639          

HSP 2 Score: 310.842 bits (795), Expect = 7.934e-85
Identity = 169/393 (43.00%), Postives = 254/393 (64.63%), Query Frame = 3
Query:  255 ELKFEVEDFSDNCQPDPELVAGSILLEDKLGEFPEELLGKPLNEIDQNLKDK-SFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPI--SEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMV----DWKNVMSENHSNEFVNAFYYNWTHNPNNWIRN--GINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
            E++++ ED  +  QPDP L  G  +     G FP EL   PL +ID    +  +FVV++   K K I+R+SA+K+  +  P++ IR++A+ I  + +F  FI+ TILVNC+ + +     +  +E +F  IYT E  +++ +RG I+  +TYLRD +N +D ++I L+Y+ + ++        N+++LRT RVLRALKT+ I+PGLKTI  A+I+S+K L +VIIL++F +S FAL  LQIY G L  KC+K       W N+  EN         Y+N   N +NW     GI++  CGN S AG C   + + +CL   GPNPN+GYT+FD+FGWA LS F+L+T D+WE+ Y LV+RA+G W++LF+I+++F GSFYL+NL+LA+V+MSY
Sbjct:   61 EIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELASTPLEDIDPYYSNVLTFVVVS---KGKDIFRFSASKAMWMLDPFNPIRRVAIYILVHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMARGFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLG------NLAALRTFRVLRALKTVAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQKCIKKFPLDGSWGNLTDENWD-------YHN--RNSSNWYSEDEGISFPLCGNISGAGQC---DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRAAGPWHMLFFIVIIFLGSFYLVNLILAIVAMSY 432          

HSP 3 Score: 241.891 bits (616), Expect = 9.829e-64
Identity = 136/322 (42.24%), Postives = 218/322 (67.70%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQPPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIG----DIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQ 5343
            + + ++  F++PTLLRVVR+ ++GRVLRL+K AKGIR LLFAL +SLPALFNI  LL L++FI++I GMS F ++K+  G++D+ NF+TF +S++LLF+++T+ GW+ +L+A+ I    C+      D  Y     G+CG+A  GI ++ +++ I +LI+INMYIA+ILEN++QA    + G+T+DD++M+Y +W+++DP  +QYI+Y  LS+F+  L+ PL I KPN   ++S D+PI  GD M+C+DIL AL K         IE++ E  +I  +         P+      +++T+ R++E+  A+ +Q AW+  KA+
Sbjct: 1655 LSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGINDVYNFKTFGQSMILLFQMSTSAGWDGVLDAI-INEEACDPPD--NDKGYP----GNCGSATVGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDMYYEIWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPICRGDLMYCVDILDALTKDFFARKGNPIEETGEIGEIAAR---------PDTEGYEPVSSTLWRQREEYCARLIQHAWRKHKAR 1960          

HSP 4 Score: 98.2117 bits (243), Expect = 7.662e-20
Identity = 64/206 (31.07%), Postives = 105/206 (50.97%), Query Frame = 3
Query: 1830 QNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEV--------DALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRIICGEWIEPSFDCI 2423
            Q  ++  VTD  FD+ I   I +N   M  + Y +  T++ +L Y N IF VI+  EC LKI AL   YF   WN+FD VVVI SI+ L + ++          L + R  ++ RV +L +  + +R LL  +  ++  + N+ +++ LV+++FA+ G   + +        D    +NF  F  SMIL+F++      +   D I
Sbjct: 1565 QAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEPWNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGIND---VYNFKTFGQSMILLFQMSTSAGWDGVLDAI 1767          

HSP 5 Score: 67.0106 bits (162), Expect = 1.825e-10
Identity = 48/159 (30.19%), Postives = 80/159 (50.31%), Query Frame = 3
Query: 1839 LYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSK-----EYFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLY---MFAVIGKQSY 2291
            +YI V  P F LFI   I +N I+M     P+       ++ + +IFT IY  E ++K+MA         Y    WN  DFVV+  + + +G++    L    A R FRV +  ++   +  L TI+ + I  + NL  +++L ++   +FA++G Q Y
Sbjct:  147 IYILV-HPLFSLFIITTILVNCILMIMPTTPT-------VESTEVIFTGIYTFESAVKVMARGFILCPFTYLRDAWNWLDFVVIALAYVTMGID----LGNLAALRTFRVLRALKTVAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIY 293          

HSP 6 Score: 56.9954 bits (136), Expect = 1.984e-7
Identity = 64/265 (24.15%), Postives = 116/265 (43.77%), Query Frame = 3
Query: 3183 DNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTX--XXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYA---------YFVIFILVGSFFI-LNLFIGVIIDNFNRLKNKYEGNYID 3941
            D + T    L  +N IF  +F  E +LKI +L +  YF   W +  +   I+SI  L L + I  +    T  R +R  +  R LR +   +G++ ++ AL  ++P++FN+ L+  +   IF+I G+ FF          + +E+                 +  N   NF       + L+Q++T  GW  ++   I+    +     +N   Y            F++  LV SF I +N++I VI++N+++     +    D
Sbjct: 1598 DASDTYNAVLDYLNAIFVVIFSSECLLKIFALRYH-YFIEPWNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFM---------HVKEK-----------------SGINDVYNFKTFGQSMILLFQMSTSAGWDGVLDAIINEEACD---PPDNDKGYPGNCGSATVGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEGLTD 1832          

HSP 7 Score: 54.299 bits (129), Expect = 1.339e-6
Identity = 74/324 (22.84%), Postives = 139/324 (42.90%), Query Frame = 3
Query:  495 WSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDY----PI-------SEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRA---LKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLV----------IRASGSWNILFYIIVVFFGSFYLINLMLAVV 1394
            W  +R     +  N+ F+  ++  IL++ + LAL + +    PI        + +F  I+ LEM+I+  + G  +    Y  + +  +D +I+++S I   V    G   +   + +T+R LRA   L+ ++ + G++ + +AL++++  +F V+++ L     FA+  +Q++ G    KC  M   K       S+E +          PN   RN               C   N   +              NFD+ G A L +FQ+ T   W    N            IR +  +  L+++  + FGSF+ +NL + V+
Sbjct: 1243 WGNLRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTVIFFLEMLIKWLALGFKV----YFTNAWCWLDFVIVMVSLINF-VASLVGAGGIQ--AFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKYF-KCEDMNGTK------LSHEII----------PN---RNA--------------CESENYTWVN----------SAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFIIFGSFFTLNLFIGVI 1515          

HSP 8 Score: 54.299 bits (129), Expect = 1.432e-6
Identity = 65/320 (20.31%), Postives = 144/320 (45.00%), Query Frame = 3
Query: 3078 RNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKV----YFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFF-KCL-----------------DSNTR---------ERLAATVVPNKSECLRQNHTW-------ANSN---INFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLK 3914
            R  ++ I  H  F   I+  IL + I +      +   PT++        IFT ++  E  +K+++ GF +    Y    W  LDF +++++ ++        G ++    +LRT R LR L+ ++   G+K +V A+I ++ ++ +V+++ +    +F++ G+Q + G    KC+                 D + R         E ++  +  N S   + +  +        N N    +FD+    FL+ +++ T + W ++ Q  + + G            +  +F++ I +GSF+++NL + ++  +++ L+
Sbjct:  143 RRVAIYILVHPLFSLFIITTILVNCILMI-----MPTTPTVEST----EVIFTGIYTFESAVKVMARGFILCPFTYLRDAWNWLDFVVIALAYVT-------MGIDLGNLAALRTFRVLRALKTVAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQKCIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQCDDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRAAG----------PWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQ 436          
BLAST of Sodium channel protein vs. Ensembl Zebrafish
Match: scn1laa (sodium channel, voltage-gated, type I-like, alpha [Source:ZFIN;Acc:ZDB-GENE-040426-751])

HSP 1 Score: 536.184 bits (1380), Expect = 1.394e-158
Identity = 362/949 (38.15%), Postives = 547/949 (57.64%), Query Frame = 3
Query: 1566 ITNGMSDADSSLCK-NTTSIHENDDNF--RFMDSEEEKEGKDCDNK--------AEYEDEVEIGNDTNNTDTAEMNPTIDRNCQCC---IKQNVL---CSK-WVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSK-EYFNVGWNIFDFVVVIASIIDLGVEEV-DALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHT---QIFGD-NIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIR-ANSPLCLLIFIPTXXXXXXXXXXXXXXXXXXXXXXXXXKNTADEDVSKLKIVIERLRNIYPMSRNNPLGINKGNQELDSTETLKDIVVNFGCENAAELQNNHEKMRIIKNC--KDLSTSNE-------LVNLLPSTGSLSKGNKLINNAIXXXXXXXXXXGKHLXXXXXXXXXXXXXXI-----DEESVNEL--------KGCCCAICYNPFQEKKPFHCCYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNH--TWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            +T+G S  +S +   NT  +      F     DS++E+  + C+++        +  E  + + + +NN   AE +    + C+       +N L   CS  W+  +  +++ V DPF DLFI+ CI INT+ MA E YP +  +  +L  +N++F  I+  E   K++AL    YF  GWNIFD ++V  S+++L +  V   +   R FRL RVFKLA+SW T+ +L+ II +++  + NL++++ +++++FAV+G Q +  +Y     +I  D  +PRW+ +DF+HS ++VFR++CGEWIE  +DC+  A  PLCL +F+  +V+GN VVLNLFLALLL+SF++D+L  + +ED + L+I + R+R  +   +       +        +   D  +   C+   +   NH  + ++K+    DL +  E       L   +P     S    L         +D ++  + L++   +  E    ++     D E   EL        + C  A C   F+      CC     D E     +W   R     I EH  FE  I+  IL SS  L FEDIYLD   ++K  L   + +FTY+F +EM+LK ++ GF  YFT+ W  LDF IV +SL+SL+ + L + +E++A +SLRT+RA RPLRA+SR+ GM++VVNAL+ AIPSI NVLLVC++FWLIFSI GV FF GKF +C++  T +RL  + V NK++C R      W N  INFDN  NG+LAL Q+ATF+GWM IM  A+DS     QP+ E  +  Y YFVIFI++G+FF LNLFIGVIIDNFN+ K K+ G   D+F+T  Q+ YYN MKKL ++KP+K + RPK  +QG  +D+     F++ I++LI+LNMV MM+E   Q+   T  L  IN++F  +FT E ++K+  LR ++F   WN
Sbjct:  619 VTSGASAPNSPVIALNTPEVSRKRAMFDDTCADSDDERRSR-CNSQNFSKAYRQSMRERALSVASGSNNP--AECSEIFKQRCEEWWFEFAENYLIWDCSPTWLRIKEVVHMIVMDPFADLFITICIVINTVFMAMECYPMDGPYSSMLSTANVVFIGIFTAEMIFKVIALDPYSYFLEGWNIFDSIIVTLSLMELCLANVLSGIGFLRPFRLLRVFKLAKSWPTLNMLIKIIGNSLGALSNLTLVLAIIVFIFAVVGMQLFGKSYGECVCKISSDCMLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQPLCLTVFMMVMVIGNLVVLNLFLALLLSSFSADNLAVSGEEDENNLQIAVRRIRKGFTFIKTCLQSFFRSGCLRKKKQKSADGNMIVNCKERKD-STNHTTIELVKSTGGTDLDSDTENFISNPSLTVSVPIAAEESDFECLNTEDFSSLSSDLEEDKEKLSDVASSFSEGSTVDLRPLGKDGEDALELVLEEEAYPEPCFTAGCVRRFR------CCQ---VDEEKGIWKKWWLLRQTCYNIVEHSWFETFIVFMILLSSGALAFEDIYLDTRKSVKTILEFADKVFTYIFILEMLLKWVAYGFAKYFTNLWCWLDFVIVDVSLISLVANALNY-SELSAIKSLRTLRAFRPLRALSRFDGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIVGVNFFAGKFSECINITTEQRLPVSEVYNKTDCERMGKGVRWRNVIINFDNVGNGYLALLQVATFKGWMPIMYAAVDSRNPEEQPEYEVNLYMYLYFVIFIILGAFFTLNLFIGVIIDNFNQQKKKFGGQ--DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPKNKIQGLIFDLVTKQAFDIFIMVLIWLNMVTMMLETEDQSIEMTRALYWINVIFIVLFTTECVLKMIALRHYFFTVGWN 1551          

HSP 2 Score: 291.582 bits (745), Expect = 7.311e-79
Identity = 164/330 (49.70%), Postives = 225/330 (68.18%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMF-IQPPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAW-KHV-----KAQRAFKQ 5358
            + E +K  F++PTL RV+R+ RIGRVLRLI+ AKGIR LLFAL++SLPALFNIG LL L++FIY+I GMS F  +KKT G+DD+ NFETF  S+L LF++TT+GGW+ +L  M   +PP C+ T             GDCG    GI +  ++I IC+LI++NMYIA+ILENF+ A  +    ++EDDF+ FY VWE++DP A+Q+++Y  LSDF   LD PL IPKPN   L+S DLP+V GD++HCLDIL A  K V+G   +  E   +  QME ++ +  P++     ITTT++RK ED++A  +QRA+ KH+     K  R FK+
Sbjct: 1567 LTEVIKKYFVSPTLFRVIRLARIGRVLRLIRSAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKKTAGIDDMFNFETFPNSMLCLFQITTSGGWDGLLAPMLNSKPPDCDPTKNFTGSSVV----GDCGNPSIGIFFFVSYIIICFLIVVNMYIAVILENFSVATEESAEPLSEDDFDRFYEVWEKFDPKATQFMEYGKLSDFADSLDPPLRIPKPNRFQLMSMDLPMVTGDRIHCLDILFAFTKRVLG---EGGEMDMLHGQMEDRFMQSNPSKSSYEPITTTLRRKHEDMSAAVIQRAFRKHLVRDSMKKVRNFKK 1889          

HSP 3 Score: 276.174 bits (705), Expect = 4.145e-74
Identity = 154/377 (40.85%), Postives = 245/377 (64.99%), Query Frame = 3
Query:  294 QPDPELVAGSILLEDKLGEFPEELLGKPLNEIDQNLKDKS-FVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNN--DYPIS-EYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNN--WIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
            +P+  L AG  L     GE P+ L+  PL ++DQ   + + F+V++   K K IYR++AT +  + + ++ +R++++ I  + +F++ I+ TIL NC F+      D+  S EYVF  IYTLE ++++T+RG  +  +T+LRDP+N +D ++I+++Y+   V+        +VS+LR  RVLRALKTI+++PGLKTI  ALI+S+K L +V+IL+LFC+S FAL  LQ++ G L+ KCV    +    +EN    + N    ++ +NP+N  ++    + L CGN S AG C    P        G NP++GYT+FD+FGWA LS+F+L+T D+WEN Y   +RA+G   ++F+++V+F GSFYL+NL+LAVV+M+Y
Sbjct:   51 KPNSGLEAGKTL-PFIYGEVPKGLVSTPLEDLDQFYSNHTTFIVVS---KKKEIYRFNATPALYIFSSFNLLRRISIQILVHFLFNFIIICTILANCAFMVYTQTPDWAKSVEYVFTGIYTLEALVKITARGFCVGRFTFLRDPWNWLDFIVIVMAYVTEFVDLG------SVSALRAFRVLRALKTISVVPGLKTIVGALIQSVKKLSDVMILTLFCLSVFALVGLQLFMGILKQKCV----YSTSFTENKEACYKNKTCRDYINNPSNQYFLPGKKDALICGNSSDAGQC----PEGYTCLKAGNNPDYGYTSFDSFGWAFLSLFRLMTQDFWENLYQQTLRAAGKTYMIFFVLVIFLGSFYLVNLILAVVAMAY 409          

HSP 4 Score: 103.219 bits (256), Expect = 2.475e-21
Identity = 64/199 (32.16%), Postives = 110/199 (55.28%), Query Frame = 3
Query: 1830 QNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEV-----DALSIFRAFRLF---RVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRI-ICGEW 2399
            Q  ++  VT   FD+FI   I++N + M  E           L + N+IF V++  EC LK++AL   +F VGWN+FDF+VVI SI+ + + EV      + ++FR  RL    RV +L +S + +R LL  +  ++  + N+ +++ LV++++A+ G  ++     T    D    +NF+ F +SM+ +F+I   G W
Sbjct: 1477 QGLIFDLVTKQAFDIFIMVLIWLNMVTMMLETEDQSIEMTRALYWINVIFIVLFTTECVLKMIALRHYFFTVGWNVFDFIVVILSIVGMSLTEVIKKYFVSPTLFRVIRLARIGRVLRLIRSAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKKTAGIDD---MFNFETFPNSMLCLFQITTSGGW 1672          

HSP 5 Score: 67.3958 bits (163), Expect = 1.801e-10
Identity = 73/318 (22.96%), Postives = 138/318 (43.40%), Query Frame = 3
Query: 3060 SRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSF----WTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFF-KCLDSN--TRERLA----------------------------------ATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVI 3890
            S ++  R  S+ I  H  F   I+  ILA+   + +        P   ++   + Y+FT ++ +E ++KI + GF V   +F    W  LDF ++ ++ ++          ++ +  +LR  R LR L+ IS   G+K +V ALI ++  + +V+++ +    +F++ G+Q F G    KC+ S   T  + A                                  A   P    CL+  +       +FD+    FL+L+++ T + W  + Q  + + G            Y  +FV+ I +GSF+++NL + V+
Sbjct:  113 SSFNLLRRISIQILVHFLFNFIIICTILANCAFMVYT-----QTPDWAKS---VEYVFTGIYTLEALVKITARGFCVGRFTFLRDPWNWLDFIVIVMAYVTEF-------VDLGSVSALRAFRVLRALKTISVVPGLKTIVGALIQSVKKLSDVMILTLFCLSVFALVGLQLFMGILKQKCVYSTSFTENKEACYKNKTCRDYINNPSNQYFLPGKKDALICGNSSDAGQCPEGYTCLKAGNNPDYGYTSFDSFGWAFLSLFRLMTQDFWENLYQQTLRAAG----------KTYMIFFVLVIFLGSFYLVNLILAVV 405          
BLAST of Sodium channel protein vs. Ensembl Zebrafish
Match: scn1laa (sodium channel, voltage-gated, type I-like, alpha [Source:ZFIN;Acc:ZDB-GENE-040426-751])

HSP 1 Score: 536.184 bits (1380), Expect = 1.394e-158
Identity = 362/949 (38.15%), Postives = 547/949 (57.64%), Query Frame = 3
Query: 1566 ITNGMSDADSSLCK-NTTSIHENDDNF--RFMDSEEEKEGKDCDNK--------AEYEDEVEIGNDTNNTDTAEMNPTIDRNCQCC---IKQNVL---CSK-WVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSK-EYFNVGWNIFDFVVVIASIIDLGVEEV-DALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHT---QIFGD-NIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIR-ANSPLCLLIFIPTXXXXXXXXXXXXXXXXXXXXXXXXXKNTADEDVSKLKIVIERLRNIYPMSRNNPLGINKGNQELDSTETLKDIVVNFGCENAAELQNNHEKMRIIKNC--KDLSTSNE-------LVNLLPSTGSLSKGNKLINNAIXXXXXXXXXXGKHLXXXXXXXXXXXXXXI-----DEESVNEL--------KGCCCAICYNPFQEKKPFHCCYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNH--TWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            +T+G S  +S +   NT  +      F     DS++E+  + C+++        +  E  + + + +NN   AE +    + C+       +N L   CS  W+  +  +++ V DPF DLFI+ CI INT+ MA E YP +  +  +L  +N++F  I+  E   K++AL    YF  GWNIFD ++V  S+++L +  V   +   R FRL RVFKLA+SW T+ +L+ II +++  + NL++++ +++++FAV+G Q +  +Y     +I  D  +PRW+ +DF+HS ++VFR++CGEWIE  +DC+  A  PLCL +F+  +V+GN VVLNLFLALLL+SF++D+L  + +ED + L+I + R+R  +   +       +        +   D  +   C+   +   NH  + ++K+    DL +  E       L   +P     S    L         +D ++  + L++   +  E    ++     D E   EL        + C  A C   F+      CC     D E     +W   R     I EH  FE  I+  IL SS  L FEDIYLD   ++K  L   + +FTY+F +EM+LK ++ GF  YFT+ W  LDF IV +SL+SL+ + L + +E++A +SLRT+RA RPLRA+SR+ GM++VVNAL+ AIPSI NVLLVC++FWLIFSI GV FF GKF +C++  T +RL  + V NK++C R      W N  INFDN  NG+LAL Q+ATF+GWM IM  A+DS     QP+ E  +  Y YFVIFI++G+FF LNLFIGVIIDNFN+ K K+ G   D+F+T  Q+ YYN MKKL ++KP+K + RPK  +QG  +D+     F++ I++LI+LNMV MM+E   Q+   T  L  IN++F  +FT E ++K+  LR ++F   WN
Sbjct:  619 VTSGASAPNSPVIALNTPEVSRKRAMFDDTCADSDDERRSR-CNSQNFSKAYRQSMRERALSVASGSNNP--AECSEIFKQRCEEWWFEFAENYLIWDCSPTWLRIKEVVHMIVMDPFADLFITICIVINTVFMAMECYPMDGPYSSMLSTANVVFIGIFTAEMIFKVIALDPYSYFLEGWNIFDSIIVTLSLMELCLANVLSGIGFLRPFRLLRVFKLAKSWPTLNMLIKIIGNSLGALSNLTLVLAIIVFIFAVVGMQLFGKSYGECVCKISSDCMLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQPLCLTVFMMVMVIGNLVVLNLFLALLLSSFSADNLAVSGEEDENNLQIAVRRIRKGFTFIKTCLQSFFRSGCLRKKKQKSADGNMIVNCKERKD-STNHTTIELVKSTGGTDLDSDTENFISNPSLTVSVPIAAEESDFECLNTEDFSSLSSDLEEDKEKLSDVASSFSEGSTVDLRPLGKDGEDALELVLEEEAYPEPCFTAGCVRRFR------CCQ---VDEEKGIWKKWWLLRQTCYNIVEHSWFETFIVFMILLSSGALAFEDIYLDTRKSVKTILEFADKVFTYIFILEMLLKWVAYGFAKYFTNLWCWLDFVIVDVSLISLVANALNY-SELSAIKSLRTLRAFRPLRALSRFDGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIVGVNFFAGKFSECINITTEQRLPVSEVYNKTDCERMGKGVRWRNVIINFDNVGNGYLALLQVATFKGWMPIMYAAVDSRNPEEQPEYEVNLYMYLYFVIFIILGAFFTLNLFIGVIIDNFNQQKKKFGGQ--DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPKNKIQGLIFDLVTKQAFDIFIMVLIWLNMVTMMLETEDQSIEMTRALYWINVIFIVLFTTECVLKMIALRHYFFTVGWN 1551          

HSP 2 Score: 291.582 bits (745), Expect = 7.311e-79
Identity = 164/330 (49.70%), Postives = 225/330 (68.18%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMF-IQPPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAW-KHV-----KAQRAFKQ 5358
            + E +K  F++PTL RV+R+ RIGRVLRLI+ AKGIR LLFAL++SLPALFNIG LL L++FIY+I GMS F  +KKT G+DD+ NFETF  S+L LF++TT+GGW+ +L  M   +PP C+ T             GDCG    GI +  ++I IC+LI++NMYIA+ILENF+ A  +    ++EDDF+ FY VWE++DP A+Q+++Y  LSDF   LD PL IPKPN   L+S DLP+V GD++HCLDIL A  K V+G   +  E   +  QME ++ +  P++     ITTT++RK ED++A  +QRA+ KH+     K  R FK+
Sbjct: 1567 LTEVIKKYFVSPTLFRVIRLARIGRVLRLIRSAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKKTAGIDDMFNFETFPNSMLCLFQITTSGGWDGLLAPMLNSKPPDCDPTKNFTGSSVV----GDCGNPSIGIFFFVSYIIICFLIVVNMYIAVILENFSVATEESAEPLSEDDFDRFYEVWEKFDPKATQFMEYGKLSDFADSLDPPLRIPKPNRFQLMSMDLPMVTGDRIHCLDILFAFTKRVLG---EGGEMDMLHGQMEDRFMQSNPSKSSYEPITTTLRRKHEDMSAAVIQRAFRKHLVRDSMKKVRNFKK 1889          

HSP 3 Score: 276.174 bits (705), Expect = 4.145e-74
Identity = 154/377 (40.85%), Postives = 245/377 (64.99%), Query Frame = 3
Query:  294 QPDPELVAGSILLEDKLGEFPEELLGKPLNEIDQNLKDKS-FVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNN--DYPIS-EYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNN--WIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
            +P+  L AG  L     GE P+ L+  PL ++DQ   + + F+V++   K K IYR++AT +  + + ++ +R++++ I  + +F++ I+ TIL NC F+      D+  S EYVF  IYTLE ++++T+RG  +  +T+LRDP+N +D ++I+++Y+   V+        +VS+LR  RVLRALKTI+++PGLKTI  ALI+S+K L +V+IL+LFC+S FAL  LQ++ G L+ KCV    +    +EN    + N    ++ +NP+N  ++    + L CGN S AG C    P        G NP++GYT+FD+FGWA LS+F+L+T D+WEN Y   +RA+G   ++F+++V+F GSFYL+NL+LAVV+M+Y
Sbjct:   51 KPNSGLEAGKTL-PFIYGEVPKGLVSTPLEDLDQFYSNHTTFIVVS---KKKEIYRFNATPALYIFSSFNLLRRISIQILVHFLFNFIIICTILANCAFMVYTQTPDWAKSVEYVFTGIYTLEALVKITARGFCVGRFTFLRDPWNWLDFIVIVMAYVTEFVDLG------SVSALRAFRVLRALKTISVVPGLKTIVGALIQSVKKLSDVMILTLFCLSVFALVGLQLFMGILKQKCV----YSTSFTENKEACYKNKTCRDYINNPSNQYFLPGKKDALICGNSSDAGQC----PEGYTCLKAGNNPDYGYTSFDSFGWAFLSLFRLMTQDFWENLYQQTLRAAGKTYMIFFVLVIFLGSFYLVNLILAVVAMAY 409          

HSP 4 Score: 103.219 bits (256), Expect = 2.475e-21
Identity = 64/199 (32.16%), Postives = 110/199 (55.28%), Query Frame = 3
Query: 1830 QNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEV-----DALSIFRAFRLF---RVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRI-ICGEW 2399
            Q  ++  VT   FD+FI   I++N + M  E           L + N+IF V++  EC LK++AL   +F VGWN+FDF+VVI SI+ + + EV      + ++FR  RL    RV +L +S + +R LL  +  ++  + N+ +++ LV++++A+ G  ++     T    D    +NF+ F +SM+ +F+I   G W
Sbjct: 1477 QGLIFDLVTKQAFDIFIMVLIWLNMVTMMLETEDQSIEMTRALYWINVIFIVLFTTECVLKMIALRHYFFTVGWNVFDFIVVILSIVGMSLTEVIKKYFVSPTLFRVIRLARIGRVLRLIRSAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKKTAGIDD---MFNFETFPNSMLCLFQITTSGGW 1672          

HSP 5 Score: 67.3958 bits (163), Expect = 1.801e-10
Identity = 73/318 (22.96%), Postives = 138/318 (43.40%), Query Frame = 3
Query: 3060 SRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSF----WTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFF-KCLDSN--TRERLA----------------------------------ATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVI 3890
            S ++  R  S+ I  H  F   I+  ILA+   + +        P   ++   + Y+FT ++ +E ++KI + GF V   +F    W  LDF ++ ++ ++          ++ +  +LR  R LR L+ IS   G+K +V ALI ++  + +V+++ +    +F++ G+Q F G    KC+ S   T  + A                                  A   P    CL+  +       +FD+    FL+L+++ T + W  + Q  + + G            Y  +FV+ I +GSF+++NL + V+
Sbjct:  113 SSFNLLRRISIQILVHFLFNFIIICTILANCAFMVYT-----QTPDWAKS---VEYVFTGIYTLEALVKITARGFCVGRFTFLRDPWNWLDFIVIVMAYVTEF-------VDLGSVSALRAFRVLRALKTISVVPGLKTIVGALIQSVKKLSDVMILTLFCLSVFALVGLQLFMGILKQKCVYSTSFTENKEACYKNKTCRDYINNPSNQYFLPGKKDALICGNSSDAGQCPEGYTCLKAGNNPDYGYTSFDSFGWAFLSLFRLMTQDFWENLYQQTLRAAG----------KTYMIFFVLVIFLGSFYLVNLILAVV 405          
BLAST of Sodium channel protein vs. Ensembl Zebrafish
Match: scn4aa (sodium channel, voltage-gated, type IV, alpha, a [Source:NCBI gene;Acc:572442])

HSP 1 Score: 462.225 bits (1188), Expect = 9.204e-134
Identity = 276/762 (36.22%), Postives = 443/762 (58.14%), Query Frame = 3
Query:  297 PDPELVAGSILLEDKLGEFPEELLGKPLNEIDQNLK-DKSFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPIS---EYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWT---------HNPNN--WIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHDKDQMKDLKITNGMSD-ADSSLCKNTTS------IHENDDNFRFMDSEEEKEGKDCDNKAEYEDEVEIGNDTNNT---DTAEMNPTIDRNCQCC----------IKQNVLCSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSK-EYFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHT---QIFGD-NIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIR-ANSPLCLLIFI 2459
            P  +L AG  L     G+ P +LL  PL +ID   K  K+F+VI+   K   I+R+S+  +    +P+S +R+ A+ I  + +F  FIM+TIL NCVF+ ++N    S   EYVF  IYT E  +++ SRG  I  +T+LRDP+N +D ++I ++Y+   V+        NVS+LRT RVLRALKTIT++PGLKTI  ALI+S+K + +V+IL++F ++ FAL  LQ++ G LR KC++     + + + +++  VN    N T          N  N  ++   ++ L CGN S AG C    P        G NPN+GYT++DNFGWA L++F+L+T D+WEN + L +RA+G   ++F+++V+F GSFYLINL+LAVV+M+Y        +        + K  + ++ L +  +  T         K Q +    T  + D AD  + K+         I     + + + +EE+++     +  +Y D+ ++   T +     TA M    D    C           +K +  C+ W+ F+  ++  V DPF DL I+ CI +NT+ MA EHYP    ++ +L   N++FT I+  E   K++A+    YF VGWNIFD ++V  S+++LG+  V  LS+ R+FRL RVFKLA+SW T+ +L+ II +++  +GNL++++ +++++FAV+G Q +  +Y     +I  D  +PRW+ +DF+HS ++VFRI+CGEWIE  +DC+  A + +CL++F+
Sbjct:   47 PSSDLEAGKCL-PMIYGDPPGDLLNTPLEDIDPFYKTQKTFIVIS---KGNTIFRFSSEPAMFCISPFSIVRRGAIKILIHSLFSMFIMITILSNCVFMTMSNPPAWSKTVEYVFTGIYTFEATVKVLSRGFCIGPFTFLRDPWNWLDFMVISMAYVTEFVDLG------NVSALRTFRVLRALKTITVIPGLKTIVGALIQSVKKMIDVMILTIFALAVFALIGLQLFMGNLRQKCIRWPILNSTIFDVYNSNMVNDTTLNVTDTFDFKAYISNEENQYFLEGSLDALLCGNSSDAGRC----PEGYTCMKAGRNPNYGYTSYDNFGWAFLALFRLMTQDFWENLFQLTLRAAGKTYMIFFVVVIFLGSFYLINLILAVVAMAY------DEQNEATLAEARDKEEEFQRLLEQLKNQETGSKASLASQKTQSRGSNRTGSLHDLADEDVIKDCNGRIVPRLIVNRVSSNKELSAEEDQKSLSSKHSMQYLDQPKLSKRTASALSVLTATMEGLEDAQRPCPPGWYKFADMFLKWDC-CAPWILFKKWVHFVVMDPFVDLGITICIVLNTLFMAMEHYPMSPHFEHVLSVGNLVFTGIFTAEMVFKLIAMDPYYYFQVGWNIFDSIIVTLSLVELGLANVQGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKDCVCKISEDCELPRWHMNDFFHSFLIVFRILCGEWIETMWDCMEVAGASMCLIVFM 787          

HSP 2 Score: 380.178 bits (975), Expect = 1.123e-106
Identity = 205/419 (48.93%), Postives = 280/419 (66.83%), Query Frame = 3
Query: 3021 CYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHT----WANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            C C+  DI    G +W   R     I EH  FE  I+  IL SS  L FEDI ++    +K  L   + +FTY+F +EM+LK ++ GFK YFT+ W  LDF IV +SL+SL  +++G+ +E+ A +SLRT+RALRPLRA+SR++GM++VVNAL+ AIPSIFNVLLVC++FWLIFSI GV  F GKF+ C+++ T ER+   VV NKS+C+   +T    W N  +N+DN   G+L+L QIATF+GWM+IM  A+DS  ++ QP  E  +  Y YFVIFI+ GSFF LNLFIGVIIDNFN+ K+K+ G   D+F+T  Q+ YYN MKKL  +K  K + RP  ++QG  +D      F++ I++LI LNMV MMIE   Q+A    VL  IN++F  +FT E ++K+  LR ++F   WN
Sbjct:  968 CACLSVDITEGWGKKWWNLRRTCFTIVEHDYFETFIIFMILLSSGALAFEDINIERRRVIKTILEYADKVFTYIFIVEMLLKWVAYGFKTYFTNAWCWLDFLIVDVSLVSLTANLMGY-SELGAIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIFNVLLVCLIFWLIFSIMGVNLFAGKFYHCINTTTEERIPMDVVNNKSDCMALMYTNEVRWVNVKVNYDNVGLGYLSLLQIATFKGWMDIMYAAVDSREVDEQPSYEINLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKSKFGGK--DIFMTEEQKKYYNAMKKLGAKKRPKPIPRPSNIIQGLVFDFISKQFFDIFIMVLICLNMVTMMIETDDQSAEKEYVLYQINLVFIVVFTSECVLKLFALRQYFFTIGWN 1383          

HSP 3 Score: 256.529 bits (654), Expect = 4.195e-68
Identity = 154/331 (46.53%), Postives = 216/331 (65.26%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQ-PPYCN------NTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVG--ITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFK 5355
            + + ++  F++PTL RV+R+ RIGRVLRLI+ AKGIR LLFAL++SLPALFNIG LL LI+FI+SI GMS F  +KK  G+DD+ NFETF  SI+ LF +TT+ GW+ +L  +    PP C+       T V           G+CG    GI++  ++I + +L+++NMYIAIILENFN  +AQEE G  + EDDF+MF   WE++D  A+Q+I+Y  L DFV  L EPL I KPN + L+S D+PIV GDK+H  DIL+A+ + V+G   D+ E   +K  +E K+    P       I TT++RK+E+ AA  +QR ++    +RA +
Sbjct: 1399 LSDIIEKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLIMFIFSIFGMSNFAYVKKQAGIDDIFNFETFGGSIICLFEITTSAGWDGLLLPILNSGPPDCDPDFENPGTDV----------RGNCGNPGMGIMFFCSYIIMSFLVVVNMYIAIILENFN--NAQEESGDPLCEDDFDMFDETWEKFDVDATQFIEYDRLFDFVDALQEPLRIAKPNRLKLISMDIPIVNGDKIHSQDILLAVTREVLG---DTIEMDAMKESIEAKFIMNNPTSASFEPIITTLRRKEEERAAIAVQRIYRRHLLKRAIR 1714          

HSP 4 Score: 95.1301 bits (235), Expect = 7.728e-19
Identity = 60/194 (30.93%), Postives = 110/194 (56.70%), Query Frame = 3
Query: 1830 QNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEV-----DALSIFRAFRLF---RVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFG-DNIPRWNFDDFWHSMILVFRI 2384
            Q  ++ F++  FFD+FI   I +N + M  E        + +L   N++F V++  EC LK+ AL + +F +GWN+FDFVVVI SI  L + ++      + ++FR  RL    RV +L +  + +R LL  +  ++  + N+ +++ L++++F++ G  ++   Y  +  G D+I  +NF+ F  S+I +F I
Sbjct: 1309 QGLVFDFISKQFFDIFIMVLICLNMVTMMIETDDQSAEKEYVLYQINLVFIVVFTSECVLKLFALRQYFFTIGWNVFDFVVVILSIAGLMLSDIIEKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLIMFIFSIFGMSNF--AYVKKQAGIDDI--FNFETFGGSIICLFEI 1498          

HSP 5 Score: 67.3958 bits (163), Expect = 2.107e-10
Identity = 44/172 (25.58%), Postives = 85/172 (49.42%), Query Frame = 3
Query: 1815 KWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEK--TWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIIDL-----GVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYH 2306
            KW   +   +  V   +F+ FI F I +++  +A E    E+      IL+Y++ +FT I+I+E  LK +A   K YF   W   DF++V  S++ L     G  E+ A+   R  R  R  +    ++ MR+++  +   I  + N+ ++ L+   +F+++G   +   ++
Sbjct:  982 KWWNLRRTCFTIVEHDYFETFIIFMILLSSGALAFEDINIERRRVIKTILEYADKVFTYIFIVEMLLKWVAYGFKTYFTNAWCWLDFLIVDVSLVSLTANLMGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIFNVLLVCLIFWLIFSIMGVNLFAGKFY 1153          

HSP 6 Score: 58.9214 bits (141), Expect = 7.965e-8
Identity = 70/323 (21.67%), Postives = 135/323 (41.80%), Query Frame = 3
Query:  495 WSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNND--------YPISEY---VFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSE--NHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWEN-QYNLV----IRASGSWNI-----LFYIIVVFFGSFYLINLMLAVV 1394
            W  +R+    I  +  F+ FI+  IL++   LA  +           I EY   VF  I+ +EM+++  + G      TY  + +  +D LI+ +S + +            + SLRTLR LR L+ ++   G++ + +AL+ ++  +F V+++ L     F++  + ++ G   + C+     + +  +  N+ ++ +   Y N       W+   +NY                                    DN G   LS+ Q+ T   W +  Y  V    +    S+ I     L+++I + FGSF+ +NL + V+
Sbjct:  983 WWNLRRTCFTIVEHDYFETFIIFMILLSSGALAFEDINIERRRVIKTILEYADKVFTYIFIVEMLLKWVAYGF----KTYFTNAWCWLDFLIVDVSLVSLTANLMGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIFNVLLVCLIFWLIFSIMGVNLFAGKFYH-CINTTTEERIPMDVVNNKSDCMALMYTNEVR----WVNVKVNY------------------------------------DNVGLGYLSLLQIATFKGWMDIMYAAVDSREVDEQPSYEINLYMYLYFVIFIIFGSFFTLNLFIGVI 1260          

HSP 7 Score: 57.3806 bits (137), Expect = 2.169e-7
Identity = 60/259 (23.17%), Postives = 113/259 (43.63%), Query Frame = 3
Query: 3183 DNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXX--XXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMA-----------YYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNK 3920
            D +   +  L  IN +F  +F  E +LK+ +L  + +FT  W +      I+SI+ L L + I  +    T FR +R  R  R LR I   +G++ ++ AL+ ++P++FN+ L+  +   IFSI G+  F                             +     +   NF+      + L++I T  GW  ++   ++S   +  P  EN                 +F  +I++    ++N++I +I++NFN  + +
Sbjct: 1342 DQSAEKEYVLYQINLVFIVVFTSECVLKLFALR-QYFFTIGWNVFDFVVVILSIAGLMLSDIIEKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLIMFIFSIFGMSNF--------------------------AYVKKQAGIDDIFNFETFGGSIICLFEITTSAGWDGLLLPILNSGPPDCDPDFENPGTDVRGNCGNPGMGIMFFCSYIIMSFLVVVNMYIAIILENFNNAQEE 1573          

HSP 8 Score: 53.9138 bits (128), Expect = 2.270e-6
Identity = 55/246 (22.36%), Postives = 109/246 (44.31%), Query Frame = 3
Query: 3054 CGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINL 3791
            C + W  F+     +      +  I +CI+ +++ +  E  +   +P  +  L V N +FT +F  EM+ K+I++    YF   W I D  IV++SL+ L          +     LR+ R LR  +    W  + +++  +  ++ ++ N+ LV  +   IF++ G+Q F   +  C            V     +C  +   W     + ++  + FL +++I   E W+E M D ++  G ++
Sbjct:  564 CCAPWILFKKWVHFVVMDPFVDLGITICIVLNTLFMAME--HYPMSPHFEHVLSVGNLVFTGIFTAEMVFKLIAMDPYYYFQVGWNIFDSIIVTLSLVELGL------ANVQGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKDC------------VCKISEDC--ELPRW-----HMNDFFHSFLIVFRILCGE-WIETMWDCMEVAGASM 781          
BLAST of Sodium channel protein vs. Ensembl Zebrafish
Match: scn4ab (sodium channel, voltage-gated, type IV, alpha, b [Source:NCBI gene;Acc:564977])

HSP 1 Score: 459.529 bits (1181), Expect = 7.823e-133
Identity = 287/772 (37.18%), Postives = 458/772 (59.33%), Query Frame = 3
Query:  231 DEGKLVDGELKFEVEDFSDNCQPDPELVAGSILLEDKLGEFPEELLGKPLNEIDQNLK-DKSFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYP----ISEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCV--KMVDW--------KNVMSENHSNEFVNAF-YYNWTHNPNNW--IRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-----XXXXXXXHDKDQMKDLKITNGMSDADSSLCKNTTSIHENDDNFRFMDSEEEKEGKDCDNKAEYEDEVEIGNDTNNTDTAEMNPTIDRNCQCCIKQNVLCSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSK-EYFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHT---QIFGD-NIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIR-ANSPLCLLIFI 2459
            ++ ++ +  +K   ED     +P  +L AG +L     G+ P  LL  P+ E+D   K  K+F+VI+   K   IYR++   +    +P++ +R+ A+ I  + +F   IMLTIL NCVF+A++ D P    I EYVF  IYT E ++++ SRG  I  +T+LRDP+N +D ++I ++Y+   V+        N+S+LRT RVLRALKTIT++PGLKTI  ALI+S+K L +V+IL++FC+S FAL  LQ++ G LR KCV    V W         N    N +    + F Y  + ++  N+  +   ++ L CGN S AG C +     ICL   G NPN+GYT++DNFGWA L++F+L+T D+WEN + L +RA+G   ++F+++++F GSFYLINL+LAVV+M+Y E+ EA + E +E++    K  ++ KK  ++ +         +S K   D DQM+        SD D    K  +  + +  N  +++  + +       K      VE   D          P   +     +K +  C  WV F+  +Y+FV DPF DL I+ CI +NT+ MA EHYP     +++L   N++FT I+  E  LK++AL    YF VGWNIFD ++V  S+++L + +V+ LS+ R+FRL RVFKLA+SW T+ +L+ II +++  +GNL++++ +++++FAV+G Q +  +Y     +I  D  +PRW+  DF+H+ +++FR++CGEWIE  +DC+  A   +C+++F+
Sbjct:   86 EQERMKEQNVKVAEEDLP---KPTSDLEAGKVL-PFIYGDPPPNLLNVPIEELDPYYKAQKTFIVID---KKNTIYRFNTEPACYCLSPFNPVRRAAIRILIHSLFSLVIMLTILTNCVFMAMS-DPPGWSKILEYVFTGIYTFEAMVKVLSRGFCIGDFTFLRDPWNWLDFMVISMAYLTEFVDLG------NISALRTFRVLRALKTITVIPGLKTIVGALIQSVKKLADVMILTVFCLSVFALIGLQLFMGNLRQKCVLWPPVGWYSDNLTVLSNYTDINGNGTANSTFDYQKYINSEENYYYVPGQMDPLVCGNSSDAGLCPE---GYICL-KAGRNPNYGYTSYDNFGWAFLALFRLMTQDFWENLFQLTLRAAGKTYMIFFVVIIFLGSFYLINLILAVVAMAYAEQNEATAAEAKEKEEEYAKIMEQLKKQAEQKNGMVNGSKTSLSSKKKGDNDQMQ--------SDYDGIALKPLSKSNGSKGNINYLEVPDSQ-----IRKPSVVSAVESALDAQEDIERPCPPGWYKFADIFLKWDC-CIPWVKFKRIVYLFVMDPFVDLGITLCIVLNTVFMAMEHYPMSVHVEEVLAIGNLVFTGIFAAEMVLKLIALDPYYYFQVGWNIFDSIIVTMSLVELMLADVEGLSVLRSFRLMRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYTDSVCKISSDCELPRWHMADFFHAFLIIFRVLCGEWIETMWDCMEVAGQGMCIIVFM 825          

HSP 2 Score: 386.341 bits (991), Expect = 1.045e-108
Identity = 211/420 (50.24%), Postives = 276/420 (65.71%), Query Frame = 3
Query: 3021 CYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSEC--LRQNHT---WANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            C C+  D+    G  W  FR     I EH  FE  I+  IL SS  L FEDIY++    +K  L   + +FTY+F +EM+LK ++ GFKVYFT+ W  LDF IV +SL+SL  +ILG+ +E+ A +SLRT+RALRPLRA+SR++GM++VVNAL+ AIPSIFNVLLVC++FWLIFSI GV  F GKF+ C +  + E     VV NK++C  L + H    W N  INFDN   G+LAL Q+ATF+GWM+IM  A+DS  I  QP  E  +  Y YFVIFI+ GSFF LNLFIGVIIDNFN+ K K  G   D+F+T  Q+ YYN MKKL ++KP+K + RP    QG  +D      F++ I+++I LNMV MM+E   Q+A    +L  IN  F  +FT E ++KI+ LR+HYF   WN
Sbjct:  995 CPCLDLDVSQGKGKAWWNFRKTCFAIVEHSYFETFIIFMILLSSGALAFEDIYIEQRRMIKIILEYADQVFTYVFVVEMLLKWVAYGFKVYFTNAWCWLDFLIVDVSLISLTANILGY-SELGAIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIFNVLLVCLIFWLIFSIMGVNLFAGKFYYCFNETSEEVFDHNVVNNKTDCYELMEFHPEVRWMNGKINFDNVGMGYLALLQVATFKGWMDIMYSAVDSRAIESQPVYEANLYMYIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKAKLGGT--DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPTNCCQGLVFDFVTQQFFDIFIMVMICLNMVTMMVETDDQSAEIEEILFYINFAFIILFTGECVLKITALRYHYFSIGWN 1411          

HSP 3 Score: 290.812 bits (743), Expect = 1.084e-78
Identity = 157/325 (48.31%), Postives = 226/325 (69.54%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQPPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFKQMT 5364
            + + ++  F++PTL RV+R+ RIGRVLRLI+ AKGIR LLFAL++SLPALFNIG LL LI+FI+SI GMS F  +KK  G+DD++NFETF  SI+ +F +TT+ GW+ +L  +   PP C +  V   G   + + G+CG A  GI++  ++I + +L+++NMYIAIILENFN A  +    + EDDFEMFY  WE++DP ASQ+I Y  LS+F   L +PL IPKPN + L++ D+P+V GDK+HCLD+L+AL   V+G    S++   +K  ME K+    P++     IT+T+KRK+E++AA T+QRA++    +R  KQ +
Sbjct: 1427 LADLIEKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLIMFIFSIFGMSNFAYVKKEVGIDDMMNFETFGNSIICMFMITTSAGWDGLLAPILNSPPDC-DPDVDNPG---STTRGNCGNAAVGIVFFCSYIVMSFLVVVNMYIAIILENFNVATEESSDPLCEDDFEMFYETWEKFDPTASQFIDYNRLSEFCDTLKDPLRIPKPNTLKLITMDIPMVTGDKIHCLDLLLALTGEVLG---GSDQMDGMKATMEEKFMANNPSKASYEPITSTLKRKQEEVAASTIQRAYRSHILKRCVKQAS 1744          

HSP 4 Score: 104.76 bits (260), Expect = 9.520e-22
Identity = 72/255 (28.24%), Postives = 124/255 (48.63%), Query Frame = 3
Query: 1704 EDEVEIGNDTNNTDTAEMNPTIDRNCQCCIKQNVLCSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEV-----DALSIFRAFRLF---RVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIRANSPLC 2444
            E++ +  N      + +    I R   CC             Q  ++ FVT  FFD+FI   I +N + M  E        ++IL Y N  F +++  EC LKI AL   YF++GWNIFDFVVVI SI+ +G+ ++      + ++FR  RL    RV +L +  + +R LL  +  ++  + N+ +++ L++++F++ G  ++          D +   NF+ F +S+I +F I      +     I  + P C
Sbjct: 1308 EEQKKYYNAMKKLGSKKPQKPIPRPTNCC-------------QGLVFDFVTQQFFDIFIMVMICLNMVTMMVETDDQSAEIEEILFYINFAFIILFTGECVLKITALRYHYFSIGWNIFDFVVVILSILGIGLADLIEKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLIMFIFSIFGMSNFAYVKKEVGIDDMM---NFETFGNSIICMFMITTSAGWDGLLAPILNSPPDC 1546          

HSP 5 Score: 74.3294 bits (181), Expect = 1.517e-12
Identity = 66/278 (23.74%), Postives = 127/278 (45.68%), Query Frame = 3
Query: 1572 NGMSDADSSLCKNTTSIHENDDNFRFMDSEEEK-EGKDCDNKAEYEDEVEIGNDTNNTDTAEMNP-------------TIDRNC-------QC-CIKQNVLCSK---WVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASE--HYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIID-----LGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYH 2306
            N + ++ SS+ K   +  E+DD+     SE+E  EG+D + K +  DE      ++   T +  P             T   +C       +C C+  +V   K   W  F+   +  V   +F+ FI F I +++  +A E  +    +    IL+Y++ +FT ++++E  LK +A   K YF   W   DF++V  S+I      LG  E+ A+   R  R  R  +    ++ MR+++  +   I  + N+ ++ L+   +F+++G   +   ++
Sbjct:  909 NAIMNSSSSMVKVPIANGESDDDDGNGSSEDEDDEGRDINMKKKNGDE------SSTCSTVDKPPEVEDLVEEEEEDLTSPEDCYTENCIRRCPCLDLDVSQGKGKAWWNFRKTCFAIVEHSYFETFIIFMILLSSGALAFEDIYIEQRRMIKIILEYADQVFTYVFVVEMLLKWVAYGFKVYFTNAWCWLDFLIVDVSLISLTANILGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIFNVLLVCLIFWLIFSIMGVNLFAGKFY 1180          

HSP 6 Score: 68.5514 bits (166), Expect = 8.349e-11
Identity = 76/347 (21.90%), Postives = 144/347 (41.50%), Query Frame = 3
Query: 3018 CCYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKV----YFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFF-KCL-------------------DSNTRERLAATV--------------VPNKSE------------------CLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVI 3890
             CYC+         S ++  R  ++ I  H  F   I++ IL + + +   D      P      +++ Y+FT ++  E ++K++S GF +    +    W  LDF ++S++ L+          ++    +LRT R LR L+ I+   G+K +V ALI ++  + +V+++ +    +F++ G+Q F G    KC+                   D N      +T               VP + +                  CL+          ++DN    FLAL+++ T + W  + Q  + + G            Y  +FV+ I +GSF+++NL + V+
Sbjct:  161 ACYCL---------SPFNPVRRAAIRILIHSLFSLVIMLTILTNCVFMAMSD-----PPGWS---KILEYVFTGIYTFEAMVKVLSRGFCIGDFTFLRDPWNWLDFMVISMAYLTEF-------VDLGNISALRTFRVLRALKTITVIPGLKTIVGALIQSVKKLADVMILTVFCLSVFALIGLQLFMGNLRQKCVLWPPVGWYSDNLTVLSNYTDINGNGTANSTFDYQKYINSEENYYYVPGQMDPLVCGNSSDAGLCPEGYICLKAGRNPNYGYTSYDNFGWAFLALFRLMTQDFWENLFQLTLRAAG----------KTYMIFFVVIIFLGSFYLINLILAVV 473          

HSP 7 Score: 63.929 bits (154), Expect = 2.342e-9
Identity = 72/312 (23.08%), Postives = 132/312 (42.31%), Query Frame = 3
Query: 3006 KPFHCCYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXX--XXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIM----------QDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFN 3905
            +P +CC  +V D  T                   + F+  I+V I  + + +  E    D +  +++ L  IN+ F  LF  E +LKI +L +  YF+  W I      I+SI  + L + I  +    T FR +R  R  R LR I   +G++ ++ AL+ ++P++FN+ L+  +   IFSI G+  F                             +     +  +NF+   N  + ++ I T  GW  ++             +D+ G   +    N      +F  +I++    ++N++I +I++NFN
Sbjct: 1331 RPTNCCQGLVFDFVT------------------QQFFDIFIMVMICLNMVTMMVETD--DQSAEIEEILFYINFAFIILFTGECVLKITALRYH-YFSIGWNIFDFVVVILSILGIGLADLIEKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLIMFIFSIFGMSNF--------------------------AYVKKEVGIDDMMNFETFGNSIICMFMITTSAGWDGLLAPILNSPPDCDPDVDNPGSTTRGNCGNAAVGIVFFCSYIVMSFLVVVNMYIAIILENFN 1595          

HSP 8 Score: 62.003 bits (149), Expect = 8.279e-9
Identity = 78/330 (23.64%), Postives = 143/330 (43.33%), Query Frame = 3
Query:  495 WSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYP--------ISEY---VFLAIYTLEMVIRMTSRGVII---NSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAG--NCSKTNPNSICLPHIGPNPNF----GYTNFDNFGWALLSMFQLITLDYWEN-QYNLV-IRASGSWNI--------LFYIIVVFFGSFYLINLMLAVV 1394
            W   RK    I  +  F+ FI+  IL++   LA  + Y         I EY   VF  ++ +EM+++  + G  +   N++ +L   + +VD+ +I L+  ++   +        + SLRTLR LR L+ ++   G++ + +AL+ ++  +F V+   L C+ F+ +F++                          N F   FYY                  C N++S    + +  N  + C   +  +P      G  NFDN G   L++ Q+ T   W +  Y+ V  RA  S  +        ++++I + FGSF+ +NL + V+
Sbjct: 1010 WWNFRKTCFAIVEHSYFETFIIFMILLSSGALAFEDIYIEQRRMIKIILEYADQVFTYVFVVEMLLKWVAYGFKVYFTNAWCWLD--FLIVDVSLISLTANILGYSELGA-----IKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIFNVL---LVCLIFWLIFSIM-----------------------GVNLFAGKFYY------------------CFNETSEEVFDHNVVNNKTDCYELMEFHPEVRWMNGKINFDNVGMGYLALLQVATFKGWMDIMYSAVDSRAIESQPVYEANLYMYIYFVIFIIFGSFFTLNLFIGVI 1288          

HSP 9 Score: 54.6842 bits (130), Expect = 1.555e-6
Identity = 61/264 (23.11%), Postives = 118/264 (44.70%), Query Frame = 3
Query: 3039 DIETPCGSRWHAFRNRSL----------------LITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTG 3782
            DIE PC   W+ F +  L                L       +  I +CI+ +++ +  E   +  +  +++ L + N +FT +F  EM+LK+I+L    YF   W I D  IV++SL+ L+        ++     LR+ R +R  +    W  + +++  +  ++ ++ N+ LV  +   IF++ G+Q F GK +             +V    S+C  +   W  ++       + FL ++++   E W+E M D ++  G
Sbjct:  581 DIERPCPPGWYKFADIFLKWDCCIPWVKFKRIVYLFVMDPFVDLGITLCIVLNTVFMAMEHYPMSVH--VEEVLAIGNLVFTGIFAAEMVLKLIALDPYYYFQVGWNIFDSIIVTMSLVELML------ADVEGLSVLRSFRLMRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLF-GKSY-----------TDSVCKISSDC--ELPRWHMADF-----FHAFLIIFRVLCGE-WIETMWDCMEVAG 816          
BLAST of Sodium channel protein vs. Ensembl Zebrafish
Match: scn4ab (sodium channel, voltage-gated, type IV, alpha, b [Source:NCBI gene;Acc:564977])

HSP 1 Score: 458.759 bits (1179), Expect = 8.089e-133
Identity = 286/772 (37.05%), Postives = 458/772 (59.33%), Query Frame = 3
Query:  231 DEGKLVDGELKFEVEDFSDNCQPDPELVAGSILLEDKLGEFPEELLGKPLNEIDQNLK-DKSFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYP----ISEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCV--KMVDW--------KNVMSENHSNEFVNAF-YYNWTHNPNNW--IRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-----XXXXXXXHDKDQMKDLKITNGMSDADSSLCKNTTSIHENDDNFRFMDSEEEKEGKDCDNKAEYEDEVEIGNDTNNTDTAEMNPTIDRNCQCCIKQNVLCSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSK-EYFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHT---QIFGD-NIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIR-ANSPLCLLIFI 2459
            ++ ++ +  +K   ED     +P  +L AG +L     G+ P  LL  P+ E+D   K  K+F+VI+ +     IYR++   +    +P++ +R+ A+ I  + +F   IMLTIL NCVF+A++ D P    I EYVF  IYT E ++++ SRG  I  +T+LRDP+N +D ++I ++Y+   V+        N+S+LRT RVLRALKTIT++PGLKTI  ALI+S+K L +V+IL++FC+S FAL  LQ++ G LR KCV    V W         N    N +    + F Y  + ++  N+  +   ++ L CGN S AG C +     ICL   G NPN+GYT++DNFGWA L++F+L+T D+WEN + L +RA+G   ++F+++++F GSFYLINL+LAVV+M+Y E+ EA + E +E++    K  ++ KK  ++ +         +S K   D DQM+        SD D    K  +  + +  N  +++  + +       K      VE   D          P   +     +K +  C  WV F+  +Y+FV DPF DL I+ CI +NT+ MA EHYP     +++L   N++FT I+  E  LK++AL    YF VGWNIFD ++V  S+++L + +V+ LS+ R+FRL RVFKLA+SW T+ +L+ II +++  +GNL++++ +++++FAV+G Q +  +Y     +I  D  +PRW+  DF+H+ +++FR++CGEWIE  +DC+  A   +C+++F+
Sbjct:   34 EQERMKEQNVKVAEEDLP---KPTSDLEAGKVL-PFIYGDPPPNLLNVPIEELDPYYKAQKTFIVIDKK---NTIYRFNTEPACYCLSPFNPVRRAAIRILIHSLFSLVIMLTILTNCVFMAMS-DPPGWSKILEYVFTGIYTFEAMVKVLSRGFCIGDFTFLRDPWNWLDFMVISMAYLTEFVDLG------NISALRTFRVLRALKTITVIPGLKTIVGALIQSVKKLADVMILTVFCLSVFALIGLQLFMGNLRQKCVLWPPVGWYSDNLTVLSNYTDINGNGTANSTFDYQKYINSEENYYYVPGQMDPLVCGNSSDAGLCPE---GYICL-KAGRNPNYGYTSYDNFGWAFLALFRLMTQDFWENLFQLTLRAAGKTYMIFFVVIIFLGSFYLINLILAVVAMAYAEQNEATAAEAKEKEEEYAKIMEQLKKQAEQKNGMVNGSKTSLSSKKKGDNDQMQ--------SDYDGIALKPLSKSNGSKGNINYLEVPDSQ-----IRKPSVVSAVESALDAQEDIERPCPPGWYKFADIFLKWDC-CIPWVKFKRIVYLFVMDPFVDLGITLCIVLNTVFMAMEHYPMSVHVEEVLAIGNLVFTGIFAAEMVLKLIALDPYYYFQVGWNIFDSIIVTMSLVELMLADVEGLSVLRSFRLMRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYTDSVCKISSDCELPRWHMADFFHAFLIIFRVLCGEWIETMWDCMEVAGQGMCIIVFM 773          

HSP 2 Score: 386.341 bits (991), Expect = 8.324e-109
Identity = 211/420 (50.24%), Postives = 276/420 (65.71%), Query Frame = 3
Query: 3021 CYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSEC--LRQNHT---WANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            C C+  D+    G  W  FR     I EH  FE  I+  IL SS  L FEDIY++    +K  L   + +FTY+F +EM+LK ++ GFKVYFT+ W  LDF IV +SL+SL  +ILG+ +E+ A +SLRT+RALRPLRA+SR++GM++VVNAL+ AIPSIFNVLLVC++FWLIFSI GV  F GKF+ C +  + E     VV NK++C  L + H    W N  INFDN   G+LAL Q+ATF+GWM+IM  A+DS  I  QP  E  +  Y YFVIFI+ GSFF LNLFIGVIIDNFN+ K K  G   D+F+T  Q+ YYN MKKL ++KP+K + RP    QG  +D      F++ I+++I LNMV MM+E   Q+A    +L  IN  F  +FT E ++KI+ LR+HYF   WN
Sbjct:  943 CPCLDLDVSQGKGKAWWNFRKTCFAIVEHSYFETFIIFMILLSSGALAFEDIYIEQRRMIKIILEYADQVFTYVFVVEMLLKWVAYGFKVYFTNAWCWLDFLIVDVSLISLTANILGY-SELGAIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIFNVLLVCLIFWLIFSIMGVNLFAGKFYYCFNETSEEVFDHNVVNNKTDCYELMEFHPEVRWMNGKINFDNVGMGYLALLQVATFKGWMDIMYSAVDSRAIESQPVYEANLYMYIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKAKLGGT--DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPTNCCQGLVFDFVTQQFFDIFIMVMICLNMVTMMVETDDQSAEIEEILFYINFAFIILFTGECVLKITALRYHYFSIGWN 1359          

HSP 3 Score: 290.426 bits (742), Expect = 1.212e-78
Identity = 157/325 (48.31%), Postives = 226/325 (69.54%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQPPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFKQMT 5364
            + + ++  F++PTL RV+R+ RIGRVLRLI+ AKGIR LLFAL++SLPALFNIG LL LI+FI+SI GMS F  +KK  G+DD++NFETF  SI+ +F +TT+ GW+ +L  +   PP C +  V   G   + + G+CG A  GI++  ++I + +L+++NMYIAIILENFN A  +    + EDDFEMFY  WE++DP ASQ+I Y  LS+F   L +PL IPKPN + L++ D+P+V GDK+HCLD+L+AL   V+G    S++   +K  ME K+    P++     IT+T+KRK+E++AA T+QRA++    +R  KQ +
Sbjct: 1375 LADLIEKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLIMFIFSIFGMSNFAYVKKEVGIDDMMNFETFGNSIICMFMITTSAGWDGLLAPILNSPPDC-DPDVDNPG---STTRGNCGNAAVGIVFFCSYIVMSFLVVVNMYIAIILENFNVATEESSDPLCEDDFEMFYETWEKFDPTASQFIDYNRLSEFCDTLKDPLRIPKPNTLKLITMDIPMVTGDKIHCLDLLLALTGEVLG---GSDQMDGMKATMEEKFMANNPSKASYEPITSTLKRKQEEVAASTIQRAYRSHILKRCVKQAS 1692          

HSP 4 Score: 104.375 bits (259), Expect = 1.043e-21
Identity = 72/255 (28.24%), Postives = 124/255 (48.63%), Query Frame = 3
Query: 1704 EDEVEIGNDTNNTDTAEMNPTIDRNCQCCIKQNVLCSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEV-----DALSIFRAFRLF---RVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIRANSPLC 2444
            E++ +  N      + +    I R   CC             Q  ++ FVT  FFD+FI   I +N + M  E        ++IL Y N  F +++  EC LKI AL   YF++GWNIFDFVVVI SI+ +G+ ++      + ++FR  RL    RV +L +  + +R LL  +  ++  + N+ +++ L++++F++ G  ++          D +   NF+ F +S+I +F I      +     I  + P C
Sbjct: 1256 EEQKKYYNAMKKLGSKKPQKPIPRPTNCC-------------QGLVFDFVTQQFFDIFIMVMICLNMVTMMVETDDQSAEIEEILFYINFAFIILFTGECVLKITALRYHYFSIGWNIFDFVVVILSILGIGLADLIEKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLIMFIFSIFGMSNFAYVKKEVGIDDMM---NFETFGNSIICMFMITTSAGWDGLLAPILNSPPDC 1494          

HSP 5 Score: 74.3294 bits (181), Expect = 1.725e-12
Identity = 66/278 (23.74%), Postives = 127/278 (45.68%), Query Frame = 3
Query: 1572 NGMSDADSSLCKNTTSIHENDDNFRFMDSEEEK-EGKDCDNKAEYEDEVEIGNDTNNTDTAEMNP-------------TIDRNC-------QC-CIKQNVLCSK---WVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASE--HYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIID-----LGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYH 2306
            N + ++ SS+ K   +  E+DD+     SE+E  EG+D + K +  DE      ++   T +  P             T   +C       +C C+  +V   K   W  F+   +  V   +F+ FI F I +++  +A E  +    +    IL+Y++ +FT ++++E  LK +A   K YF   W   DF++V  S+I      LG  E+ A+   R  R  R  +    ++ MR+++  +   I  + N+ ++ L+   +F+++G   +   ++
Sbjct:  857 NAIMNSSSSMVKVPIANGESDDDDGNGSSEDEDDEGRDINMKKKNGDE------SSTCSTVDKPPEVEDLVEEEEEDLTSPEDCYTENCIRRCPCLDLDVSQGKGKAWWNFRKTCFAIVEHSYFETFIIFMILLSSGALAFEDIYIEQRRMIKIILEYADQVFTYVFVVEMLLKWVAYGFKVYFTNAWCWLDFLIVDVSLISLTANILGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIFNVLLVCLIFWLIFSIMGVNLFAGKFY 1128          

HSP 6 Score: 68.5514 bits (166), Expect = 9.745e-11
Identity = 76/347 (21.90%), Postives = 144/347 (41.50%), Query Frame = 3
Query: 3018 CCYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKV----YFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFF-KCL-------------------DSNTRERLAATV--------------VPNKSE------------------CLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVI 3890
             CYC+         S ++  R  ++ I  H  F   I++ IL + + +   D      P      +++ Y+FT ++  E ++K++S GF +    +    W  LDF ++S++ L+          ++    +LRT R LR L+ I+   G+K +V ALI ++  + +V+++ +    +F++ G+Q F G    KC+                   D N      +T               VP + +                  CL+          ++DN    FLAL+++ T + W  + Q  + + G            Y  +FV+ I +GSF+++NL + V+
Sbjct:  109 ACYCL---------SPFNPVRRAAIRILIHSLFSLVIMLTILTNCVFMAMSD-----PPGWS---KILEYVFTGIYTFEAMVKVLSRGFCIGDFTFLRDPWNWLDFMVISMAYLTEF-------VDLGNISALRTFRVLRALKTITVIPGLKTIVGALIQSVKKLADVMILTVFCLSVFALIGLQLFMGNLRQKCVLWPPVGWYSDNLTVLSNYTDINGNGTANSTFDYQKYINSEENYYYVPGQMDPLVCGNSSDAGLCPEGYICLKAGRNPNYGYTSYDNFGWAFLALFRLMTQDFWENLFQLTLRAAG----------KTYMIFFVVIIFLGSFYLINLILAVV 421          

HSP 7 Score: 63.929 bits (154), Expect = 2.451e-9
Identity = 72/312 (23.08%), Postives = 132/312 (42.31%), Query Frame = 3
Query: 3006 KPFHCCYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXX--XXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIM----------QDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFN 3905
            +P +CC  +V D  T                   + F+  I+V I  + + +  E    D +  +++ L  IN+ F  LF  E +LKI +L +  YF+  W I      I+SI  + L + I  +    T FR +R  R  R LR I   +G++ ++ AL+ ++P++FN+ L+  +   IFSI G+  F                             +     +  +NF+   N  + ++ I T  GW  ++             +D+ G   +    N      +F  +I++    ++N++I +I++NFN
Sbjct: 1279 RPTNCCQGLVFDFVT------------------QQFFDIFIMVMICLNMVTMMVETD--DQSAEIEEILFYINFAFIILFTGECVLKITALRYH-YFSIGWNIFDFVVVILSILGIGLADLIEKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLIMFIFSIFGMSNF--------------------------AYVKKEVGIDDMMNFETFGNSIICMFMITTSAGWDGLLAPILNSPPDCDPDVDNPGSTTRGNCGNAAVGIVFFCSYIVMSFLVVVNMYIAIILENFN 1543          

HSP 8 Score: 62.003 bits (149), Expect = 8.452e-9
Identity = 78/330 (23.64%), Postives = 143/330 (43.33%), Query Frame = 3
Query:  495 WSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYP--------ISEY---VFLAIYTLEMVIRMTSRGVII---NSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAG--NCSKTNPNSICLPHIGPNPNF----GYTNFDNFGWALLSMFQLITLDYWEN-QYNLV-IRASGSWNI--------LFYIIVVFFGSFYLINLMLAVV 1394
            W   RK    I  +  F+ FI+  IL++   LA  + Y         I EY   VF  ++ +EM+++  + G  +   N++ +L   + +VD+ +I L+  ++   +        + SLRTLR LR L+ ++   G++ + +AL+ ++  +F V+   L C+ F+ +F++                          N F   FYY                  C N++S    + +  N  + C   +  +P      G  NFDN G   L++ Q+ T   W +  Y+ V  RA  S  +        ++++I + FGSF+ +NL + V+
Sbjct:  958 WWNFRKTCFAIVEHSYFETFIIFMILLSSGALAFEDIYIEQRRMIKIILEYADQVFTYVFVVEMLLKWVAYGFKVYFTNAWCWLD--FLIVDVSLISLTANILGYSELGA-----IKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIFNVL---LVCLIFWLIFSIM-----------------------GVNLFAGKFYY------------------CFNETSEEVFDHNVVNNKTDCYELMEFHPEVRWMNGKINFDNVGMGYLALLQVATFKGWMDIMYSAVDSRAIESQPVYEANLYMYIYFVIFIIFGSFFTLNLFIGVI 1236          

HSP 9 Score: 54.6842 bits (130), Expect = 1.549e-6
Identity = 61/264 (23.11%), Postives = 118/264 (44.70%), Query Frame = 3
Query: 3039 DIETPCGSRWHAFRNRSL----------------LITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTG 3782
            DIE PC   W+ F +  L                L       +  I +CI+ +++ +  E   +  +  +++ L + N +FT +F  EM+LK+I+L    YF   W I D  IV++SL+ L+        ++     LR+ R +R  +    W  + +++  +  ++ ++ N+ LV  +   IF++ G+Q F GK +             +V    S+C  +   W  ++       + FL ++++   E W+E M D ++  G
Sbjct:  529 DIERPCPPGWYKFADIFLKWDCCIPWVKFKRIVYLFVMDPFVDLGITLCIVLNTVFMAMEHYPMSVH--VEEVLAIGNLVFTGIFAAEMVLKLIALDPYYYFQVGWNIFDSIIVTMSLVELML------ADVEGLSVLRSFRLMRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLF-GKSY-----------TDSVCKISSDC--ELPRWHMADF-----FHAFLIIFRVLCGE-WIETMWDCMEVAG 764          
BLAST of Sodium channel protein vs. Ensembl Xenopus
Match: SCN4A (sodium channel, voltage gated, type IV alpha subunit [Source:NCBI gene;Acc:100492371])

HSP 1 Score: 464.151 bits (1193), Expect = 1.444e-134
Identity = 274/734 (37.33%), Postives = 430/734 (58.58%), Query Frame = 3
Query:  345 GEFPEELLGKPLNEIDQNLKD-KSFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLAL--LISTNQIFDYFIMLTILVNCVFLALNNDYPIS---EYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHN----PNNWIRNGIN-YLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHDKDQMKDLKIT--NGMSDADSSLCKNTTSIHENDDNFRFMDSEEEKEGKDCDNKAEYEDEVEIGNDTNNTDTAEMNPTIDRNCQCCIK-----QNVL-----CSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSK-EYFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHT---QIFGD-NIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIR-ANSPLCLLIFI 2459
            G+ P EL+G P+ E+D    + K+F+V+N   K K I+R++ATK+  L  P++ IR+ A+  LI +  + + FIM TIL NCVF+ +++  P S   EY F  IYT E +I++ +RG  I+S+T+LRDP+N +D  +I+++Y    V+        NVS+LRT RVLRALKTIT++PGLKTI  ALI+S+K L +V+IL+LFC++ FAL  LQ++ G LR+KCV+     +     + N  +N+  YN T       N +  +G N  L CGN S AG C    P S      G NPN+GYT++D+F WA LS+F+L+T D+WEN + L +RA+G   ++F+++V+F GSFYLINL+LAVV+M+Y                 +      ++++ K+      +     H ++Q + +     +   +A   +C +   +  N      +      +     N   Y +E  +     +T +      ++   Q C        N       C  WV F+  +   V DPF DL I+ CI +NT+ MA EHYP  + ++ +L   N++FT I+  E   KI+AL    YF VGWNIFD ++V  S+++LG+  V+ LS+ R+FRL RVFKLA+SW T+ +L+ II +++  +GNL++++ +++++FAV+G Q +  +Y     +I  D  +PRW+  DF+HS ++VFRI+CGEWIE  +DC+  A   +CL++F+
Sbjct:   64 GDPPPELIGIPIEELDSFYSNQKTFIVLN---KGKAIFRFTATKALYLLDPFNPIRRGAIKVLIHSYPLINLFIMFTILTNCVFMTMSDPPPWSKNVEYTFTGIYTFESLIKILARGFCIDSFTFLRDPWNWLDFCVIVMAYTTEFVDLG------NVSALRTFRVLRALKTITVIPGLKTIVGALIQSVKKLADVMILTLFCLAVFALIGLQLFMGNLRHKCVRWPPPDDYFML-YDNSTLNSTLYNDTMINSTLTNFYFLDGANDALLCGNSSDAGKC----PESYTCMKTGRNPNYGYTSYDSFNWAFLSLFRLMTQDFWENLFQLTLRAAGKTYMVFFVVVIFLGSFYLINLILAVVAMAY----------------AEQNEATLQEEIEKEKEFQELLLQLKKHQEEQARRVSTVFLSHSQNARLKICSHVVCLLANCLLVSTVSQTSSAQSDQQRNSKVYLEEPTLQKRAESTHSVLSEVALEEAHQKCPPWWYKFANTFLIWDCCDLWVKFKEFVRFVVMDPFVDLGITICIVLNTLFMAMEHYPMTEQFEGVLNVGNLVFTGIFAAEMFFKIIALDPYYYFQVGWNIFDSIIVTLSLVELGLANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKIASDCELPRWHMHDFFHSFLIVFRILCGEWIETMWDCMEVAGQAMCLVVFM 767          

HSP 2 Score: 381.333 bits (978), Expect = 3.703e-107
Identity = 209/425 (49.18%), Postives = 282/425 (66.35%), Query Frame = 3
Query: 3012 FHC---CYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHT----WANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            F+C   C C+  DI T  G  W   R     I EH  FE  I+  IL SS  L FEDIY++    +K  L   + +FTY+F  EM+LK  + GFK+YFT+ W  LDF IV +SL+SL  + LG+ +E+   +SLRT+RALRPLRA+SR++GM++VVNAL+ AIPSI NVLLVC++FWLIFSI GV  F GK+++C+++ T E     VV N+S+CL  N++    W N  +NFDN   G+L+L Q+ATF+GWM+IM  A+DS  I  QP+ E  +  Y YFVIFI+ G+FF LNLFIGVIIDNFN+ K K      D+F+T  Q+ YYN MKKL ++KP+K + RP   +QG  YD      F++VI+ILI LNMV MMIE   Q+   T++L  IN++F  IFT E ++K+  LR+++F   WN
Sbjct:  923 FNCVRRCPCLYVDITTEKGKIWWNIRKTCFQIVEHNWFETFIIFMILLSSGALAFEDIYIEQRQVIKTILEYADKVFTYIFVFEMLLKWTAYGFKIYFTNAWCWLDFLIVDVSLISLTANWLGY-SELGPIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKYYRCINTTTSELFEIDVVNNRSDCLALNNSEQVRWVNVKVNFDNVGLGYLSLLQVATFKGWMDIMYAAVDSRNIEDQPQYEINLYMYLYFVIFIIFGAFFTLNLFIGVIIDNFNQQKKKISK---DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPTNKIQGLVYDFVTKQLFDIVIMILICLNMVTMMIETDDQSQEKTDILFKINLVFIVIFTAECVLKMFALRYYFFTIGWN 1343          

HSP 3 Score: 293.508 bits (750), Expect = 2.222e-79
Identity = 163/326 (50.00%), Postives = 224/326 (68.71%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQ-PPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFKQMT 5364
            + + +   F++PTL RV+R+ RIGRVLRLI+ AKGIR LLFAL++SLPALFNIG LL L++FIYSI GMS F  +KK  G+DD+ NFETF  SI+ LF++TT+ GW+ +L  +    PP C + H+   G       GDCG    GI++  ++I I +LI++NMYIAIILENFN A  +    + EDDFEMFY  WE++DP A+Q+++Y+ +SDFV  L +PL IPKPN I L++ DLP+V GDK+HCLDIL AL K V+G   DS E   +K  ME K+    P++V    ITTT+KRK+E++    +QRA++    +R+ K  +
Sbjct: 1359 LSDLIAEYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYSIFGMSNFAYVKKESGIDDIFNFETFGNSIICLFQITTSAGWDGLLNPILNSGPPDC-DPHLENFG---TTVTGDCGNPAIGIVFFCSYIIISFLIVVNMYIAIILENFNVATEESGEPLCEDDFEMFYETWEKFDPDATQFVEYSRMSDFVDTLQDPLRIPKPNKIKLITLDLPMVTGDKIHCLDILFALTKEVLG---DSGEMDALKASMEEKFMMANPSKVSYEPITTTLKRKQEEVCVIKIQRAFRRHLLRRSVKHAS 1677          

HSP 4 Score: 98.9821 bits (245), Expect = 7.312e-20
Identity = 67/194 (34.54%), Postives = 110/194 (56.70%), Query Frame = 3
Query: 1830 QNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASII-----DLGVEEVDALSIFRAFRLF---RVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFG-DNIPRWNFDDFWHSMILVFRI 2384
            Q  +Y FVT   FD+ I   I +N + M  E     +   DIL   N++F VI+  EC LK+ AL   +F +GWNIFDFVVVI SI+     DL  E   + ++FR  RL    RV +L +  + +R LL  +  ++  + N+ +++ LV++++++ G  ++   Y  +  G D+I  +NF+ F +S+I +F+I
Sbjct: 1269 QGLVYDFVTKQLFDIVIMILICLNMVTMMIETDDQSQEKTDILFKINLVFIVIFTAECVLKMFALRYYFFTIGWNIFDFVVVILSIVGIVLSDLIAEYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYSIFGMSNF--AYVKKESGIDDI--FNFETFGNSIICLFQI 1458          

HSP 5 Score: 64.3142 bits (155), Expect = 2.703e-9
Identity = 54/220 (24.55%), Postives = 100/220 (45.45%), Query Frame = 3
Query: 1689 NKAEYEDEVEIGNDTNN---TDTAEMNPTIDRNCQCCIKQNVLCSK---WVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASE--HYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIID-----LGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYH 2306
            N      EV I ++ ++    DT E N    R C C +  ++   K   W   +   +  V   +F+ FI F I +++  +A E  +    +    IL+Y++ +FT I++ E  LK  A   K YF   W   DF++V  S+I      LG  E+  +   R  R  R  +    ++ MR+++  +   I  + N+ ++ L+   +F+++G   +   Y+
Sbjct:  898 NNPHMRIEVPIASEESDFDIPDTDEFNCV--RRCPC-LYVDITTEKGKIWWNIRKTCFQIVEHNWFETFIIFMILLSSGALAFEDIYIEQRQVIKTILEYADKVFTYIFVFEMLLKWTAYGFKIYFTNAWCWLDFLIVDVSLISLTANWLGYSELGPIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKYY 1114          

HSP 6 Score: 60.077 bits (144), Expect = 4.773e-8
Identity = 56/267 (20.97%), Postives = 112/267 (41.95%), Query Frame = 3
Query: 3219 INYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKG-------------KFFKCLDSNTRERLA------------------------------ATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVI 3890
            + Y FT ++  E ++KI++ GF +   SF  + D +      + ++     F  ++    +LRT R LR L+ I+   G+K +V ALI ++  + +V+++ +    +F++ G+Q F G              +F   D++T                                   A   P    C++          ++D+    FL+L+++ T + W  + Q  + + G            Y  +FV+ I +GSF+++NL + V+
Sbjct:  157 VEYTFTGIYTFESLIKILARGFCI--DSFTFLRDPWNWLDFCVIVMAYTTEF-VDLGNVSALRTFRVLRALKTITVIPGLKTIVGALIQSVKKLADVMILTLFCLAVFALIGLQLFMGNLRHKCVRWPPPDDYFMLYDNSTLNSTLYNDTMINSTLTNFYFLDGANDALLCGNSSDAGKCPESYTCMKTGRNPNYGYTSYDSFNWAFLSLFRLMTQDFWENLFQLTLRAAG----------KTYMVFFVVVIFLGSFYLINLILAVV 410          

HSP 7 Score: 58.5362 bits (140), Expect = 1.379e-7
Identity = 76/324 (23.46%), Postives = 133/324 (41.05%), Query Frame = 3
Query:  495 WSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDY--------PISEY---VFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNI-------------LFYIIVVFFGSFYLINLMLAVV 1394
            W  IRK    I  +  F+ FI+  IL++   LA  + Y         I EY   VF  I+  EM+++ T+ G  I    Y  + +  +D LI+ +S I +            + SLRTLR LR L+ ++   G++ + +AL+ ++  +  V+++ L     F++  + ++ G    +C+         SE    + VN                  N   C   +++      N                  NFDN G   LS+ Q+ T   W    +++  A  S NI             L+++I + FG+F+ +NL + V+
Sbjct:  944 WWNIRKTCFQIVEHNWFETFIIFMILLSSGALAFEDIYIEQRQVIKTILEYADKVFTYIFVFEMLLKWTAYGFKI----YFTNAWCWLDFLIVDVSLISLTANWLGYSELGPIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKYY-RCI-----NTTTSELFEIDVVN------------------NRSDCLALNNSEQVRWVNVK---------------VNFDNVGLGYLSLLQVATFKGW---MDIMYAAVDSRNIEDQPQYEINLYMYLYFVIFIIFGAFFTLNLFIGVI 1221          
BLAST of Sodium channel protein vs. Ensembl Xenopus
Match: ENSXETT00000052002.1 (sodium channel, voltage gated, type I alpha subunit [Source:NCBI gene;Acc:100488621])

HSP 1 Score: 385.571 bits (989), Expect = 5.094e-108
Identity = 218/446 (48.88%), Postives = 286/446 (64.13%), Query Frame = 3
Query: 2934 IDEESVNELKGCCCAICYNPFQEKKPFHCCYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHT--WANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            I+ E   E   C    C       K F  CY    +IE   G  W  FR     I EH  FE  I+  IL SS  L FEDIY++   T+K  L   + +FTY+F +EM+LK ++ GF  YFT+ W  LDF IV +SL+SL+ + LG+ +E+ A +SLRT+RALRPLRA+SR++GM++VVNALI AIPSI NVLLVC++FWLIFSI GV  F GK++ C+++ T E L  T V N+S+CL  N +  W N  +NFDN   G+LAL Q+ATF+GWM+IM  A+DS  +  QP+ E+ +  Y YFVIFI+ GSFF LNLFIGVIIDNFN+ K K      D+F+T  Q+ YYN MKKL ++KP+K + RP    QG  +D      F+++I+ILI LNMV MMIE   Q+    N L  IN++F  +FT E I+KI  LR +YF   WN
Sbjct: 1130 IESEEALEPDACFTEGCV------KRFPICYV---NIEENKGKLWWTFRKTCYTIVEHNWFETFIIFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFVKYFTNAWCWLDFLIVDVSLVSLVANALGY-SELGAIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKYYHCVNTTTGEMLLDTQVNNRSDCLHLNESARWKNVKVNFDNVGAGYLALLQVATFKGWMDIMYAAVDSRKVEEQPRYEDNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKISQ---DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPPNKYQGLVFDFVTKQAFDIIIMILICLNMVTMMIETDEQSQDMENNLYWINLVFIILFTGECILKIISLRHYYFTIGWN 1562          

HSP 2 Score: 269.24 bits (687), Expect = 8.636e-72
Identity = 145/326 (44.48%), Postives = 218/326 (66.87%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQ-PPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFKQMT 5364
            + + ++  F++PTL RV+R+ RIGR+LRLIK AKGIR LLFAL++SLPALFNIG LL L++FIY+I GMS F  +KK  G+DD+ NFETF  S++ LF++TT+ GW+ +L  +     P C+          K    GDCG    GI +  ++I I +L+++NMYIA+ILENF+ A  +    + EDDFEMFY VWE++DP A+Q+I+Y+ LS+F   LD PL I KPN + L++ DLP+V GD++HCLDIL A  K V+G   + +E   ++  ME ++    P++     IT+T++RK+E+++   +QR ++    ++  K+ +
Sbjct: 1578 LADMIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKKESGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSGAPDCDPQMEHPGSSVK----GDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLGEDDFEMFYEVWEKFDPDATQFIEYSKLSNFADALDPPLRIAKPNRVQLIAMDLPMVSGDRIHCLDILFAFTKRVLG---EGDEMDALRLPMEERFMASNPSKASYEPITSTLRRKQEELSVVIIQRCFRKYLLRKTIKKAS 1896          

HSP 3 Score: 265.388 bits (677), Expect = 1.397e-70
Identity = 159/407 (39.07%), Postives = 251/407 (61.67%), Query Frame = 3
Query:  219 HRHIDEGKLVDGELKFEVEDFSDNCQPDPELVAGSILLEDKLGEFPEELLGKPLNEIDQN-LKDKSFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQIFDY-----FIMLTILVNCVFLALNNDYPIS---EYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSN--EFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
             + I E K    + +   +D  +  +P  +L AG  L     G+ P  ++ +PL ++D   +  K+F+V+N   + K I+R+SAT +  +  P++ +RK+A+ +  +  + +      IM TIL NCVF+ ++N    +   EY F  IYT E +I++ +RG  +  +T+LRDP+N +D  +I+++Y+   V+        NVS+LRT RVLRALKTI+++PGLKTI  ALI+S+K L +V+IL++FC+S FAL  LQ++ G LRNKC++   W  +     +N    +N       H+P +  +N   ++T   +SSA  C K     IC+   G NPN+GYT+FD F WA LS+F+L+T DYWEN Y L +RA+G   ++F+++V+F GSFYL+NL+LAVV+M+Y
Sbjct:   26 EKRIAEEKAKKPKQEHRDDDDDNGPKPSSDLEAGKSL-PFIYGDIPPGMVSEPLEDLDPYYMNQKTFIVLN---RGKAIFRFSATSALYILTPFNPLRKVAIKVLVHS-YPFPSDLMLIMCTILTNCVFMTMSNPPEWTKNVEYTFTGIYTFESLIKILARGFCLEKFTFLRDPWNWLDFSVIVMAYVTEFVDLG------NVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGHLRNKCLQ---WPPIDYFPLTNIPPILNGTMN--IHDPFDKSKNNCQFMT---NSSAAQCPK---GYICV-KTGKNPNYGYTSFDTFSWAFLSLFRLMTQDYWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLVNLILAVVAMAY 409          

HSP 4 Score: 207.608 bits (527), Expect = 6.259e-53
Identity = 94/223 (42.15%), Postives = 154/223 (69.06%), Query Frame = 3
Query: 1809 CSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEY-FNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQI--FGDN--IPRWNFDDFWHSMILVFRIICGEWIEPSFDCIR-ANSPLCLLIFI 2459
            C  W+  ++ + + V DPF DL I+ CI +NT+ MA EHYP  K ++D+L   N++FT I+  E   K++AL   Y F  GWNIFD ++V  S+++LG+  V+ LS+ R+FRL RVFKLA+SW T+ +L+ II +++  +GNL++++ +++++FAV+G Q +  +Y   +    +N  +PRW+ +DF+HS ++VFR++CGEWIE  +DC+  A   +CLL+F+
Sbjct:  709 CENWLTVKHIVKLIVMDPFVDLAITICIVLNTLFMAMEHYPMTKEFNDVLSIGNLVFTGIFTAEMVFKLIALDPYYYFQEGWNIFDGIIVSLSLMELGLANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKIAENCELPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQSMCLLVFM 931          

HSP 5 Score: 96.6709 bits (239), Expect = 3.371e-19
Identity = 58/194 (29.90%), Postives = 109/194 (56.19%), Query Frame = 3
Query: 1827 FQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEV-----DALSIFRAFRLF---RVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRI 2384
            +Q  ++ FVT   FD+ I   I +N + M  E     +  ++ L + N++F +++  EC LKI++L   YF +GWNIFDFVVVI SI+ + + ++      + ++FR  RL    R+ +L +  + +R LL  +  ++  + N+ +++ LV++++A+ G  ++          D    +NF+ F +SMI +F+I
Sbjct: 1487 YQGLVFDFVTKQAFDIIIMILICLNMVTMMIETDEQSQDMENNLYWINLVFIILFTGECILKIISLRHYYFTIGWNIFDFVVVILSIVGMFLADMIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKKESGIDD---MFNFETFGNSMICLFQI 1677          

HSP 6 Score: 71.633 bits (174), Expect = 1.625e-11
Identity = 48/192 (25.00%), Postives = 93/192 (48.44%), Query Frame = 3
Query: 1782 QCCIKQNVLC---------SKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASE--HYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIID-----LGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYH 2306
            + C+K+  +C           W  F+   Y  V   +F+ FI F I +++  +A E  +    KT   +L+Y++ +FT I+I+E  LK +A    +YF   W   DF++V  S++      LG  E+ A+   R  R  R  +    ++ MR+++  +   I  + N+ ++ L+   +F+++G   +   Y+
Sbjct: 1144 EGCVKRFPICYVNIEENKGKLWWTFRKTCYTIVEHNWFETFIIFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFVKYFTNAWCWLDFLIVDVSLVSLVANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKYY 1335          

HSP 7 Score: 65.855 bits (159), Expect = 8.141e-10
Identity = 61/261 (23.37%), Postives = 118/261 (45.21%), Query Frame = 3
Query: 3219 INYIFTYLFCIEMILKIISLGFKVYFTSF----WTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFF-KCLDSNTRERLAATVVP-------------NKSE-------------------CLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVI 3890
            + Y FT ++  E ++KI++ GF +   +F    W  LDF ++ ++ ++          ++    +LRT R LR L+ IS   G+K +V ALI ++  + +V+++ +    +F++ G+Q F G    KCL     +    T +P             +KS+                   C++          +FD  +  FL+L+++ T + W  + Q  + + G            Y  +FV+ I +GSF+++NL + V+
Sbjct:  162 VEYTFTGIYTFESLIKILARGFCLEKFTFLRDPWNWLDFSVIVMAYVTEF-------VDLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGHLRNKCLQWPPIDYFPLTNIPPILNGTMNIHDPFDKSKNNCQFMTNSSAAQCPKGYICVKTGKNPNYGYTSFDTFSWAFLSLFRLMTQDYWENLYQLTLRAAG----------KTYMIFFVLVIFLGSFYLVNLILAVV 405          

HSP 8 Score: 58.9214 bits (141), Expect = 1.011e-7
Identity = 71/332 (21.39%), Postives = 136/332 (40.96%), Query Frame = 3
Query:  495 WSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDY-----------PISEYVFLAIYTLEMVIRMTSRGVI---INSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVN-VSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNC--SKTNPNSICLPHIGPNPNFG--YTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNI-------------LFYIIVVFFGSFYLINLMLAVV 1394
            W   RK    I  +  F+ FI+  IL++   LA  + Y             ++ VF  I+ LEM+++  + G +    N++ +L   + +VD+ ++ L      V    G + +  + SLRTLR LR L+ ++   G++ + +ALI ++  +  V+++ L     F++  + ++ G                                             Y  C N ++      ++ N  S CL H+  +  +     NFDN G   L++ Q+ T   W    +++  A  S  +             L+++I + FGSF+ +NL + V+
Sbjct: 1165 WWTFRKTCYTIVEHNWFETFIIFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFVKYFTNAWCWLD--FLIVDVSLVSL------VANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAG--------------------------------------------KYYHCVNTTTGEMLLDTQVNNRSDCL-HLNESARWKNVKVNFDNVGAGYLALLQVATFKGW---MDIMYAAVDSRKVEEQPRYEDNLYMYLYFVIFIIFGSFFTLNLFIGVI 1440          

HSP 9 Score: 56.6102 bits (135), Expect = 5.771e-7
Identity = 51/214 (23.83%), Postives = 102/214 (47.66%), Query Frame = 3
Query:  459 YSATKSFLL---CAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPISE----------YVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAF 1061
            Y    +FL+   C  W  ++ +  LI  +   D  I + I++N +F+A+ + YP+++           VF  I+T EMV ++    + ++ Y Y ++ +N+ D +I+ LS + + +    G     +S LR+ R+LR  K     P L  +   +  S+  L  + ++    +  FA+  +Q++ G    +CV  +     +   H N+F ++F
Sbjct:  697 YKFANTFLIWDCCENWLTVKHIVKLIVMDPFVDLAITICIVLNTLFMAMEH-YPMTKEFNDVLSIGNLVFTGIFTAEMVFKL----IALDPYYYFQEGWNIFDGIIVSLSLMELGLANVEG-----LSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLF-GKSYKECVCKIAENCELPRWHMNDFFHSF 899          
BLAST of Sodium channel protein vs. Ensembl Xenopus
Match: ENSXETT00000051997.1 (sodium channel, voltage gated, type I alpha subunit [Source:NCBI gene;Acc:100488621])

HSP 1 Score: 385.185 bits (988), Expect = 6.533e-108
Identity = 218/446 (48.88%), Postives = 286/446 (64.13%), Query Frame = 3
Query: 2934 IDEESVNELKGCCCAICYNPFQEKKPFHCCYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHT--WANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            I+ E   E   C    C       K F  CY    +IE   G  W  FR     I EH  FE  I+  IL SS  L FEDIY++   T+K  L   + +FTY+F +EM+LK ++ GF  YFT+ W  LDF IV +SL+SL+ + LG+ +E+ A +SLRT+RALRPLRA+SR++GM++VVNALI AIPSI NVLLVC++FWLIFSI GV  F GK++ C+++ T E L  T V N+S+CL  N +  W N  +NFDN   G+LAL Q+ATF+GWM+IM  A+DS  +  QP+ E+ +  Y YFVIFI+ GSFF LNLFIGVIIDNFN+ K K      D+F+T  Q+ YYN MKKL ++KP+K + RP    QG  +D      F+++I+ILI LNMV MMIE   Q+    N L  IN++F  +FT E I+KI  LR +YF   WN
Sbjct: 1150 IESEEALEPDACFTEGCV------KRFPICYV---NIEENKGKLWWTFRKTCYTIVEHNWFETFIIFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFVKYFTNAWCWLDFLIVDVSLVSLVANALGY-SELGAIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKYYHCVNTTTGEMLLDTQVNNRSDCLHLNESARWKNVKVNFDNVGAGYLALLQVATFKGWMDIMYAAVDSRKVEEQPRYEDNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKISQ---DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPPNKYQGLVFDFVTKQAFDIIIMILICLNMVTMMIETDEQSQDMENNLYWINLVFIILFTGECILKIISLRHYYFTIGWN 1582          

HSP 2 Score: 276.559 bits (706), Expect = 4.486e-74
Identity = 160/405 (39.51%), Postives = 250/405 (61.73%), Query Frame = 3
Query:  219 HRHIDEGKLVDGELKFEVEDFSDNCQPDPELVAGSILLEDKLGEFPEELLGKPLNEIDQN-LKDKSFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQIFDY-----FIMLTILVNCVFLALNNDYPIS---EYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
             + I E K    + +   +D  +  +P  +L AG  L     G+ P  ++ +PL ++D   +  K+F+V+N   + K I+R+SAT +  +  P++ +RK+A+ +  +  + +      IM TIL NCVF+ ++N    +   EY F  IYT E +I++ +RG  +  +T+LRDP+N +D  +I+++Y+   V+        NVS+LRT RVLRALKTI+++PGLKTI  ALI+S+K L +V+IL++FC+S FAL  LQ++ G LRNKC+   DW+  +++       N FY          +    ++L CGN S +G C K     IC+   G NPN+GYT+FD F WA LS+F+L+T DYWEN Y L +RA+G   ++F+++V+F GSFYL+NL+LAVV+M+Y
Sbjct:   26 EKRIAEEKAKKPKQEHRDDDDDNGPKPSSDLEAGKSL-PFIYGDIPPGMVSEPLEDLDPYYMNQKTFIVLN---RGKAIFRFSATSALYILTPFNPLRKVAIKVLVHS-YPFPSDLMLIMCTILTNCVFMTMSNPPEWTKNVEYTFTGIYTFESLIKILARGFCLEKFTFLRDPWNWLDFSVIVMAYVTEFVDLG------NVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGHLRNKCLTF-DWEEYITDK------NHFYK---------LEGQKDFLLCGNSSDSGQCPK---GYICV-KTGKNPNYGYTSFDTFSWAFLSLFRLMTQDYWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLVNLILAVVAMAY 399          

HSP 3 Score: 268.855 bits (686), Expect = 1.059e-71
Identity = 145/326 (44.48%), Postives = 218/326 (66.87%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQ-PPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFKQMT 5364
            + + ++  F++PTL RV+R+ RIGR+LRLIK AKGIR LLFAL++SLPALFNIG LL L++FIY+I GMS F  +KK  G+DD+ NFETF  S++ LF++TT+ GW+ +L  +     P C+          K    GDCG    GI +  ++I I +L+++NMYIA+ILENF+ A  +    + EDDFEMFY VWE++DP A+Q+I+Y+ LS+F   LD PL I KPN + L++ DLP+V GD++HCLDIL A  K V+G   + +E   ++  ME ++    P++     IT+T++RK+E+++   +QR ++    ++  K+ +
Sbjct: 1598 LADMIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKKESGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSGAPDCDPQMEHPGSSVK----GDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLGEDDFEMFYEVWEKFDPDATQFIEYSKLSNFADALDPPLRIAKPNRVQLIAMDLPMVSGDRIHCLDILFAFTKRVLG---EGDEMDALRLPMEERFMASNPSKASYEPITSTLRRKQEELSVVIIQRCFRKYLLRKTIKKAS 1916          

HSP 4 Score: 207.608 bits (527), Expect = 6.934e-53
Identity = 94/223 (42.15%), Postives = 154/223 (69.06%), Query Frame = 3
Query: 1809 CSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEY-FNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQI--FGDN--IPRWNFDDFWHSMILVFRIICGEWIEPSFDCIR-ANSPLCLLIFI 2459
            C  W+  ++ + + V DPF DL I+ CI +NT+ MA EHYP  K ++D+L   N++FT I+  E   K++AL   Y F  GWNIFD ++V  S+++LG+  V+ LS+ R+FRL RVFKLA+SW T+ +L+ II +++  +GNL++++ +++++FAV+G Q +  +Y   +    +N  +PRW+ +DF+HS ++VFR++CGEWIE  +DC+  A   +CLL+F+
Sbjct:  728 CENWLTVKHIVKLIVMDPFVDLAITICIVLNTLFMAMEHYPMTKEFNDVLSIGNLVFTGIFTAEMVFKLIALDPYYYFQEGWNIFDGIIVSLSLMELGLANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKIAENCELPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQSMCLLVFM 950          

HSP 5 Score: 96.6709 bits (239), Expect = 3.709e-19
Identity = 58/194 (29.90%), Postives = 109/194 (56.19%), Query Frame = 3
Query: 1827 FQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEV-----DALSIFRAFRLF---RVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRI 2384
            +Q  ++ FVT   FD+ I   I +N + M  E     +  ++ L + N++F +++  EC LKI++L   YF +GWNIFDFVVVI SI+ + + ++      + ++FR  RL    R+ +L +  + +R LL  +  ++  + N+ +++ LV++++A+ G  ++          D    +NF+ F +SMI +F+I
Sbjct: 1507 YQGLVFDFVTKQAFDIIIMILICLNMVTMMIETDEQSQDMENNLYWINLVFIILFTGECILKIISLRHYYFTIGWNIFDFVVVILSIVGMFLADMIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKKESGIDD---MFNFETFGNSMICLFQI 1697          

HSP 6 Score: 71.633 bits (174), Expect = 1.713e-11
Identity = 48/192 (25.00%), Postives = 93/192 (48.44%), Query Frame = 3
Query: 1782 QCCIKQNVLC---------SKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASE--HYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIID-----LGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYH 2306
            + C+K+  +C           W  F+   Y  V   +F+ FI F I +++  +A E  +    KT   +L+Y++ +FT I+I+E  LK +A    +YF   W   DF++V  S++      LG  E+ A+   R  R  R  +    ++ MR+++  +   I  + N+ ++ L+   +F+++G   +   Y+
Sbjct: 1164 EGCVKRFPICYVNIEENKGKLWWTFRKTCYTIVEHNWFETFIIFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFVKYFTNAWCWLDFLIVDVSLVSLVANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKYY 1355          

HSP 7 Score: 68.1662 bits (165), Expect = 1.662e-10
Identity = 61/251 (24.30%), Postives = 115/251 (45.82%), Query Frame = 3
Query: 3219 INYIFTYLFCIEMILKIISLGFKVYFTSF----WTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFF-KCL---------DSNTRERLAAT-------------VVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVI 3890
            + Y FT ++  E ++KI++ GF +   +F    W  LDF ++ ++ ++          ++    +LRT R LR L+ IS   G+K +V ALI ++  + +V+++ +    +F++ G+Q F G    KCL         D N   +L                  P    C++          +FD  +  FL+L+++ T + W  + Q  + + G            Y  +FV+ I +GSF+++NL + V+
Sbjct:  162 VEYTFTGIYTFESLIKILARGFCLEKFTFLRDPWNWLDFSVIVMAYVTEF-------VDLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGHLRNKCLTFDWEEYITDKNHFYKLEGQKDFLLCGNSSDSGQCPKGYICVKTGKNPNYGYTSFDTFSWAFLSLFRLMTQDYWENLYQLTLRAAG----------KTYMIFFVLVIFLGSFYLVNLILAVV 395          

HSP 8 Score: 58.9214 bits (141), Expect = 9.628e-8
Identity = 71/332 (21.39%), Postives = 136/332 (40.96%), Query Frame = 3
Query:  495 WSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDY-----------PISEYVFLAIYTLEMVIRMTSRGVI---INSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVN-VSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNC--SKTNPNSICLPHIGPNPNFG--YTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNI-------------LFYIIVVFFGSFYLINLMLAVV 1394
            W   RK    I  +  F+ FI+  IL++   LA  + Y             ++ VF  I+ LEM+++  + G +    N++ +L   + +VD+ ++ L      V    G + +  + SLRTLR LR L+ ++   G++ + +ALI ++  +  V+++ L     F++  + ++ G                                             Y  C N ++      ++ N  S CL H+  +  +     NFDN G   L++ Q+ T   W    +++  A  S  +             L+++I + FGSF+ +NL + V+
Sbjct: 1185 WWTFRKTCYTIVEHNWFETFIIFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFVKYFTNAWCWLD--FLIVDVSLVSL------VANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAG--------------------------------------------KYYHCVNTTTGEMLLDTQVNNRSDCL-HLNESARWKNVKVNFDNVGAGYLALLQVATFKGW---MDIMYAAVDSRKVEEQPRYEDNLYMYLYFVIFIIFGSFFTLNLFIGVI 1460          

HSP 9 Score: 56.6102 bits (135), Expect = 5.588e-7
Identity = 51/214 (23.83%), Postives = 102/214 (47.66%), Query Frame = 3
Query:  459 YSATKSFLL---CAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPISE----------YVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAF 1061
            Y    +FL+   C  W  ++ +  LI  +   D  I + I++N +F+A+ + YP+++           VF  I+T EMV ++    + ++ Y Y ++ +N+ D +I+ LS + + +    G     +S LR+ R+LR  K     P L  +   +  S+  L  + ++    +  FA+  +Q++ G    +CV  +     +   H N+F ++F
Sbjct:  716 YKFANTFLIWDCCENWLTVKHIVKLIVMDPFVDLAITICIVLNTLFMAMEH-YPMTKEFNDVLSIGNLVFTGIFTAEMVFKL----IALDPYYYFQEGWNIFDGIIVSLSLMELGLANVEG-----LSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLF-GKSYKECVCKIAENCELPRWHMNDFFHSF 918          
BLAST of Sodium channel protein vs. Ensembl Xenopus
Match: ENSXETT00000051931.1 (sodium channel, voltage gated, type I alpha subunit [Source:NCBI gene;Acc:100488621])

HSP 1 Score: 385.185 bits (988), Expect = 7.530e-108
Identity = 218/446 (48.88%), Postives = 286/446 (64.13%), Query Frame = 3
Query: 2934 IDEESVNELKGCCCAICYNPFQEKKPFHCCYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHT--WANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            I+ E   E   C    C       K F  CY    +IE   G  W  FR     I EH  FE  I+  IL SS  L FEDIY++   T+K  L   + +FTY+F +EM+LK ++ GF  YFT+ W  LDF IV +SL+SL+ + LG+ +E+ A +SLRT+RALRPLRA+SR++GM++VVNALI AIPSI NVLLVC++FWLIFSI GV  F GK++ C+++ T E L  T V N+S+CL  N +  W N  +NFDN   G+LAL Q+ATF+GWM+IM  A+DS  +  QP+ E+ +  Y YFVIFI+ GSFF LNLFIGVIIDNFN+ K K      D+F+T  Q+ YYN MKKL ++KP+K + RP    QG  +D      F+++I+ILI LNMV MMIE   Q+    N L  IN++F  +FT E I+KI  LR +YF   WN
Sbjct: 1186 IESEEALEPDACFTEGCV------KRFPICYV---NIEENKGKLWWTFRKTCYTIVEHNWFETFIIFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFVKYFTNAWCWLDFLIVDVSLVSLVANALGY-SELGAIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKYYHCVNTTTGEMLLDTQVNNRSDCLHLNESARWKNVKVNFDNVGAGYLALLQVATFKGWMDIMYAAVDSRKVEEQPRYEDNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKISQ---DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPPNKYQGLVFDFVTKQAFDIIIMILICLNMVTMMIETDEQSQDMENNLYWINLVFIILFTGECILKIISLRHYYFTIGWN 1618          

HSP 2 Score: 269.24 bits (687), Expect = 9.487e-72
Identity = 161/426 (37.79%), Postives = 257/426 (60.33%), Query Frame = 3
Query:  219 HRHIDEGKLVDGELKFEVEDFSDNCQPDPELVAGSILLEDKLGEFPEELLGKPLNEIDQN-LKDKSFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQIFDY-----FIMLTILVNCVFLALNNDYPIS---EYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVK--MVDW---KNVMSENHSNEFVNAFYYNWTHNPNNW----------------IRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
             + I E K    + +   +D  +  +P  +L AG  L     G+ P  ++ +PL ++D   +  K+F+V+N   + K I+R+SAT +  +  P++ +RK+A+ +  +  + +      IM TIL NCVF+ ++N    +   EY F  IYT E +I++ +RG  +  +T+LRDP+N +D  +I+++Y+   V      N  NVS+LRT RVLRALKTI+++PGLKTI  ALI+S+K L +V+IL++FC+S FAL  LQ++ G LRNKC++   +D+    N+    +    ++  + N T++  +W                +    ++L CGN S +G C K     IC+   G NPN+GYT+FD F WA LS+F+L+T DYWEN Y L +RA+G   ++F+++V+F GSFYL+NL+LAVV+M+Y
Sbjct:   26 EKRIAEEKAKKPKQEHRDDDDDNGPKPSSDLEAGKSL-PFIYGDIPPGMVSEPLEDLDPYYMNQKTFIVLN---RGKAIFRFSATSALYILTPFNPLRKVAIKVLVHS-YPFPSDLMLIMCTILTNCVFMTMSNPPEWTKNVEYTFTGIYTFESLIKILARGFCLEKFTFLRDPWNWLDFSVIVMAYVTEFV------NLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGHLRNKCLQWPPIDYFPLTNIPPILNGTMNIHDPFGNTTNSTFDWEEYITDKSKNNYHFYKLEGQKDFLLCGNSSDSGQCPK---GYICV-KTGKNPNYGYTSFDTFSWAFLSLFRLMTQDYWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLVNLILAVVAMAY 436          

HSP 3 Score: 268.855 bits (686), Expect = 1.156e-71
Identity = 145/326 (44.48%), Postives = 218/326 (66.87%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQ-PPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFKQMT 5364
            + + ++  F++PTL RV+R+ RIGR+LRLIK AKGIR LLFAL++SLPALFNIG LL L++FIY+I GMS F  +KK  G+DD+ NFETF  S++ LF++TT+ GW+ +L  +     P C+          K    GDCG    GI +  ++I I +L+++NMYIA+ILENF+ A  +    + EDDFEMFY VWE++DP A+Q+I+Y+ LS+F   LD PL I KPN + L++ DLP+V GD++HCLDIL A  K V+G   + +E   ++  ME ++    P++     IT+T++RK+E+++   +QR ++    ++  K+ +
Sbjct: 1634 LADMIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKKESGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSGAPDCDPQMEHPGSSVK----GDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLGEDDFEMFYEVWEKFDPDATQFIEYSKLSNFADALDPPLRIAKPNRVQLIAMDLPMVSGDRIHCLDILFAFTKRVLG---EGDEMDALRLPMEERFMASNPSKASYEPITSTLRRKQEELSVVIIQRCFRKYLLRKTIKKAS 1952          

HSP 4 Score: 207.608 bits (527), Expect = 6.869e-53
Identity = 94/223 (42.15%), Postives = 154/223 (69.06%), Query Frame = 3
Query: 1809 CSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEY-FNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQI--FGDN--IPRWNFDDFWHSMILVFRIICGEWIEPSFDCIR-ANSPLCLLIFI 2459
            C  W+  ++ + + V DPF DL I+ CI +NT+ MA EHYP  K ++D+L   N++FT I+  E   K++AL   Y F  GWNIFD ++V  S+++LG+  V+ LS+ R+FRL RVFKLA+SW T+ +L+ II +++  +GNL++++ +++++FAV+G Q +  +Y   +    +N  +PRW+ +DF+HS ++VFR++CGEWIE  +DC+  A   +CLL+F+
Sbjct:  764 CENWLTVKHIVKLIVMDPFVDLAITICIVLNTLFMAMEHYPMTKEFNDVLSIGNLVFTGIFTAEMVFKLIALDPYYYFQEGWNIFDGIIVSLSLMELGLANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKIAENCELPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQSMCLLVFM 986          

HSP 5 Score: 96.6709 bits (239), Expect = 3.484e-19
Identity = 58/194 (29.90%), Postives = 109/194 (56.19%), Query Frame = 3
Query: 1827 FQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEV-----DALSIFRAFRLF---RVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRI 2384
            +Q  ++ FVT   FD+ I   I +N + M  E     +  ++ L + N++F +++  EC LKI++L   YF +GWNIFDFVVVI SI+ + + ++      + ++FR  RL    R+ +L +  + +R LL  +  ++  + N+ +++ LV++++A+ G  ++          D    +NF+ F +SMI +F+I
Sbjct: 1543 YQGLVFDFVTKQAFDIIIMILICLNMVTMMIETDEQSQDMENNLYWINLVFIILFTGECILKIISLRHYYFTIGWNIFDFVVVILSIVGMFLADMIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKKESGIDD---MFNFETFGNSMICLFQI 1733          

HSP 6 Score: 71.633 bits (174), Expect = 1.416e-11
Identity = 48/192 (25.00%), Postives = 93/192 (48.44%), Query Frame = 3
Query: 1782 QCCIKQNVLC---------SKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASE--HYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIID-----LGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYH 2306
            + C+K+  +C           W  F+   Y  V   +F+ FI F I +++  +A E  +    KT   +L+Y++ +FT I+I+E  LK +A    +YF   W   DF++V  S++      LG  E+ A+   R  R  R  +    ++ MR+++  +   I  + N+ ++ L+   +F+++G   +   Y+
Sbjct: 1200 EGCVKRFPICYVNIEENKGKLWWTFRKTCYTIVEHNWFETFIIFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFVKYFTNAWCWLDFLIVDVSLVSLVANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKYY 1391          

HSP 7 Score: 58.9214 bits (141), Expect = 1.113e-7
Identity = 71/332 (21.39%), Postives = 136/332 (40.96%), Query Frame = 3
Query:  495 WSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDY-----------PISEYVFLAIYTLEMVIRMTSRGVI---INSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVN-VSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNC--SKTNPNSICLPHIGPNPNFG--YTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNI-------------LFYIIVVFFGSFYLINLMLAVV 1394
            W   RK    I  +  F+ FI+  IL++   LA  + Y             ++ VF  I+ LEM+++  + G +    N++ +L   + +VD+ ++ L      V    G + +  + SLRTLR LR L+ ++   G++ + +ALI ++  +  V+++ L     F++  + ++ G                                             Y  C N ++      ++ N  S CL H+  +  +     NFDN G   L++ Q+ T   W    +++  A  S  +             L+++I + FGSF+ +NL + V+
Sbjct: 1221 WWTFRKTCYTIVEHNWFETFIIFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFVKYFTNAWCWLD--FLIVDVSLVSL------VANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAG--------------------------------------------KYYHCVNTTTGEMLLDTQVNNRSDCL-HLNESARWKNVKVNFDNVGAGYLALLQVATFKGW---MDIMYAAVDSRKVEEQPRYEDNLYMYLYFVIFIIFGSFFTLNLFIGVI 1496          

HSP 8 Score: 56.6102 bits (135), Expect = 5.192e-7
Identity = 51/214 (23.83%), Postives = 102/214 (47.66%), Query Frame = 3
Query:  459 YSATKSFLL---CAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPISE----------YVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAF 1061
            Y    +FL+   C  W  ++ +  LI  +   D  I + I++N +F+A+ + YP+++           VF  I+T EMV ++    + ++ Y Y ++ +N+ D +I+ LS + + +    G     +S LR+ R+LR  K     P L  +   +  S+  L  + ++    +  FA+  +Q++ G    +CV  +     +   H N+F ++F
Sbjct:  752 YKFANTFLIWDCCENWLTVKHIVKLIVMDPFVDLAITICIVLNTLFMAMEH-YPMTKEFNDVLSIGNLVFTGIFTAEMVFKL----IALDPYYYFQEGWNIFDGIIVSLSLMELGLANVEG-----LSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLF-GKSYKECVCKIAENCELPRWHMNDFFHSF 954          
BLAST of Sodium channel protein vs. Ensembl Xenopus
Match: ENSXETT00000052025.1 (sodium channel, voltage gated, type I alpha subunit [Source:NCBI gene;Acc:100488621])

HSP 1 Score: 384.415 bits (986), Expect = 7.987e-108
Identity = 218/446 (48.88%), Postives = 286/446 (64.13%), Query Frame = 3
Query: 2934 IDEESVNELKGCCCAICYNPFQEKKPFHCCYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHT--WANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            I+ E   E   C    C       K F  CY    +IE   G  W  FR     I EH  FE  I+  IL SS  L FEDIY++   T+K  L   + +FTY+F +EM+LK ++ GF  YFT+ W  LDF IV +SL+SL+ + LG+ +E+ A +SLRT+RALRPLRA+SR++GM++VVNALI AIPSI NVLLVC++FWLIFSI GV  F GK++ C+++ T E L  T V N+S+CL  N +  W N  +NFDN   G+LAL Q+ATF+GWM+IM  A+DS  +  QP+ E+ +  Y YFVIFI+ GSFF LNLFIGVIIDNFN+ K K      D+F+T  Q+ YYN MKKL ++KP+K + RP    QG  +D      F+++I+ILI LNMV MMIE   Q+    N L  IN++F  +FT E I+KI  LR +YF   WN
Sbjct: 1068 IESEEALEPDACFTEGCV------KRFPICYV---NIEENKGKLWWTFRKTCYTIVEHNWFETFIIFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFVKYFTNAWCWLDFLIVDVSLVSLVANALGY-SELGAIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKYYHCVNTTTGEMLLDTQVNNRSDCLHLNESARWKNVKVNFDNVGAGYLALLQVATFKGWMDIMYAAVDSRKVEEQPRYEDNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKISQ---DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPPNKYQGLVFDFVTKQAFDIIIMILICLNMVTMMIETDEQSQDMENNLYWINLVFIILFTGECILKIISLRHYYFTIGWN 1500          

HSP 2 Score: 270.011 bits (689), Expect = 4.306e-72
Identity = 158/405 (39.01%), Postives = 248/405 (61.23%), Query Frame = 3
Query:  219 HRHIDEGKLVDGELKFEVEDFSDNCQPDPELVAGSILLEDKLGEFPEELLGKPLNEIDQN-LKDKSFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQIFDY-----FIMLTILVNCVFLALNNDYPIS---EYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
             + I E K    + +   +D  +  +P  +L AG  L     G+ P  ++ +PL ++D   +  K+F+V+N   + K I+R+SAT +  +  P++ +RK+A+ +  +  + +      IM TIL NCVF+ ++N    +   EY F  IYT E +I++ +RG  +  +T+LRDP+N +D  +I+++Y+   V+        NVS+LRT RVLRALKTI+++PGLKTI  ALI+S+K L +V+IL++FC+S FAL  LQ++ G LRNKC+                F + F++  T +    +    ++L CGN S +G C K     IC+   G NPN+GYT+FD F WA LS+F+L+T DYWEN Y L +RA+G   ++F+++V+F GSFYL+NL+LAVV+M+Y
Sbjct:   26 EKRIAEEKAKKPKQEHRDDDDDNGPKPSSDLEAGKSL-PFIYGDIPPGMVSEPLEDLDPYYMNQKTFIVLN---RGKAIFRFSATSALYILTPFNPLRKVAIKVLVHS-YPFPSDLMLIMCTILTNCVFMTMSNPPEWTKNVEYTFTGIYTFESLIKILARGFCLEKFTFLRDPWNWLDFSVIVMAYVTEFVDLG------NVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGHLRNKCL----------------FCSQFFFLSTDHFYK-LEGQKDFLLCGNSSDSGQCPK---GYICV-KTGKNPNYGYTSFDTFSWAFLSLFRLMTQDYWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLVNLILAVVAMAY 398          

HSP 3 Score: 269.24 bits (687), Expect = 8.386e-72
Identity = 145/326 (44.48%), Postives = 218/326 (66.87%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQ-PPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFKQMT 5364
            + + ++  F++PTL RV+R+ RIGR+LRLIK AKGIR LLFAL++SLPALFNIG LL L++FIY+I GMS F  +KK  G+DD+ NFETF  S++ LF++TT+ GW+ +L  +     P C+          K    GDCG    GI +  ++I I +L+++NMYIA+ILENF+ A  +    + EDDFEMFY VWE++DP A+Q+I+Y+ LS+F   LD PL I KPN + L++ DLP+V GD++HCLDIL A  K V+G   + +E   ++  ME ++    P++     IT+T++RK+E+++   +QR ++    ++  K+ +
Sbjct: 1516 LADMIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKKESGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSGAPDCDPQMEHPGSSVK----GDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLGEDDFEMFYEVWEKFDPDATQFIEYSKLSNFADALDPPLRIAKPNRVQLIAMDLPMVSGDRIHCLDILFAFTKRVLG---EGDEMDALRLPMEERFMASNPSKASYEPITSTLRRKQEELSVVIIQRCFRKYLLRKTIKKAS 1834          

HSP 4 Score: 206.838 bits (525), Expect = 9.838e-53
Identity = 94/223 (42.15%), Postives = 154/223 (69.06%), Query Frame = 3
Query: 1809 CSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEY-FNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQI--FGDN--IPRWNFDDFWHSMILVFRIICGEWIEPSFDCIR-ANSPLCLLIFI 2459
            C  W+  ++ + + V DPF DL I+ CI +NT+ MA EHYP  K ++D+L   N++FT I+  E   K++AL   Y F  GWNIFD ++V  S+++LG+  V+ LS+ R+FRL RVFKLA+SW T+ +L+ II +++  +GNL++++ +++++FAV+G Q +  +Y   +    +N  +PRW+ +DF+HS ++VFR++CGEWIE  +DC+  A   +CLL+F+
Sbjct:  646 CENWLTVKHIVKLIVMDPFVDLAITICIVLNTLFMAMEHYPMTKEFNDVLSIGNLVFTGIFTAEMVFKLIALDPYYYFQEGWNIFDGIIVSLSLMELGLANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKIAENCELPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQSMCLLVFM 868          

HSP 5 Score: 96.6709 bits (239), Expect = 3.988e-19
Identity = 58/194 (29.90%), Postives = 109/194 (56.19%), Query Frame = 3
Query: 1827 FQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEV-----DALSIFRAFRLF---RVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRI 2384
            +Q  ++ FVT   FD+ I   I +N + M  E     +  ++ L + N++F +++  EC LKI++L   YF +GWNIFDFVVVI SI+ + + ++      + ++FR  RL    R+ +L +  + +R LL  +  ++  + N+ +++ LV++++A+ G  ++          D    +NF+ F +SMI +F+I
Sbjct: 1425 YQGLVFDFVTKQAFDIIIMILICLNMVTMMIETDEQSQDMENNLYWINLVFIILFTGECILKIISLRHYYFTIGWNIFDFVVVILSIVGMFLADMIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKKESGIDD---MFNFETFGNSMICLFQI 1615          

HSP 6 Score: 71.2478 bits (173), Expect = 1.803e-11
Identity = 48/192 (25.00%), Postives = 93/192 (48.44%), Query Frame = 3
Query: 1782 QCCIKQNVLC---------SKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASE--HYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIID-----LGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYH 2306
            + C+K+  +C           W  F+   Y  V   +F+ FI F I +++  +A E  +    KT   +L+Y++ +FT I+I+E  LK +A    +YF   W   DF++V  S++      LG  E+ A+   R  R  R  +    ++ MR+++  +   I  + N+ ++ L+   +F+++G   +   Y+
Sbjct: 1082 EGCVKRFPICYVNIEENKGKLWWTFRKTCYTIVEHNWFETFIIFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFVKYFTNAWCWLDFLIVDVSLVSLVANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKYY 1273          

HSP 7 Score: 66.2402 bits (160), Expect = 7.320e-10
Identity = 61/250 (24.40%), Postives = 117/250 (46.80%), Query Frame = 3
Query: 3219 INYIFTYLFCIEMILKIISLGFKVYFTSF----WTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGK-----------FFKCLD-----SNTRERLAATVVPNKSECLRQN---HTWANSN---INFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVI 3890
            + Y FT ++  E ++KI++ GF +   +F    W  LDF ++ ++ ++          ++    +LRT R LR L+ IS   G+K +V ALI ++  + +V+++ +    +F++ G+Q F G            FF   D        ++ L      +  +C +      T  N N    +FD  +  FL+L+++ T + W  + Q  + + G            Y  +FV+ I +GSF+++NL + V+
Sbjct:  162 VEYTFTGIYTFESLIKILARGFCLEKFTFLRDPWNWLDFSVIVMAYVTEF-------VDLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGHLRNKCLFCSQFFFLSTDHFYKLEGQKDFLLCGNSSDSGQCPKGYICVKTGKNPNYGYTSFDTFSWAFLSLFRLMTQDYWENLYQLTLRAAG----------KTYMIFFVLVIFLGSFYLVNLILAVV 394          

HSP 8 Score: 58.9214 bits (141), Expect = 1.181e-7
Identity = 71/332 (21.39%), Postives = 136/332 (40.96%), Query Frame = 3
Query:  495 WSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDY-----------PISEYVFLAIYTLEMVIRMTSRGVI---INSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVN-VSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNC--SKTNPNSICLPHIGPNPNFG--YTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNI-------------LFYIIVVFFGSFYLINLMLAVV 1394
            W   RK    I  +  F+ FI+  IL++   LA  + Y             ++ VF  I+ LEM+++  + G +    N++ +L   + +VD+ ++ L      V    G + +  + SLRTLR LR L+ ++   G++ + +ALI ++  +  V+++ L     F++  + ++ G                                             Y  C N ++      ++ N  S CL H+  +  +     NFDN G   L++ Q+ T   W    +++  A  S  +             L+++I + FGSF+ +NL + V+
Sbjct: 1103 WWTFRKTCYTIVEHNWFETFIIFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFVKYFTNAWCWLD--FLIVDVSLVSL------VANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAG--------------------------------------------KYYHCVNTTTGEMLLDTQVNNRSDCL-HLNESARWKNVKVNFDNVGAGYLALLQVATFKGW---MDIMYAAVDSRKVEEQPRYEDNLYMYLYFVIFIIFGSFFTLNLFIGVI 1378          

HSP 9 Score: 56.6102 bits (135), Expect = 5.699e-7
Identity = 51/214 (23.83%), Postives = 102/214 (47.66%), Query Frame = 3
Query:  459 YSATKSFLL---CAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPISE----------YVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAF 1061
            Y    +FL+   C  W  ++ +  LI  +   D  I + I++N +F+A+ + YP+++           VF  I+T EMV ++    + ++ Y Y ++ +N+ D +I+ LS + + +    G     +S LR+ R+LR  K     P L  +   +  S+  L  + ++    +  FA+  +Q++ G    +CV  +     +   H N+F ++F
Sbjct:  634 YKFANTFLIWDCCENWLTVKHIVKLIVMDPFVDLAITICIVLNTLFMAMEH-YPMTKEFNDVLSIGNLVFTGIFTAEMVFKL----IALDPYYYFQEGWNIFDGIIVSLSLMELGLANVEG-----LSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLF-GKSYKECVCKIAENCELPRWHMNDFFHSF 836          
BLAST of Sodium channel protein vs. Ensembl Mouse
Match: Scn4a (sodium channel, voltage-gated, type IV, alpha [Source:MGI Symbol;Acc:MGI:98250])

HSP 1 Score: 815.068 bits (2104), Expect = 0.000e+0
Identity = 526/1435 (36.66%), Postives = 804/1435 (56.03%), Query Frame = 3
Query:  219 HRHIDEGKLVDGELKFEVEDFSDNCQPDPELVAGSILLEDKLGEFPEELLGKPLNEIDQNLKDK-SFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPIS---EYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYN---------WTHN-----PNNWIRNGI--------------------NYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHDKDQMKDLKITNGMSDADSSLCKNTTSIHENDDNFRFMDSEEEKEGK-DCDNKAEYEDEVEIGNDTNNTDTAEMNPTIDRNCQCCIKQNVLCSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSK-EYFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHT---QIFGD-NIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIRANSPLCLLIFIPTXXXXXXXXXXXXXXXXXXXXXXXXXKNTADED--VSKLKIVIERLRNIYPMSRNNPLGINKGNQELDSTETLKDIVVNFG-----CENAAELQNNHEKMRIIKNCKDLSTSNELVNLLPSTGSLSKGNKL-----INNAIXXXXXXXXXXGKHLXXXXXXXXXXXXXXID-EESVNELKGCCCAIC-----------------YNPFQEKKPFHC--------CYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHT----WANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
             R ++E   +    + E+E+     +P  +L AG  L     G+ P E++G PL ++D    DK +F+V+N   K K I+R+SAT +  + +P+S +R++A+ +  + +F  FIM+TIL NCVF+ ++N    S   EY F  IYT E +I+M +RG  I+ +T+LRDP+N +D  +I ++Y+   V+        N+S+LRT RVLRALKTIT++PGLKTI  ALI+S+K L +V+IL++FC+S FAL  LQ++ G LR KCV+   W   M++ ++  + N  +Y          W  N       +W+ N                      + L CGN S AG+C    P        G NPN+GYT++D F WA L++F+L+T DYWEN + L +RA+G   ++F+++++F GSFYLINL+LAVV+M+Y E+ EA   E++E++    +  ++ KK                 + ++ K  +   G  +AD          H  D N     S E+   +  C  ++   D +E        +  +  P     C   +     C+ WV F++ + + V DPF DL I+ CI +NT+ MA EHYP  + +D++L   N++FT I+  E  LK++A+   EYF  GWNIFD  +V  S+++LG+  V  LS+ R+FRL RVFKLA+SW T+ +L+ II +++  +GNL++++ +++++FAV+G Q +  +Y     +I  D ++PRW+  DF+HS ++VFRI+CGEWIE  +DC+        L     +++   +V+      LL S  S      +DED  ++ L+I I R++     ++   LG+  G        +LKDI+++ G      EN      + +K    ++       N ++N +  T       ++     INN           +   L    + + +  +E  D ++ +  L     ++C                  NP + + P  C        C C+  DI    G  W   R     I EH  FE  I+  IL SS  L FEDIY++    ++  L   + +FTY+F +EM+LK ++ GFKVYFT+ W  LDF IV +S++SL+ + LG+ +E+   +SLRT+RALRPLRA+SR++GM++VVNAL+ AIPSI NVLLVC++FWLIFSI GV  F GKF+ C+++ T ER   +VV NKSEC    +T    W N  +N+DN   G+L+L Q+ATF+GWM+IM  A+DS     QP  E  +  Y YFVIFI+ GSFF LNLFIGVIIDNFN+ K K+ G   D+F+T  Q+ YYN MKKL ++KP+K + RP+  +QG  YD      F++ I+ILI LNMV MM+E   Q+    ++L  IN++F  +FT E ++K+  LR +YF   WN
Sbjct:   30 QRAMEEEARLQRNKQMEIEE--PERKPRSDLEAGKNL-PLIYGDPPPEVIGVPLEDLDPYYSDKKTFIVLN---KGKAIFRFSATPALYMLSPFSIVRRVAIKVLIHALFSMFIMITILTNCVFMTMSNPPSWSKDVEYTFTGIYTFESLIKMLARGFCIDDFTFLRDPWNWLDFSVITMAYVTEFVDLG------NISALRTFRVLRALKTITVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALVGLQLFMGNLRQKCVR---WPPPMNDTNTTWYGNDTWYGNDTWYGNDTWYGNDTWNSQESWVSNSTFDWEAYINDEGNFYFLEGSNDALLCGNSSDAGHC----PEGYECMKAGRNPNYGYTSYDTFSWAFLALFRLMTQDYWENLFQLTLRAAGKTYMIFFVVIIFLGSFYLINLILAVVAMAYAEQNEATLAEDQEKEEEFQQMLEKFKKHQ--------------EELEKAKAAQALEGGEEADGD------PTHSKDCNGSLDTSGEKGPPRPSCSAESAISDAME-----ELEEAHQKCPPWWYKCAHKVLIWNCCAPWVKFKHIILLIVMDPFVDLGITICIVLNTLFMAMEHYPMTEHFDNVLSVGNLVFTGIFTAEMVLKLIAMDPYEYFQQGWNIFDSFIVTLSLVELGLANVQGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKIASDCSLPRWHMHDFFHSFLIVFRILCGEWIETMWDCMEVAGQAMCLTVFLMVMVIGNLVVLNLFLALLLSSFSADSLAASDEDGEMNNLQIAIGRIKWGIAFAKTFLLGLLHGK-----ILSLKDIMLSLGEPGGAGENGESPPEDEKKEPPPEDGNKELKDNHILNHVGLTDGPRSSIEMDHLNFINNPYLTIHVPIASEESDLEMPTEEETDTFSEPEDIKKPLQPLYDGNSSVCSTADYKPPEEDPEEQAEENP-EGELPEECFTEACVKRCPCLYVDISQGRGKMWWTLRRACFKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRRVIQTILEYADKVFTYIFILEMLLKWVAYGFKVYFTNAWCWLDFLIVDVSIISLVANWLGY-SELGPIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYYCINTTTSERFDISVVNNKSECESLMYTGQVRWMNVKVNYDNVGLGYLSLLQVATFKGWMDIMYAAVDSREKEEQPDYEVNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGK--DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPQNKIQGMVYDFVTKQVFDISIMILICLNMVTMMVETDDQSQLKVDILYNINMVFIIVFTGECVLKMFALRHYYFTIGWN 1411          

HSP 2 Score: 298.516 bits (763), Expect = 5.657e-81
Identity = 171/335 (51.04%), Postives = 226/335 (67.46%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQ-PPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFKQMTENATLSSRH 5391
            + + ++  F++PTL RV+R+ RIGRVLRLI+ AKGIR LLFAL++SLPALFNIG LL L++FIYSI GMS F  +KK  G+DD+ NFETF  SI+ LF +TT+ GW+ +L  +    PP C+ T        K    GDCG    GI +  ++I I +LI++NMYIAIILENFN A  +    + EDDFEMFY  WE++DP A+Q+I Y+ LSDFV  L EPL I KPN I L++ DLP+V GDK+HCLDIL AL K V+G   DS E   +K+ ME K+    P++V    ITTT+KRK+E++ A  +QRA++    QR+ KQ    A+   RH
Sbjct: 1427 LSDLIQKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYSIFGMSNFAYVKKESGIDDMFNFETFGNSIICLFEITTSAGWDGLLNPILNSGPPDCDPTLENPGTNIK----GDCGNPSIGICFFCSYIIISFLIVVNMYIAIILENFNVATEESSEPLCEDDFEMFYETWEKFDPDATQFIDYSRLSDFVDTLQEPLKIAKPNKIKLITLDLPMVPGDKIHCLDILFALTKEVLG---DSGEMDALKQTMEEKFMAANPSKVSYEPITTTLKRKQEEVCAIKIQRAYRRHLLQRSVKQ----ASYMYRH 1750          

HSP 3 Score: 97.4413 bits (241), Expect = 1.700e-19
Identity = 61/193 (31.61%), Postives = 105/193 (54.40%), Query Frame = 3
Query: 1830 QNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEV-----DALSIFRAFRLF---RVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRI 2384
            Q  +Y FVT   FD+ I   I +N + M  E     +   DIL   N++F +++  EC LK+ AL   YF +GWNIFDFVVVI SI+ L + ++      + ++FR  RL    RV +L +  + +R LL  +  ++  + N+ +++ LV++++++ G  ++          D    +NF+ F +S+I +F I
Sbjct: 1337 QGMVYDFVTKQVFDISIMILICLNMVTMMVETDDQSQLKVDILYNINMVFIIVFTGECVLKMFALRHYYFTIGWNIFDFVVVILSIVGLALSDLIQKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYSIFGMSNFAYVKKESGIDD---MFNFETFGNSIICLFEI 1526          
BLAST of Sodium channel protein vs. Ensembl Mouse
Match: Scn2a (sodium channel, voltage-gated, type II, alpha [Source:MGI Symbol;Acc:MGI:98248])

HSP 1 Score: 385.571 bits (989), Expect = 4.350e-108
Identity = 217/447 (48.55%), Postives = 289/447 (64.65%), Query Frame = 3
Query: 2940 EESVNELKGCCCAICYNPFQEKKPFHCCYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSEC---LRQNHT--WANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            EES+ E + C    C       + F CC      IE   G  W   R     I EH  FE  I+  IL SS  L FEDIY++   T+K  L   + +FTY+F +EM+LK ++ GF++YFT+ W  LDF IV +SL+SL  + LG+ +E+ A +SLRT+RALRPLRA+SR++GM++VVNAL+ AIPSI NVLLVC++FWLIFSI GV  F GKF+ C++  T E    +VV N SEC   +  N T  W N  +NFDN   G+L+L Q+ATF+GWM+IM  A+DS  + LQPK E+ +  Y YFVIFI+ GSFF LNLFIGVIIDNFN+ K K+ G   D+F+T  Q+ YYN MKKL ++KP+K + RP    QG  +D      F++ I+ILI LNMV MM+E   Q+   TN+L  IN++F  +FT E ++K+  LR +YF   WN
Sbjct: 1163 EESL-EPEACFTEDCV------RKFKCCQI---SIEEGKGKLWWNLRKTCYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQMYFTNAWCWLDFLIVDVSLVSLTANALGY-SELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCINYTTGEMFDVSVVNNYSECQALIESNQTARWKNVKVNFDNVGLGYLSLLQVATFKGWMDIMYAAVDSRNVELQPKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQ--DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPANKFQGMVFDFVTKQVFDISIMILICLNMVTMMVETDDQSQEMTNILYWINLVFIVLFTGECVLKLISLRHYYFTIGWN 1596          

HSP 2 Score: 288.5 bits (737), Expect = 6.780e-78
Identity = 170/417 (40.77%), Postives = 255/417 (61.15%), Query Frame = 3
Query:  219 HRHIDEGKLVDGELKFEVEDFSDNCQPDPELVAGSILLEDKLGEFPEELLGKPLNEIDQN-LKDKSFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPIS---EYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAF-----YYNWTHNPNNW------------IRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
             + I E K    + + + ED  +  +P+ +L AG  L     G+ P E++ +PL ++D   +  K+F+V+N   K K I R+SAT +  +  P++ IRKLA+ I  + +F+  IM TIL NCVF+ ++N    +   EY F  IYT E +I++ +RG  +  +T+LRDP+N +D  +I  +Y+   V+        NVS+LRT RVLRALKTI+++PGLKTI  ALI+S+K L +V+IL++FC+S FAL  LQ++ G LRNKC++     +    N ++ F N+       +N T N  NW            +    + L CGN S AG C +     IC+   G NPN+GYT+FD F WA LS+F+L+T D+WEN Y L +RA+G   ++F+++V+F GSFYLINL+LAVV+M+Y
Sbjct:   26 EQRIAEEKAKRPKQERKDEDDENGPKPNSDLEAGKSL-PFIYGDIPPEMVSEPLEDLDPYYINKKTFIVLN---KGKAISRFSATSALYILTPFNPIRKLAIKILVHSLFNVLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKILARGFCLEDFTFLRDPWNWLDFTVITFAYVTEFVDLG------NVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPDNSTFEINITSFFNNSLDWNGTAFNRTMNMFNWDEYIEDKSHFYFLEGQNDALLCGNSSDAGQCPE---GYICV-KAGRNPNYGYTSFDTFSWAFLSLFRLMTQDFWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLINLILAVVAMAY 428          

HSP 3 Score: 285.419 bits (729), Expect = 6.753e-77
Identity = 154/326 (47.24%), Postives = 228/326 (69.94%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQ-PPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFKQMT 5364
            + E ++  F++PTL RV+R+ RIGR+LRLIK AKGIR LLFAL++SLPALFNIG LL L++FIY+I GMS F  +K+  G+DD+ NFETF  S++ LF++TT+ GW+ +L  +    PP C+     +D    ++  GDCG    GI +  ++I I +L+++NMYIA+ILENF+ A  +    ++EDDFEMFY VWE++DP A+Q+I++  LSDF A LD PL I KPN + L++ DLP+V GD++HCLDIL A  K V+G   +S E   ++ QME ++    P++V    ITTT+KRK+E+++A  +QRA++    ++  K+++
Sbjct: 1612 LAELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKREVGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSGPPDCDPE---KDHPGSSV-KGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYEVWEKFDPDATQFIEFCKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLG---ESGEMDALRIQMEERFMASNPSKVSYEPITTTLKRKQEEVSAIVIQRAYRRYLLKQKVKKVS 1930          

HSP 4 Score: 200.29 bits (508), Expect = 7.410e-51
Identity = 93/223 (41.70%), Postives = 150/223 (67.26%), Query Frame = 3
Query: 1809 CSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEY-FNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHT---QIFGD-NIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIR-ANSPLCLLIFI 2459
            C  W+  ++ + + V DPF DL I+ CI +NT+ MA EHYP  + +  +L   N++FT I+  E  LKI+A+   Y F  GWNIFD  +V  S+++LG+  V+ LS+ R+FRL RVFKLA+SW T+ +L+ II +++  +GNL++++ +++++FAV+G Q +  +Y     +I  D  +PRW+  DF+HS ++VFR++CGEWIE  +DC+  A   +CL +F+
Sbjct:  743 CKPWLKVKHVVNLVVMDPFVDLAITICIVLNTLFMAMEHYPMTEQFSSVLSVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVSLSLMELGLANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKISNDCELPRWHMHDFFHSFLIVFRVLCGEWIETMWDCMEVAGQTMCLTVFM 965          

HSP 5 Score: 100.523 bits (249), Expect = 1.776e-20
Identity = 63/195 (32.31%), Postives = 114/195 (58.46%), Query Frame = 3
Query: 1827 FQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEV-----DALSIFRAFRLF---RVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFG-DNIPRWNFDDFWHSMILVFRI 2384
            FQ  ++ FVT   FD+ I   I +N + M  E     +   +IL + N++F V++  EC LK+++L   YF +GWNIFDFVVVI SI+ + + E+      + ++FR  RL    R+ +L +  + +R LL  +  ++  + N+ +++ LV++++A+ G  ++   Y  +  G D++  +NF+ F +SMI +F+I
Sbjct: 1521 FQGMVFDFVTKQVFDISIMILICLNMVTMMVETDDQSQEMTNILYWINLVFIVLFTGECVLKLISLRHYYFTIGWNIFDFVVVILSIVGMFLAELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNF--AYVKREVGIDDM--FNFETFGNSMICLFQI 1711          

HSP 6 Score: 69.3218 bits (168), Expect = 5.296e-11
Identity = 56/240 (23.33%), Postives = 108/240 (45.00%), Query Frame = 3
Query: 1653 DSEEEKEGKDCDNKAEYEDEVEIGNDTNNTDTAEMNPTIDRNCQCCIKQNVL----CSK----------WVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASE--HYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIID-----LGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYH 2306
            D EE KE  +  + +E    V+IG      +  E  P      + C  ++ +    C +          W   +   Y  V   +F+ FI F I +++  +A E  +    KT   +L+Y++ +FT I+I+E  LK +A   + YF   W   DF++V  S++      LG  E+ A+   R  R  R  +    ++ MR+++  +   I  + N+ ++ L+   +F+++G   +   ++
Sbjct: 1128 DMEESKEKLNATSSSE-GSTVDIGAPAEG-EQPEAEPEESLEPEACFTEDCVRKFKCCQISIEEGKGKLWWNLRKTCYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQMYFTNAWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFY 1365          

HSP 7 Score: 62.003 bits (149), Expect = 1.045e-8
Identity = 77/328 (23.48%), Postives = 134/328 (40.85%), Query Frame = 3
Query:  495 WSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDY-----------PISEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGY----TNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNI-------------LFYIIVVFFGSFYLINLMLAVV 1394
            W  +RK    I  +  F+ FI+  IL++   LA  + Y             ++ VF  I+ LEM+++  + G  +    Y  + +  +D LI+ +S + +            + SLRTLR LR L+ ++   G++ + +AL+ ++  +  V+   L C+ F+ +F++                          N F   FY+             INY T        + S  N  S C   I  N    +     NFDN G   LS+ Q+ T   W    +++  A  S N+             L+++I + FGSF+ +NL + V+
Sbjct: 1195 WWNLRKTCYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQM----YFTNAWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVL---LVCLIFWLIFSIM-----------------------GVNLFAGKFYH------------CINYTT----GEMFDVSVVNNYSECQALIESNQTARWKNVKVNFDNVGLGYLSLLQVATFKGW---MDIMYAAVDSRNVELQPKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVI 1473          

HSP 8 Score: 56.9954 bits (136), Expect = 3.129e-7
Identity = 47/202 (23.27%), Postives = 97/202 (48.02%), Query Frame = 3
Query:  486 CAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPISE----------YVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAF 1061
            C PW  ++ +  L+  +   D  I + I++N +F+A+ + YP++E           VF  I+T EM +++    + ++ Y Y ++ +N+ D  I+ LS + + +    G     +S LR+ R+LR  K     P L  +   +  S+  L  + ++    +  FA+  +Q++ G    +CV  +     +   H ++F ++F
Sbjct:  743 CKPWLKVKHVVNLVVMDPFVDLAITICIVLNTLFMAMEH-YPMTEQFSSVLSVGNLVFTGIFTAEMFLKI----IAMDPYYYFQEGWNIFDGFIVSLSLMELGLANVEG-----LSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLF-GKSYKECVCKISNDCELPRWHMHDFFHSF 933          

HSP 9 Score: 52.373 bits (124), Expect = 7.338e-6
Identity = 48/188 (25.53%), Postives = 87/188 (46.28%), Query Frame = 3
Query: 3027 CIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCL 3590
            C++ D    C   W   ++   L+      +  I +CI+ +++ +  E   +         L V N +FT +F  EM LKII++    YF   W I D FIVS+SL+ L          +     LR+ R LR  +    W  + +++  +  ++ ++ N+ LV  +   IF++ G+Q F   + +C+
Sbjct:  737 CLIWD----CCKPWLKVKHVVNLVVMDPFVDLAITICIVLNTLFMAMEHYPMTEQ--FSSVLSVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVSLSLMELGL------ANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECV 912          

HSP 10 Score: 52.373 bits (124), Expect = 8.186e-6
Identity = 28/70 (40.00%), Postives = 42/70 (60.00%), Query Frame = 3
Query: 4059 VAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGL-RWHYFRYMWN 4265
            V M    +L I I I LN + M +EHY  T  F++VL + N++F+ IFT E  +KI  +  ++YF+  WN
Sbjct:  756 VVMDPFVDLAITICIVLNTLFMAMEHYPMTEQFSSVLSVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWN 825          
BLAST of Sodium channel protein vs. Ensembl Mouse
Match: Scn2a (sodium channel, voltage-gated, type II, alpha [Source:MGI Symbol;Acc:MGI:98248])

HSP 1 Score: 385.571 bits (989), Expect = 4.389e-108
Identity = 217/447 (48.55%), Postives = 289/447 (64.65%), Query Frame = 3
Query: 2940 EESVNELKGCCCAICYNPFQEKKPFHCCYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSEC---LRQNHT--WANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            EES+ E + C    C       + F CC      IE   G  W   R     I EH  FE  I+  IL SS  L FEDIY++   T+K  L   + +FTY+F +EM+LK ++ GF++YFT+ W  LDF IV +SL+SL  + LG+ +E+ A +SLRT+RALRPLRA+SR++GM++VVNAL+ AIPSI NVLLVC++FWLIFSI GV  F GKF+ C++  T E    +VV N SEC   +  N T  W N  +NFDN   G+L+L Q+ATF+GWM+IM  A+DS  + LQPK E+ +  Y YFVIFI+ GSFF LNLFIGVIIDNFN+ K K+ G   D+F+T  Q+ YYN MKKL ++KP+K + RP    QG  +D      F++ I+ILI LNMV MM+E   Q+   TN+L  IN++F  +FT E ++K+  LR +YF   WN
Sbjct: 1163 EESL-EPEACFTEDCV------RKFKCCQI---SIEEGKGKLWWNLRKTCYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQMYFTNAWCWLDFLIVDVSLVSLTANALGY-SELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCINYTTGEMFDVSVVNNYSECQALIESNQTARWKNVKVNFDNVGLGYLSLLQVATFKGWMDIMYAAVDSRNVELQPKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQ--DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPANKFQGMVFDFVTKQVFDISIMILICLNMVTMMVETDDQSQEMTNILYWINLVFIVLFTGECVLKLISLRHYYFTIGWN 1596          

HSP 2 Score: 289.271 bits (739), Expect = 4.096e-78
Identity = 171/417 (41.01%), Postives = 255/417 (61.15%), Query Frame = 3
Query:  219 HRHIDEGKLVDGELKFEVEDFSDNCQPDPELVAGSILLEDKLGEFPEELLGKPLNEIDQN-LKDKSFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPIS---EYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAF-----YYNWTHNPNNW------------IRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
             + I E K    + + + ED  +  +P+ +L AG  L     G+ P E++ +PL ++D   +  K+F+V+N   K K I R+SAT +  +  P++ IRKLA+ I  + +F+  IM TIL NCVF+ ++N    +   EY F  IYT E +I++ +RG  +  +T+LRDP+N +D  +I  +Y+   V      N  NVS+LRT RVLRALKTI+++PGLKTI  ALI+S+K L +V+IL++FC+S FAL  LQ++ G LRNKC++     +    N ++ F N+       +N T N  NW            +    + L CGN S AG C +     IC+   G NPN+GYT+FD F WA LS+F+L+T D+WEN Y L +RA+G   ++F+++V+F GSFYLINL+LAVV+M+Y
Sbjct:   26 EQRIAEEKAKRPKQERKDEDDENGPKPNSDLEAGKSL-PFIYGDIPPEMVSEPLEDLDPYYINKKTFIVLN---KGKAISRFSATSALYILTPFNPIRKLAIKILVHSLFNVLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKILARGFCLEDFTFLRDPWNWLDFTVITFAYVTEFV------NLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPDNSTFEINITSFFNNSLDWNGTAFNRTMNMFNWDEYIEDKSHFYFLEGQNDALLCGNSSDAGQCPE---GYICV-KAGRNPNYGYTSFDTFSWAFLSLFRLMTQDFWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLINLILAVVAMAY 428          

HSP 3 Score: 285.419 bits (729), Expect = 6.928e-77
Identity = 154/326 (47.24%), Postives = 228/326 (69.94%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQ-PPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFKQMT 5364
            + E ++  F++PTL RV+R+ RIGR+LRLIK AKGIR LLFAL++SLPALFNIG LL L++FIY+I GMS F  +K+  G+DD+ NFETF  S++ LF++TT+ GW+ +L  +    PP C+     +D    ++  GDCG    GI +  ++I I +L+++NMYIA+ILENF+ A  +    ++EDDFEMFY VWE++DP A+Q+I++  LSDF A LD PL I KPN + L++ DLP+V GD++HCLDIL A  K V+G   +S E   ++ QME ++    P++V    ITTT+KRK+E+++A  +QRA++    ++  K+++
Sbjct: 1612 LAELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKREVGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSGPPDCDPE---KDHPGSSV-KGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYEVWEKFDPDATQFIEFCKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLG---ESGEMDALRIQMEERFMASNPSKVSYEPITTTLKRKQEEVSAIVIQRAYRRYLLKQKVKKVS 1930          

HSP 4 Score: 200.29 bits (508), Expect = 7.410e-51
Identity = 93/223 (41.70%), Postives = 150/223 (67.26%), Query Frame = 3
Query: 1809 CSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEY-FNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHT---QIFGD-NIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIR-ANSPLCLLIFI 2459
            C  W+  ++ + + V DPF DL I+ CI +NT+ MA EHYP  + +  +L   N++FT I+  E  LKI+A+   Y F  GWNIFD  +V  S+++LG+  V+ LS+ R+FRL RVFKLA+SW T+ +L+ II +++  +GNL++++ +++++FAV+G Q +  +Y     +I  D  +PRW+  DF+HS ++VFR++CGEWIE  +DC+  A   +CL +F+
Sbjct:  743 CKPWLKVKHVVNLVVMDPFVDLAITICIVLNTLFMAMEHYPMTEQFSSVLSVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVSLSLMELGLANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKISNDCELPRWHMHDFFHSFLIVFRVLCGEWIETMWDCMEVAGQTMCLTVFM 965          

HSP 5 Score: 100.523 bits (249), Expect = 1.718e-20
Identity = 63/195 (32.31%), Postives = 114/195 (58.46%), Query Frame = 3
Query: 1827 FQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEV-----DALSIFRAFRLF---RVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFG-DNIPRWNFDDFWHSMILVFRI 2384
            FQ  ++ FVT   FD+ I   I +N + M  E     +   +IL + N++F V++  EC LK+++L   YF +GWNIFDFVVVI SI+ + + E+      + ++FR  RL    R+ +L +  + +R LL  +  ++  + N+ +++ LV++++A+ G  ++   Y  +  G D++  +NF+ F +SMI +F+I
Sbjct: 1521 FQGMVFDFVTKQVFDISIMILICLNMVTMMVETDDQSQEMTNILYWINLVFIVLFTGECVLKLISLRHYYFTIGWNIFDFVVVILSIVGMFLAELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNF--AYVKREVGIDDM--FNFETFGNSMICLFQI 1711          

HSP 6 Score: 69.3218 bits (168), Expect = 5.477e-11
Identity = 56/240 (23.33%), Postives = 108/240 (45.00%), Query Frame = 3
Query: 1653 DSEEEKEGKDCDNKAEYEDEVEIGNDTNNTDTAEMNPTIDRNCQCCIKQNVL----CSK----------WVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASE--HYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIID-----LGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYH 2306
            D EE KE  +  + +E    V+IG      +  E  P      + C  ++ +    C +          W   +   Y  V   +F+ FI F I +++  +A E  +    KT   +L+Y++ +FT I+I+E  LK +A   + YF   W   DF++V  S++      LG  E+ A+   R  R  R  +    ++ MR+++  +   I  + N+ ++ L+   +F+++G   +   ++
Sbjct: 1128 DMEESKEKLNATSSSE-GSTVDIGAPAEG-EQPEAEPEESLEPEACFTEDCVRKFKCCQISIEEGKGKLWWNLRKTCYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQMYFTNAWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFY 1365          

HSP 7 Score: 62.003 bits (149), Expect = 1.054e-8
Identity = 77/328 (23.48%), Postives = 134/328 (40.85%), Query Frame = 3
Query:  495 WSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDY-----------PISEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGY----TNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNI-------------LFYIIVVFFGSFYLINLMLAVV 1394
            W  +RK    I  +  F+ FI+  IL++   LA  + Y             ++ VF  I+ LEM+++  + G  +    Y  + +  +D LI+ +S + +            + SLRTLR LR L+ ++   G++ + +AL+ ++  +  V+   L C+ F+ +F++                          N F   FY+             INY T        + S  N  S C   I  N    +     NFDN G   LS+ Q+ T   W    +++  A  S N+             L+++I + FGSF+ +NL + V+
Sbjct: 1195 WWNLRKTCYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQM----YFTNAWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVL---LVCLIFWLIFSIM-----------------------GVNLFAGKFYH------------CINYTT----GEMFDVSVVNNYSECQALIESNQTARWKNVKVNFDNVGLGYLSLLQVATFKGW---MDIMYAAVDSRNVELQPKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVI 1473          

HSP 8 Score: 56.9954 bits (136), Expect = 3.129e-7
Identity = 47/202 (23.27%), Postives = 97/202 (48.02%), Query Frame = 3
Query:  486 CAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPISE----------YVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAF 1061
            C PW  ++ +  L+  +   D  I + I++N +F+A+ + YP++E           VF  I+T EM +++    + ++ Y Y ++ +N+ D  I+ LS + + +    G     +S LR+ R+LR  K     P L  +   +  S+  L  + ++    +  FA+  +Q++ G    +CV  +     +   H ++F ++F
Sbjct:  743 CKPWLKVKHVVNLVVMDPFVDLAITICIVLNTLFMAMEH-YPMTEQFSSVLSVGNLVFTGIFTAEMFLKI----IAMDPYYYFQEGWNIFDGFIVSLSLMELGLANVEG-----LSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLF-GKSYKECVCKISNDCELPRWHMHDFFHSF 933          

HSP 9 Score: 52.373 bits (124), Expect = 7.400e-6
Identity = 48/188 (25.53%), Postives = 87/188 (46.28%), Query Frame = 3
Query: 3027 CIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCL 3590
            C++ D    C   W   ++   L+      +  I +CI+ +++ +  E   +         L V N +FT +F  EM LKII++    YF   W I D FIVS+SL+ L          +     LR+ R LR  +    W  + +++  +  ++ ++ N+ LV  +   IF++ G+Q F   + +C+
Sbjct:  737 CLIWD----CCKPWLKVKHVVNLVVMDPFVDLAITICIVLNTLFMAMEHYPMTEQ--FSSVLSVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVSLSLMELGL------ANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECV 912          

HSP 10 Score: 52.373 bits (124), Expect = 8.325e-6
Identity = 28/70 (40.00%), Postives = 42/70 (60.00%), Query Frame = 3
Query: 4059 VAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGL-RWHYFRYMWN 4265
            V M    +L I I I LN + M +EHY  T  F++VL + N++F+ IFT E  +KI  +  ++YF+  WN
Sbjct:  756 VVMDPFVDLAITICIVLNTLFMAMEHYPMTEQFSSVLSVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWN 825          
BLAST of Sodium channel protein vs. Ensembl Mouse
Match: Scn2a (sodium channel, voltage-gated, type II, alpha [Source:MGI Symbol;Acc:MGI:98248])

HSP 1 Score: 385.571 bits (989), Expect = 4.389e-108
Identity = 217/447 (48.55%), Postives = 289/447 (64.65%), Query Frame = 3
Query: 2940 EESVNELKGCCCAICYNPFQEKKPFHCCYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSEC---LRQNHT--WANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            EES+ E + C    C       + F CC      IE   G  W   R     I EH  FE  I+  IL SS  L FEDIY++   T+K  L   + +FTY+F +EM+LK ++ GF++YFT+ W  LDF IV +SL+SL  + LG+ +E+ A +SLRT+RALRPLRA+SR++GM++VVNAL+ AIPSI NVLLVC++FWLIFSI GV  F GKF+ C++  T E    +VV N SEC   +  N T  W N  +NFDN   G+L+L Q+ATF+GWM+IM  A+DS  + LQPK E+ +  Y YFVIFI+ GSFF LNLFIGVIIDNFN+ K K+ G   D+F+T  Q+ YYN MKKL ++KP+K + RP    QG  +D      F++ I+ILI LNMV MM+E   Q+   TN+L  IN++F  +FT E ++K+  LR +YF   WN
Sbjct: 1163 EESL-EPEACFTEDCV------RKFKCCQI---SIEEGKGKLWWNLRKTCYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQMYFTNAWCWLDFLIVDVSLVSLTANALGY-SELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCINYTTGEMFDVSVVNNYSECQALIESNQTARWKNVKVNFDNVGLGYLSLLQVATFKGWMDIMYAAVDSRNVELQPKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQ--DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPANKFQGMVFDFVTKQVFDISIMILICLNMVTMMVETDDQSQEMTNILYWINLVFIVLFTGECVLKLISLRHYYFTIGWN 1596          

HSP 2 Score: 289.271 bits (739), Expect = 4.096e-78
Identity = 171/417 (41.01%), Postives = 255/417 (61.15%), Query Frame = 3
Query:  219 HRHIDEGKLVDGELKFEVEDFSDNCQPDPELVAGSILLEDKLGEFPEELLGKPLNEIDQN-LKDKSFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPIS---EYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAF-----YYNWTHNPNNW------------IRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
             + I E K    + + + ED  +  +P+ +L AG  L     G+ P E++ +PL ++D   +  K+F+V+N   K K I R+SAT +  +  P++ IRKLA+ I  + +F+  IM TIL NCVF+ ++N    +   EY F  IYT E +I++ +RG  +  +T+LRDP+N +D  +I  +Y+   V      N  NVS+LRT RVLRALKTI+++PGLKTI  ALI+S+K L +V+IL++FC+S FAL  LQ++ G LRNKC++     +    N ++ F N+       +N T N  NW            +    + L CGN S AG C +     IC+   G NPN+GYT+FD F WA LS+F+L+T D+WEN Y L +RA+G   ++F+++V+F GSFYLINL+LAVV+M+Y
Sbjct:   26 EQRIAEEKAKRPKQERKDEDDENGPKPNSDLEAGKSL-PFIYGDIPPEMVSEPLEDLDPYYINKKTFIVLN---KGKAISRFSATSALYILTPFNPIRKLAIKILVHSLFNVLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKILARGFCLEDFTFLRDPWNWLDFTVITFAYVTEFV------NLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPDNSTFEINITSFFNNSLDWNGTAFNRTMNMFNWDEYIEDKSHFYFLEGQNDALLCGNSSDAGQCPE---GYICV-KAGRNPNYGYTSFDTFSWAFLSLFRLMTQDFWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLINLILAVVAMAY 428          

HSP 3 Score: 285.419 bits (729), Expect = 6.928e-77
Identity = 154/326 (47.24%), Postives = 228/326 (69.94%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQ-PPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFKQMT 5364
            + E ++  F++PTL RV+R+ RIGR+LRLIK AKGIR LLFAL++SLPALFNIG LL L++FIY+I GMS F  +K+  G+DD+ NFETF  S++ LF++TT+ GW+ +L  +    PP C+     +D    ++  GDCG    GI +  ++I I +L+++NMYIA+ILENF+ A  +    ++EDDFEMFY VWE++DP A+Q+I++  LSDF A LD PL I KPN + L++ DLP+V GD++HCLDIL A  K V+G   +S E   ++ QME ++    P++V    ITTT+KRK+E+++A  +QRA++    ++  K+++
Sbjct: 1612 LAELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKREVGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSGPPDCDPE---KDHPGSSV-KGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYEVWEKFDPDATQFIEFCKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLG---ESGEMDALRIQMEERFMASNPSKVSYEPITTTLKRKQEEVSAIVIQRAYRRYLLKQKVKKVS 1930          

HSP 4 Score: 200.29 bits (508), Expect = 7.410e-51
Identity = 93/223 (41.70%), Postives = 150/223 (67.26%), Query Frame = 3
Query: 1809 CSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEY-FNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHT---QIFGD-NIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIR-ANSPLCLLIFI 2459
            C  W+  ++ + + V DPF DL I+ CI +NT+ MA EHYP  + +  +L   N++FT I+  E  LKI+A+   Y F  GWNIFD  +V  S+++LG+  V+ LS+ R+FRL RVFKLA+SW T+ +L+ II +++  +GNL++++ +++++FAV+G Q +  +Y     +I  D  +PRW+  DF+HS ++VFR++CGEWIE  +DC+  A   +CL +F+
Sbjct:  743 CKPWLKVKHVVNLVVMDPFVDLAITICIVLNTLFMAMEHYPMTEQFSSVLSVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVSLSLMELGLANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKISNDCELPRWHMHDFFHSFLIVFRVLCGEWIETMWDCMEVAGQTMCLTVFM 965          

HSP 5 Score: 100.523 bits (249), Expect = 1.718e-20
Identity = 63/195 (32.31%), Postives = 114/195 (58.46%), Query Frame = 3
Query: 1827 FQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEV-----DALSIFRAFRLF---RVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFG-DNIPRWNFDDFWHSMILVFRI 2384
            FQ  ++ FVT   FD+ I   I +N + M  E     +   +IL + N++F V++  EC LK+++L   YF +GWNIFDFVVVI SI+ + + E+      + ++FR  RL    R+ +L +  + +R LL  +  ++  + N+ +++ LV++++A+ G  ++   Y  +  G D++  +NF+ F +SMI +F+I
Sbjct: 1521 FQGMVFDFVTKQVFDISIMILICLNMVTMMVETDDQSQEMTNILYWINLVFIVLFTGECVLKLISLRHYYFTIGWNIFDFVVVILSIVGMFLAELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNF--AYVKREVGIDDM--FNFETFGNSMICLFQI 1711          

HSP 6 Score: 69.3218 bits (168), Expect = 5.477e-11
Identity = 56/240 (23.33%), Postives = 108/240 (45.00%), Query Frame = 3
Query: 1653 DSEEEKEGKDCDNKAEYEDEVEIGNDTNNTDTAEMNPTIDRNCQCCIKQNVL----CSK----------WVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASE--HYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIID-----LGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYH 2306
            D EE KE  +  + +E    V+IG      +  E  P      + C  ++ +    C +          W   +   Y  V   +F+ FI F I +++  +A E  +    KT   +L+Y++ +FT I+I+E  LK +A   + YF   W   DF++V  S++      LG  E+ A+   R  R  R  +    ++ MR+++  +   I  + N+ ++ L+   +F+++G   +   ++
Sbjct: 1128 DMEESKEKLNATSSSE-GSTVDIGAPAEG-EQPEAEPEESLEPEACFTEDCVRKFKCCQISIEEGKGKLWWNLRKTCYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQMYFTNAWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFY 1365          

HSP 7 Score: 62.003 bits (149), Expect = 1.054e-8
Identity = 77/328 (23.48%), Postives = 134/328 (40.85%), Query Frame = 3
Query:  495 WSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDY-----------PISEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGY----TNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNI-------------LFYIIVVFFGSFYLINLMLAVV 1394
            W  +RK    I  +  F+ FI+  IL++   LA  + Y             ++ VF  I+ LEM+++  + G  +    Y  + +  +D LI+ +S + +            + SLRTLR LR L+ ++   G++ + +AL+ ++  +  V+   L C+ F+ +F++                          N F   FY+             INY T        + S  N  S C   I  N    +     NFDN G   LS+ Q+ T   W    +++  A  S N+             L+++I + FGSF+ +NL + V+
Sbjct: 1195 WWNLRKTCYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQM----YFTNAWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVL---LVCLIFWLIFSIM-----------------------GVNLFAGKFYH------------CINYTT----GEMFDVSVVNNYSECQALIESNQTARWKNVKVNFDNVGLGYLSLLQVATFKGW---MDIMYAAVDSRNVELQPKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVI 1473          

HSP 8 Score: 56.9954 bits (136), Expect = 3.129e-7
Identity = 47/202 (23.27%), Postives = 97/202 (48.02%), Query Frame = 3
Query:  486 CAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPISE----------YVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAF 1061
            C PW  ++ +  L+  +   D  I + I++N +F+A+ + YP++E           VF  I+T EM +++    + ++ Y Y ++ +N+ D  I+ LS + + +    G     +S LR+ R+LR  K     P L  +   +  S+  L  + ++    +  FA+  +Q++ G    +CV  +     +   H ++F ++F
Sbjct:  743 CKPWLKVKHVVNLVVMDPFVDLAITICIVLNTLFMAMEH-YPMTEQFSSVLSVGNLVFTGIFTAEMFLKI----IAMDPYYYFQEGWNIFDGFIVSLSLMELGLANVEG-----LSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLF-GKSYKECVCKISNDCELPRWHMHDFFHSF 933          

HSP 9 Score: 52.373 bits (124), Expect = 7.400e-6
Identity = 48/188 (25.53%), Postives = 87/188 (46.28%), Query Frame = 3
Query: 3027 CIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCL 3590
            C++ D    C   W   ++   L+      +  I +CI+ +++ +  E   +         L V N +FT +F  EM LKII++    YF   W I D FIVS+SL+ L          +     LR+ R LR  +    W  + +++  +  ++ ++ N+ LV  +   IF++ G+Q F   + +C+
Sbjct:  737 CLIWD----CCKPWLKVKHVVNLVVMDPFVDLAITICIVLNTLFMAMEHYPMTEQ--FSSVLSVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVSLSLMELGL------ANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECV 912          

HSP 10 Score: 52.373 bits (124), Expect = 8.325e-6
Identity = 28/70 (40.00%), Postives = 42/70 (60.00%), Query Frame = 3
Query: 4059 VAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGL-RWHYFRYMWN 4265
            V M    +L I I I LN + M +EHY  T  F++VL + N++F+ IFT E  +KI  +  ++YF+  WN
Sbjct:  756 VVMDPFVDLAITICIVLNTLFMAMEHYPMTEQFSSVLSVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWN 825          
BLAST of Sodium channel protein vs. Ensembl Mouse
Match: Scn1a (sodium channel, voltage-gated, type I, alpha [Source:MGI Symbol;Acc:MGI:98246])

HSP 1 Score: 382.874 bits (982), Expect = 2.546e-107
Identity = 212/449 (47.22%), Postives = 289/449 (64.37%), Query Frame = 3
Query: 2934 IDEESVNELKGCCCAICYNPFQEKKPFHCCYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLR---QNHT--WANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            I+ E   E + C    C   F+      CC      +E   G +W   R     I EH  FE  I+  IL SS  L FEDIY+D   T+K  L   + +FTY+F +EM+LK ++ G++ YFT+ W  LDF IV +SL+SL  + LG+ +E+ A +SLRT+RALRPLRA+SR++GM++VVNAL+ AIPSI NVLLVC++FWLIFSI GV  F GKF+ C+++ T +    + V N S+CL+   +N T  W N  +NFDN   G+L+L Q+ATF+GWM+IM  A+DS  + LQPK E  +  Y YFVIFI+ GSFF LNLFIGVIIDNFN+ K K+ G   D+F+T  Q+ YYN MKKL ++KP+K + RP    QG  +D      F++ I+ILI LNMV MM+E   Q+   T++L  IN++F  +FT E ++K+  LR +YF   WN
Sbjct: 1169 IEPEETLEPEACFTEGCVQRFK------CCQI---SVEEGRGKQWWNLRRTCFRIVEHNWFETFIVFMILLSSGALAFEDIYIDQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGYQTYFTNAWCWLDFLIVDVSLVSLTANALGY-SELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCVNTTTGDIFEISEVNNHSDCLKLIERNETARWKNVKVNFDNVGFGYLSLLQVATFKGWMDIMYAAVDSRNVELQPKYEESLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQ--DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPGNKFQGMVFDFVTRQVFDISIMILICLNMVTMMVETDDQSDYVTSILSRINLVFIVLFTGECVLKLISLRHYYFTIGWN 1605          

HSP 2 Score: 286.96 bits (733), Expect = 2.063e-77
Identity = 166/401 (41.40%), Postives = 247/401 (61.60%), Query Frame = 3
Query:  273 EDFSDNCQPDPELVAGSILLEDKLGEFPEELLGKPLNEIDQN-LKDKSFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPIS---EYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWK--NVMSENHSNE----------FVN--AFYYNWTHNPNN-----WIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
            +D  +  +P+ +L AG  L     G+ P E++ +PL ++D   +  K+F+V+N   K K I+R+SAT +  +  P++ +RK+A+ I  + +F   IM TIL NCVF+ ++N    +   EY F  IYT E +I++ +RG  +  +T+LRDP+N +D  +I  +Y+   V+        NVS+LRT RVLRALKTI+++PGLKTI  ALI+S+K L +V+IL++FC+S FAL  LQ++ G LRNKCV+   W   N   E HS E           VN   F ++W     +     ++   ++ L CGN S AG C    P        G NPN+GYT+FD F WA LS+F+L+T D+WEN Y L +RA+G   ++F+++V+F GSFYLINL+LAVV+M+Y
Sbjct:   43 DDDENGPKPNSDLEAGKNL-PFIYGDIPPEMVSEPLEDLDPYYINKKTFIVLN---KGKAIFRFSATSALYILTPFNPLRKIAIKILVHSLFSMLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKIIARGFCLEDFTFLRDPWNWLDFTVITFAYVTEFVDLG------NVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCVQ---WPPTNASLEEHSIEKNITMDYNGTLVNETVFEFDWKSYIQDSRYHYFLEGVLDALLCGNSSDAGQC----PEGYMCVKAGRNPNYGYTSFDTFSWAFLSLFRLMTQDFWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLINLILAVVAMAY 426          

HSP 3 Score: 286.96 bits (733), Expect = 2.410e-77
Identity = 153/326 (46.93%), Postives = 226/326 (69.33%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMF-IQPPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFKQMT 5364
            + E ++  F++PTL RV+R+ RIGR+LRLIK AKGIR LLFAL++SLPALFNIG LL L++FIY+I GMS F  +K+  G+DD+ NFETF  S++ LF++TT+ GW+ +L  +   +PP C+   V      K    GDCG    GI +  ++I I +L+++NMYIA+ILENF+ A  +    ++EDDFEMFY VWE++DP A+Q++++  LS F A L+ PL +P+PN + L++ DLP+V GD++HCLDIL A  K V+G   +S E   ++ QME ++    P++V    ITTT+KRK+E+++A  +QRA++    +R  KQ +
Sbjct: 1621 LAELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKREVGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSKPPDCDPNKVNPGSSVK----GDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYEVWEKFDPDATQFMEFEKLSQFAAALEPPLNLPQPNKLQLIAMDLPMVSGDRIHCLDILFAFTKRVLG---ESGEMDALRIQMEERFMASNPSKVSYQPITTTLKRKQEEVSAVIIQRAYRRHLLKRTVKQAS 1939          

HSP 4 Score: 198.749 bits (504), Expect = 2.707e-50
Identity = 94/224 (41.96%), Postives = 153/224 (68.30%), Query Frame = 3
Query: 1809 CSK-WVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEY-FNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHT---QIFGD-NIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIR-ANSPLCLLIFI 2459
            CS  W+  ++ + + V DPF DL I+ CI +NT+ MA EHYP  + ++ +L   N++FT I+  E  LKI+A+   Y F  GWNIFD  +V  S+++LG+  V+ LS+ R+FRL RVFKLA+SW T+ +L+ II +++  +GNL++++ +++++FAV+G Q +  +Y     +I  D  +PRW+ +DF+HS ++VFR++CGEWIE  +DC+  A   +CL +F+
Sbjct:  750 CSPYWLKVKHIVNLVVMDPFVDLAITICIVLNTLFMAMEHYPMTEHFNHVLTVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVTLSLVELGLANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKDCVCKIATDCKLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMCLTVFM 973          

HSP 5 Score: 97.4413 bits (241), Expect = 1.472e-19
Identity = 63/195 (32.31%), Postives = 111/195 (56.92%), Query Frame = 3
Query: 1827 FQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEV-----DALSIFRAFRLF---RVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFG-DNIPRWNFDDFWHSMILVFRI 2384
            FQ  ++ FVT   FD+ I   I +N + M  E          IL   N++F V++  EC LK+++L   YF +GWNIFDFVVVI SI+ + + E+      + ++FR  RL    R+ +L +  + +R LL  +  ++  + N+ +++ LV++++A+ G  ++   Y  +  G D++  +NF+ F +SMI +F+I
Sbjct: 1530 FQGMVFDFVTRQVFDISIMILICLNMVTMMVETDDQSDYVTSILSRINLVFIVLFTGECVLKLISLRHYYFTIGWNIFDFVVVILSIVGMFLAELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNF--AYVKREVGIDDM--FNFETFGNSMICLFQI 1720          

HSP 6 Score: 70.4774 bits (171), Expect = 2.569e-11
Identity = 54/238 (22.69%), Postives = 108/238 (45.38%), Query Frame = 3
Query: 1653 DSEEEKEGKDCDNKAEYEDEVEIGNDTNNTDTAEMNPTIDRNC---QCCIKQNVLCS---------KWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASE--HYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIID-----LGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYH 2306
            D EE KE  +  + +     V+IG         E   T++      + C+++   C          +W   +   +  V   +F+ FI F I +++  +A E  +    KT   +L+Y++ +FT I+I+E  LK +A   + YF   W   DF++V  S++      LG  E+ A+   R  R  R  +    ++ MR+++  +   I  + N+ ++ L+   +F+++G   +   ++
Sbjct: 1137 DLEESKEKLNESSSSSEGSTVDIGAPAEEQPVIEPEETLEPEACFTEGCVQRFKCCQISVEEGRGKQWWNLRRTCFRIVEHNWFETFIVFMILLSSGALAFEDIYIDQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGYQTYFTNAWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFY 1374          

HSP 7 Score: 66.2402 bits (160), Expect = 4.380e-10
Identity = 76/330 (23.03%), Postives = 137/330 (41.52%), Query Frame = 3
Query:  495 WSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDY-----------PISEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAG--NCSKTNPNSICLPHIGPNPNFGY----TNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNI-------------LFYIIVVFFGSFYLINLMLAVV 1394
            W  +R+    I  +  F+ FI+  IL++   LA  + Y             ++ VF  I+ LEM+++  + G      TY  + +  +D LI+ +S + +            + SLRTLR LR L+ ++   G++ + +AL+ ++  +  V+   L C+ F+ +F++                          N F   FY+                  C N ++      S+ N +S CL  I  N    +     NFDN G+  LS+ Q+ T   W    +++  A  S N+             L+++I + FGSF+ +NL + V+
Sbjct: 1204 WWNLRRTCFRIVEHNWFETFIVFMILLSSGALAFEDIYIDQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGY----QTYFTNAWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVL---LVCLIFWLIFSIM-----------------------GVNLFAGKFYH------------------CVNTTTGDIFEISEVNNHSDCLKLIERNETARWKNVKVNFDNVGFGYLSLLQVATFKGW---MDIMYAAVDSRNVELQPKYEESLYMYLYFVIFIIFGSFFTLNLFIGVI 1482          

HSP 8 Score: 59.3066 bits (142), Expect = 6.381e-8
Identity = 72/334 (21.56%), Postives = 140/334 (41.92%), Query Frame = 3
Query: 3066 WHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSF----WTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFF-KC---------LDSNTRER------------------------------------LAATVVPNKSE---------CLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVI 3890
            ++  R  ++ I  H  F   I+  IL + + +      + N P   +    + Y FT ++  E ++KII+ GF +   +F    W  LDF +++ + ++          ++    +LRT R LR L+ IS   G+K +V ALI ++  + +V+++ +    +F++ G+Q F G    KC         L+ ++ E+                                    L A +  N S+         C++          +FD  +  FL+L+++ T + W  + Q  + + G            Y  +FV+ I +GSF+++NL + V+
Sbjct:  114 FNPLRKIAIKILVHSLFSMLIMCTILTNCVFMT-----MSNPPDWTKN---VEYTFTGIYTFESLIKIIARGFCLEDFTFLRDPWNWLDFTVITFAYVTEF-------VDLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCVQWPPTNASLEEHSIEKNITMDYNGTLVNETVFEFDWKSYIQDSRYHYFLEGVLDALLCGNSSDAGQCPEGYMCVKAGRNPNYGYTSFDTFSWAFLSLFRLMTQDFWENLYQLTLRAAG----------KTYMIFFVLVIFLGSFYLINLILAVV 422          
BLAST of Sodium channel protein vs. UniProt/SwissProt
Match: sp|P15390|SCN4A_RAT (Sodium channel protein type 4 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn4a PE=1 SV=1)

HSP 1 Score: 829.321 bits (2141), Expect = 0.000e+0
Identity = 534/1450 (36.83%), Postives = 812/1450 (56.00%), Query Frame = 3
Query:  219 HRHIDEGKLVDGELKFEVEDFSDNCQPDPELVAGSILLEDKLGEFPEELLGKPLNEIDQNLKDK-SFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPIS---EYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYN---WTHN-----------PNNWIRNGI--------------------NYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHDKDQMKDLKITNGMSDADSSLCKNTTSIHENDDNFRFMDSEEEKEG-----KDCDNKAEYEDEVEIGNDTNNTDTA---EMNPTIDRNCQC------CIKQNVL---CSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSK-EYFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHT---QIFGD-NIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIR-ANSPLCLLIFIPTXXXX-XXXXXXXXXXXXXXXXXXXXXKNTADEDVSKLKIVIERLRNIYPMSRNNPLGINKGNQELDSTETLKDIVVNFG-----CENAAELQNNHEKMRIIKNCKDLSTSNELVNLLPSTGSLSKGN----KLINNAIXXXXXXXXXXGKHLXXXXXXXXXXXXXXID-EESVNELKGCCCAIC-----------------YNPFQEKKPFHC--------CYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHT----WANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
             R ++E   +    + E+E+     +P  +L AG  L     G+ P E++G PL ++D    DK +F+V+N   K K I+R+SAT +  L +P+S +R++A+ +  + +F  FIM+TIL NCVF+ ++N    S   EY F  IYT E +I+M +RG  I+ +T+LRDP+N +D  +I ++Y+   V+        N+S+LRT RVLRALKTIT++PGLKTI  ALI+S+K L +V+IL++FC+S FAL  LQ++ G LR KCV+   W   M++ ++  + N  +Y+   W  N             +W  N                      + L CGN S AG+C    P        G NPN+GYT++D F WA L++F+L+T DYWEN + L +RA+G   ++F+++++F GSFYLINL+LAVV+M+Y E+ EA                                       +DQ K+ +    +        K      E     + ++S EE +G     KDC+   +   E      + + D+A    M    + + +C      C  + ++   C+ WV F++ +Y+ V DPF DL I+ CI +NT+ MA EHYP  + +D++L   N++FT I+  E  LK++A+   EYF  GWNIFD  +V  S+++LG+  V  LS+ R+FRL RVFKLA+SW T+ +L+ II +++  +GNL++++ +++++FAV+G Q +  +Y     +I  D N+PRW+ +DF+HS ++VFRI+CGEWIE  +DC+  A   +CL +F+  +V+G   V+      LL +  A     +  D +++ L+I I R++     ++   LG+ +G        + K+I+++ G      ENA E     EK       K+L  ++ L ++  + G  S         INN           +   L    + + +  +E  D ++ +  L     ++C                  NP + ++P  C        C C+  DI    G  W   R     I EH  FE  I+  IL SS  L FEDIY++    ++  L   + +FTY+F +EM+LK ++ GFKVYFT+ W  LDF IV +S++SL+ + LG+ +E+   +SLRT+RALRPLRA+SR++GM++VVNAL+ AIPSI NVLLVC++FWLIFSI GV  F GKF+ C+++ T ER   +VV NKSE     +T    W N  +N+DN   G+L+L Q+ATF+GWM+IM  A+DS     QP  E  +  Y YFVIFI+ GSFF LNLFIGVIIDNFN+ K K+ G   D+F+T  Q+ YYN MKKL ++KP+K + RP+  +QG  YD      F++ I+ILI LNMV MM+E   Q+    ++L  IN++F  IFT E ++K+  LR +YF   WN
Sbjct:   30 QRAVEEEARLQRNKQMEIEE--PERKPRSDLEAGKNL-PLIYGDPPPEVIGIPLEDLDPYYSDKKTFIVLN---KGKAIFRFSATPALYLLSPFSIVRRVAIKVLIHALFSMFIMITILTNCVFMTMSNPPSWSKHVEYTFTGIYTFESLIKMLARGFCIDDFTFLRDPWNWLDFSVITMAYVTEFVDLG------NISALRTFRVLRALKTITVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALVGLQLFMGNLRQKCVR---WPPPMNDTNTTWYGNDTWYSNDTWYGNDTWYINDTWNSQESWAGNSTFDWEAYINDEGNFYFLEGSNDALLCGNSSDAGHC----PEGYECIKAGRNPNYGYTSYDTFSWAFLALFRLMTQDYWENLFQLTLRAAGKTYMIFFVVIIFLGSFYLINLILAVVAMAYAEQNEATLA------------------------------------EDQEKEEEFQQMLEKY-----KKHQEELEKAKAAQALESGEEADGDPTHNKDCNGSLDASGEKGPPRPSCSADSAISDAMEELEEAHQKCPPWWYKCAHKVLIWNCCAPWVKFKHIIYLIVMDPFVDLGITICIVLNTLFMAMEHYPMTEHFDNVLSVGNLVFTGIFTAEMVLKLIAMDPYEYFQQGWNIFDSFIVTLSLVELGLANVQGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKIASDCNLPRWHMNDFFHSFLIVFRILCGEWIETMWDCMEVAGQAMCLTVFLMVMVIGNLVVLNLFLALLLSSFSADSLAASDEDGEMNNLQIAIGRIKWGIGFAKTFLLGLLRGK-----ILSPKEIILSLGEPGGAGENAEESTPEDEKKEPPPEDKELKDNHILNHVGLTDGPRSSIELDHLNFINNPYLTIQVPIASEESDLEMPTEEETDAFSEPEDIKKPLQPLYDGNSSVCSTADYKPPEEDPEEQAEENP-EGEQPEECFTEACVKRCPCLYVDISQGRGKMWWTLRRACFKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRRVIRTILEYADKVFTYIFILEMLLKWVAYGFKVYFTNAWCWLDFLIVDVSIISLVANWLGY-SELGPIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYYCVNTTTSERFDISVVNNKSESESLMYTGQVRWMNVKVNYDNVGLGYLSLLQVATFKGWMDIMYAAVDSREKEEQPHYEVNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGK--DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPQNKIQGMVYDFVTKQVFDISIMILICLNMVTMMVETDDQSQLKVDILYNINMVFIIIFTGECVLKMFALRHYYFTIGWN 1410          

HSP 2 Score: 298.901 bits (764), Expect = 2.686e-80
Identity = 171/335 (51.04%), Postives = 228/335 (68.06%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQ-PPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFKQMTENATLSSRH 5391
            + + ++  F++PTL RV+R+ RIGRVLRLI+ AKGIR LLFAL++SLPALFNIG LL L++FIYSI GMS F  +KK  G+DD+ NFETF  SI+ LF +TT+ GW+ +L  +    PP C+ T  L +        GDCG    GI +  ++I I +LI++NMYIAIILENFN A  +    ++EDDFEMFY  WE++DP A+Q+I Y+ LSDFV  L EPL I KPN I L++ DLP+V GDK+HCLDIL AL K V+G   DS E   +K+ ME K+    P++V    ITTT+KRK+E++ A  +QRA++    QR+ KQ    A+   RH
Sbjct: 1426 LSDLIQKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYSIFGMSNFAYVKKESGIDDMFNFETFGNSIICLFEITTSAGWDGLLNPILNSGPPDCDPT--LENPGTNV--RGDCGNPSIGICFFCSYIIISFLIVVNMYIAIILENFNVATEESSEPLSEDDFEMFYETWEKFDPDATQFIDYSRLSDFVDTLQEPLKIAKPNKIKLITLDLPMVPGDKIHCLDILFALTKEVLG---DSGEMDALKQTMEEKFMAANPSKVSYEPITTTLKRKQEEVCAIKIQRAYRRHLLQRSVKQ----ASYMYRH 1749          

HSP 3 Score: 97.8265 bits (242), Expect = 8.067e-19
Identity = 62/193 (32.12%), Postives = 105/193 (54.40%), Query Frame = 3
Query: 1830 QNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEV-----DALSIFRAFRLF---RVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRI 2384
            Q  +Y FVT   FD+ I   I +N + M  E     +   DIL   N++F +I+  EC LK+ AL   YF +GWNIFDFVVVI SI+ L + ++      + ++FR  RL    RV +L +  + +R LL  +  ++  + N+ +++ LV++++++ G  ++          D    +NF+ F +S+I +F I
Sbjct: 1336 QGMVYDFVTKQVFDISIMILICLNMVTMMVETDDQSQLKVDILYNINMVFIIIFTGECVLKMFALRHYYFTIGWNIFDFVVVILSIVGLALSDLIQKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYSIFGMSNFAYVKKESGIDD---MFNFETFGNSIICLFEI 1525          
BLAST of Sodium channel protein vs. UniProt/SwissProt
Match: sp|Q9ER60|SCN4A_MOUSE (Sodium channel protein type 4 subunit alpha OS=Mus musculus OX=10090 GN=Scn4a PE=1 SV=1)

HSP 1 Score: 815.453 bits (2105), Expect = 0.000e+0
Identity = 526/1435 (36.66%), Postives = 804/1435 (56.03%), Query Frame = 3
Query:  219 HRHIDEGKLVDGELKFEVEDFSDNCQPDPELVAGSILLEDKLGEFPEELLGKPLNEIDQNLKDK-SFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPIS---EYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYN---------WTHN-----PNNWIRNGI--------------------NYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHDKDQMKDLKITNGMSDADSSLCKNTTSIHENDDNFRFMDSEEEKEGK-DCDNKAEYEDEVEIGNDTNNTDTAEMNPTIDRNCQCCIKQNVLCSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSK-EYFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHT---QIFGD-NIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIRANSPLCLLIFIPTXXXXXXXXXXXXXXXXXXXXXXXXXKNTADED--VSKLKIVIERLRNIYPMSRNNPLGINKGNQELDSTETLKDIVVNFG-----CENAAELQNNHEKMRIIKNCKDLSTSNELVNLLPSTGSLSKGNKL-----INNAIXXXXXXXXXXGKHLXXXXXXXXXXXXXXID-EESVNELKGCCCAIC-----------------YNPFQEKKPFHC--------CYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHT----WANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
             R ++E   +    + E+E+     +P  +L AG  L     G+ P E++G PL ++D    DK +F+V+N   K K I+R+SAT +  + +P+S +R++A+ +  + +F  FIM+TIL NCVF+ ++N    S   EY F  IYT E +I+M +RG  I+ +T+LRDP+N +D  +I ++Y+   V+        N+S+LRT RVLRALKTIT++PGLKTI  ALI+S+K L +V+IL++FC+S FAL  LQ++ G LR KCV+   W   M++ ++  + N  +Y          W  N       +W+ N                      + L CGN S AG+C    P        G NPN+GYT++D F WA L++F+L+T DYWEN + L +RA+G   ++F+++++F GSFYLINL+LAVV+M+Y E+ EA   E++E++    +  ++ KK                 + ++ K  +   G  +AD          H  D N     S E+   +  C  ++   D +E        +  +  P     C   +     C+ WV F++ + + V DPF DL I+ CI +NT+ MA EHYP  + +D++L   N++FT I+  E  LK++A+   EYF  GWNIFD  +V  S+++LG+  V  LS+ R+FRL RVFKLA+SW T+ +L+ II +++  +GNL++++ +++++FAV+G Q +  +Y     +I  D ++PRW+  DF+HS ++VFRI+CGEWIE  +DC+        L     +++   +V+      LL S  S      +DED  ++ L+I I R++     ++   LG+  G        +LKDI+++ G      EN      + +K    ++       N ++N +  T       ++     INN           +   L    + + +  +E  D ++ +  L     ++C                  NP + + P  C        C C+  DI    G  W   R     I EH  FE  I+  IL SS  L FEDIY++    ++  L   + +FTY+F +EM+LK ++ GFKVYFT+ W  LDF IV +S++SL+ + LG+ +E+   +SLRT+RALRPLRA+SR++GM++VVNAL+ AIPSI NVLLVC++FWLIFSI GV  F GKF+ C+++ T ER   +VV NKSEC    +T    W N  +N+DN   G+L+L Q+ATF+GWM+IM  A+DS     QP  E  +  Y YFVIFI+ GSFF LNLFIGVIIDNFN+ K K+ G   D+F+T  Q+ YYN MKKL ++KP+K + RP+  +QG  YD      F++ I+ILI LNMV MM+E   Q+    ++L  IN++F  +FT E ++K+  LR +YF   WN
Sbjct:   30 QRAMEEEARLQRNKQMEIEE--PERKPRSDLEAGKNL-PLIYGDPPPEVIGVPLEDLDPYYSDKKTFIVLN---KGKAIFRFSATPALYMLSPFSIVRRVAIKVLIHALFSMFIMITILTNCVFMTMSNPPSWSKDVEYTFTGIYTFESLIKMLARGFCIDDFTFLRDPWNWLDFSVITMAYVTEFVDLG------NISALRTFRVLRALKTITVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALVGLQLFMGNLRQKCVR---WPPPMNDTNTTWYGNDTWYGNDTWYGNDTWYGNDTWNSQESWVSNSTFDWEAYINDEGNFYFLEGSNDALLCGNSSDAGHC----PEGYECMKAGRNPNYGYTSYDTFSWAFLALFRLMTQDYWENLFQLTLRAAGKTYMIFFVVIIFLGSFYLINLILAVVAMAYAEQNEATLAEDQEKEEEFQQMLEKFKKHQ--------------EELEKAKAAQALEGGEEADGD------PTHSKDCNGSLDTSGEKGPPRPSCSAESAISDAME-----ELEEAHQKCPPWWYKCAHKVLIWNCCAPWVKFKHIILLIVMDPFVDLGITICIVLNTLFMAMEHYPMTEHFDNVLSVGNLVFTGIFTAEMVLKLIAMDPYEYFQQGWNIFDSFIVTLSLVELGLANVQGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKIASDCSLPRWHMHDFFHSFLIVFRILCGEWIETMWDCMEVAGQAMCLTVFLMVMVIGNLVVLNLFLALLLSSFSADSLAASDEDGEMNNLQIAIGRIKWGIAFAKTFLLGLLHGK-----ILSLKDIMLSLGEPGGAGENGESPPEDEKKEPPPEDGNKELKDNHILNHVGLTDGPRSSIEMDHLNFINNPYLTIHVPIASEESDLEMPTEEETDTFSEPEDIKKPLQPLYDGNSSVCSTADYKPPEEDPEEQAEENP-EGELPEECFTEACVKRCPCLYVDISQGRGKMWWTLRRACFKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRRVIRTILEYADKVFTYIFILEMLLKWVAYGFKVYFTNAWCWLDFLIVDVSIISLVANWLGY-SELGPIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYYCINTTTSERFDISVVNNKSECESLMYTGQVRWMNVKVNYDNVGLGYLSLLQVATFKGWMDIMYAAVDSREKEEQPDYEVNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGK--DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPQNKIQGMVYDFVTKQVFDISIMILICLNMVTMMVETDDQSQLKVDILYNINMVFIIVFTGECVLKMFALRHYYFTIGWN 1411          

HSP 2 Score: 298.516 bits (763), Expect = 3.890e-80
Identity = 171/335 (51.04%), Postives = 226/335 (67.46%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQ-PPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFKQMTENATLSSRH 5391
            + + ++  F++PTL RV+R+ RIGRVLRLI+ AKGIR LLFAL++SLPALFNIG LL L++FIYSI GMS F  +KK  G+DD+ NFETF  SI+ LF +TT+ GW+ +L  +    PP C+ T        K    GDCG    GI +  ++I I +LI++NMYIAIILENFN A  +    + EDDFEMFY  WE++DP A+Q+I Y+ LSDFV  L EPL I KPN I L++ DLP+V GDK+HCLDIL AL K V+G   DS E   +K+ ME K+    P++V    ITTT+KRK+E++ A  +QRA++    QR+ KQ    A+   RH
Sbjct: 1427 LSDLIQKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYSIFGMSNFAYVKKESGIDDMFNFETFGNSIICLFEITTSAGWDGLLNPILNSGPPDCDPTLENPGTNIK----GDCGNPSIGICFFCSYIIISFLIVVNMYIAIILENFNVATEESSEPLCEDDFEMFYETWEKFDPDATQFIDYSRLSDFVDTLQEPLKIAKPNKIKLITLDLPMVPGDKIHCLDILFALTKEVLG---DSGEMDALKQTMEEKFMAANPSKVSYEPITTTLKRKQEEVCAIKIQRAYRRHLLQRSVKQ----ASYMYRH 1750          

HSP 3 Score: 97.4413 bits (241), Expect = 1.159e-18
Identity = 61/193 (31.61%), Postives = 105/193 (54.40%), Query Frame = 3
Query: 1830 QNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEV-----DALSIFRAFRLF---RVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRI 2384
            Q  +Y FVT   FD+ I   I +N + M  E     +   DIL   N++F +++  EC LK+ AL   YF +GWNIFDFVVVI SI+ L + ++      + ++FR  RL    RV +L +  + +R LL  +  ++  + N+ +++ LV++++++ G  ++          D    +NF+ F +S+I +F I
Sbjct: 1337 QGMVYDFVTKQVFDISIMILICLNMVTMMVETDDQSQLKVDILYNINMVFIIVFTGECVLKMFALRHYYFTIGWNIFDFVVVILSIVGLALSDLIQKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYSIFGMSNFAYVKKESGIDD---MFNFETFGNSIICLFEI 1526          
BLAST of Sodium channel protein vs. UniProt/SwissProt
Match: sp|Q2XVR6|SC4AB_TAKRU (Sodium channel protein type 4 subunit alpha B OS=Takifugu rubripes OX=31033 GN=scn4ab PE=3 SV=1)

HSP 1 Score: 533.872 bits (1374), Expect = 2.119e-158
Identity = 348/838 (41.53%), Postives = 504/838 (60.14%), Query Frame = 3
Query: 1809 CSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKE-YFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHT---QIFGDNI-PRWNFDDFWHSMILVFRIICGEWIEPSFDCIR-ANSPLCLLIFIPTXXXXXXXXXXXXXXXXXXXXXXXXXKNTADEDVSKLKIVIERLRNIYPMSRNNPLGINKGNQELDSTETLKDIVVNFGCE---NAAELQNNHEKMRIIKNCKDLS--TSNELVNLLPSTGSLSKGNKLINNAIXXXXXXXXXXGKHLXXXXXXXXXXXXXXIDEESVN--ELKGCCCAICYNPFQEKKPFHCCYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSEC---LRQNHT---WANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            C  W   +  LY  V DPF DL I+ CI +NT+ MA EHYP    ++++L   N++FT I+  E   KI+A+    YF VGWNIFD ++V  S+++LG+  V  LS+ R+FRL RVFKLA+SW T+ +L+ II +++  +GNL++++ +++++FAV+G Q +   Y     +I  D + PRW+ +DF+H+ +++FR++CGEWIE  +DC+  +   +CL++F+  LV+GN VVLNLFLALLL+SF+ D+L    DE  + L+I I R+                 N+ +  T+T   + V    E   N     ++ E+ R +K+   L+  +S++LV       S   GN      I E ++D  D     + + +        ++ +  V   E+   C A        KK +  C  +  D     G  W   R     I E+  FE  I+  IL SS  L FEDIYL+ +  +K  L   + +FTY+F +EM+LK  + GFK YF++ W  LDF IV +SL+SL  +ILG+ +E+ A +SLRT+RALRPLRA+SR++GM++VVNAL+ A+PSIFNVLLVC++FWLIFSI GV  F GKF  C +  ++E +   VV NK+EC   ++ N T   W N  +N+DN   G+L+L Q+ATF+GW +IM  A+DS  +  QP  E  +  Y YFVIFI+ GSFF LNLFIGVIIDNFN+ K K  G   D+F+T  Q+ YYN MKKL ++KP+K V RP+   QG  +D+     F++ I++LI LNMV MM+E   Q+     VL  IN++F  IFT E  +KI  LR HYF   WN
Sbjct:  496 CGCWRHLKECLYAIVMDPFVDLGITICIILNTVFMAMEHYPMSADFEELLSVGNLVFTGIFTGEMVFKILAMDPYFYFQVGWNIFDSIIVTISLVELGLANVQGLSVLRSFRLMRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKNYKDCVCRISEDCVLPRWHMNDFFHAFLIIFRVLCGEWIESMWDCMEVSGQTMCLIVFMMVLVIGNLVVLNLFLALLLSSFSGDNLTTQDDEGENNLQIAINRI-----------------NRAMSWTKTYILLYVYTLTESNLNQHFAVSDDEEQRRVKDILALTSVSSDKLV-------SHHCGNDFFRVPIAEAESDSDDSDYDEDKDSQCDESSVCSSVQKPEVQEEEMDENCVAKTPTDCWTKKCYSRCPFLDIDTSQGRGKIWCNIRRTCFSIVENNYFESFIVFMILLSSGALAFEDIYLEKHQLIKSILEYADKVFTYVFVMEMVLKWFAYGFKSYFSNAWCWLDFLIVDVSLVSLTANILGY-SELGAIKSLRTLRALRPLRALSRFEGMRVVVNALVGAVPSIFNVLLVCLIFWLIFSIMGVNLFAGKFSYCFNETSQEIIDTKVVDNKTECIALIKANFTEVRWKNVKVNYDNVGIGYLSLLQVATFKGWTDIMYAAVDSRDVESQPIYEVNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKAKLGGQ--DIFMTEEQKKYYNAMKKLGSKKPQKPVPRPENPFQGLVFDLVTKQIFDVFIMVLICLNMVTMMVETDEQSDKKEEVLYWINVVFILIFTTECTLKIIALRRHYFSIGWN 1306          

HSP 2 Score: 288.5 bits (737), Expect = 3.846e-77
Identity = 155/313 (49.52%), Postives = 220/313 (70.29%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQPPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWK 5328
            + + ++  F++PTL RV+R+ RIGRVLRLI+ AKGIR LLFAL++SLPALFNIG LL LI+FI+SI GMS F  +KK   +DD+ NFETF  S++ LF +TT+ GW+ +L  +   PP C + +V   G       G+CG+   GI + +T+I + +L+++NM+IAIILENFN A  +    + EDDFEMFY  WE++DP ASQ+I+Y+ LSDF   L EPL IP+PN I L+S DLP+V GD++HC+DIL+AL   V+G   DS+E   +K  ME K+    P++V    I++T+ RK+E++AA  +QRA++
Sbjct: 1322 LADIIEKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLIMFIFSIFGMSNFAYVKKEALIDDMFNFETFGNSMICLFMITTSAGWDGLLSPIMNTPPDC-DPNVENPG---TTVRGNCGSPAIGIAFFSTYIIMSFLVVVNMFIAIILENFNVATEESSDPLCEDDFEMFYETWEKFDPDASQFIQYSKLSDFCDTLKEPLRIPQPNTIKLISMDLPLVPGDRIHCMDILLALTAEVLG---DSDEMDTLKATMEEKFMANNPSKVSYEPISSTLLRKEEEVAATVIQRAYR 1627          

HSP 3 Score: 280.411 bits (716), Expect = 1.215e-74
Identity = 165/397 (41.56%), Postives = 245/397 (61.71%), Query Frame = 3
Query:  294 QPDPELVAGSILLEDKLGEFPEELLGKPLNEIDQNLK-DKSFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPIS---EYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDW--KNVMSENHSNEFVNAFYYNWTH------------------NPNNW--IRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
            +P  +L AG  L     GE P ELL  PL +ID   +  K+F+V++   K   IYR++A  S  L +P++ +R +A+ I  + +F  FIM TIL NC F+ L++    S   EYVF  IYT E  I++ SRG  +  +T+L+DP+N +D ++I ++Y+  +V+        NVS LRT RVLRALKTIT++PGLKTI  ALI+S++ L + ++L++FC+S FAL  LQ++ G LR KCV +  W   N+  + +S    N +Y N TH                  NP+N+  +    + L CGN S AG C    P S     +G NPN+GYT++D+FGWA L++F+L+T D+WEN + L +R +G   ++F+++V+F GSFYLINL+LAVV+M+Y
Sbjct:   48 EPASDLEAGKPL-PFIYGEPPHELLNVPLEDIDPFYQSQKTFIVLS---KGNIIYRFNAESSLYLLSPFNALRIVAIKILIHSLFSLFIMATILTNCAFMTLSDPPAWSKTMEYVFTFIYTFEATIKILSRGFCVGKFTFLKDPWNWLDFMVISMAYLTELVDLG------NVSVLRTFRVLRALKTITVIPGLKTIVGALIQSVRKLADAMVLTVFCLSVFALIGLQLFMGNLRQKCVLIPQWLYGNLTFDINST---NGYYGNDTHDNGTKSKHLEFEFERHINNPDNYYYLTGQGDPLLCGNSSDAGVC----PESYVCLKVGANPNYGYTSYDSFGWAFLALFRLMTQDFWENLFQLTLRTAGKTYMIFFVVVIFLGSFYLINLILAVVAMAY 427          

HSP 4 Score: 108.612 bits (270), Expect = 4.381e-22
Identity = 65/214 (30.37%), Postives = 116/214 (54.21%), Query Frame = 3
Query: 1827 FQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEV-----DALSIFRAFRLF---RVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIRANSPLC 2444
            FQ  ++  VT   FD+FI   I +N + M  E        +++L + N++F +I+  EC+LKI+AL + YF++GWNIFDFVVVI SI+ L + ++      + ++FR  RL    RV +L +  + +R LL  +  ++  + N+ +++ L++++F++ G  ++       +  D    +NF+ F +SMI +F I      +     I    P C
Sbjct: 1231 FQGLVFDLVTKQIFDVFIMVLICLNMVTMMVETDEQSDKKEEVLYWINVVFILIFTTECTLKIIALRRHYFSIGWNIFDFVVVILSILGLLLADIIEKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLIMFIFSIFGMSNFAYVKKEALIDD---MFNFETFGNSMICLFMITTSAGWDGLLSPIMNTPPDC 1441          

HSP 5 Score: 73.9442 bits (180), Expect = 1.371e-11
Identity = 60/251 (23.90%), Postives = 103/251 (41.04%), Query Frame = 3
Query: 3618 ATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRR-PKALVQGF---------------------------------FYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGL-RWHYFRYMWN 4265
            A V P    CL+          ++D+    FLAL+++ T + W  + Q  + + G            Y  +FV+ I +GSF+++NL + V+   +       +           +  Y + ++ L  R+  +  R+ P + V+GF                                  Y + M    +L I I I LN V M +EHY  +A F  +L + N++F+ IFT E + KI  +  + YF+  WN
Sbjct:  343 AGVCPESYVCLKVGANPNYGYTSYDSFGWAFLALFRLMTQDFWENLFQLTLRTAG----------KTYMIFFVVVIFLGSFYLINLILAVVAMAYAE-----QNEATLAEAKEKEEEYIHILEALKKREEEQAARKEPHSTVEGFEDDHRLCPPCWYAFANIFLKWDCCGCWRHLKECLYAIVMDPFVDLGITICIILNTVFMAMEHYPMSADFEELLSVGNLVFTGIFTGEMVFKILAMDPYFYFQVGWN 578          

HSP 6 Score: 62.7734 bits (151), Expect = 3.458e-8
Identity = 78/300 (26.00%), Postives = 133/300 (44.33%), Query Frame = 3
Query: 3045 ETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXX--XXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYY-----------AYFVIFILVGSFFILNLFIGVIIDNFN 3905
            + P     + F+     +   + F+  I+V I  + + +  E    + +   ++ L  IN +F  +F  E  LKII+L  + YF+  W I      I+SI  L L + I  +    T FR +R  R  R LR I   +G++ ++ AL+ ++P++FN+ L+  +   IFSI G+  F                 A V   K E L       +   NF+   N  + L+ I T  GW  ++   I +T  +  P  EN                A+F  +I++    ++N+FI +I++NFN
Sbjct: 1221 QKPVPRPENPFQGLVFDLVTKQIFDVFIMVLICLNMVTMMVETD--EQSDKKEEVLYWINVVFILIFTTECTLKIIALR-RHYFSIGWNIFDFVVVILSILGLLLADIIEKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLIMFIFSIFGMSNF-----------------AYV---KKEAL------IDDMFNFETFGNSMICLFMITTSAGWDGLLS-PIMNTPPDCDPNVENPGTTVRGNCGSPAIGIAFFSTYIIMSFLVVVNMFIAIILENFN 1490          

HSP 7 Score: 61.6178 bits (148), Expect = 9.742e-8
Identity = 74/321 (23.05%), Postives = 131/321 (40.81%), Query Frame = 3
Query:  495 WSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDY--------PISEY---VFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWEN-QYNLV---------IRASGSWNILFYIIVVFFGSFYLINLMLAVV 1394
            W  IR+    I  N  F+ FI+  IL++   LA  + Y         I EY   VF  ++ +EMV++  + G      +Y  + +  +D LI+ +S + +            + SLRTLR LR L+ ++   G++ + +AL+ ++  +F V+   L C+ F+ +F++                          N F   F Y +       I   +      N +      K N   +   ++         N+DN G   LS+ Q+ T   W +  Y  V         I     +  L+++I + FGSF+ +NL + V+
Sbjct:  904 WCNIRRTCFSIVENNYFESFIVFMILLSSGALAFEDIYLEKHQLIKSILEYADKVFTYVFVMEMVLKWFAYGF----KSYFSNAWCWLDFLIVDVSLVSLTANILGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALVGAVPSIFNVL---LVCLIFWLIFSIM-----------------------GVNLFAGKFSYCFNETSQEIIDTKV----VDNKTECIALIKANFTEVRWKNVK-------VNYDNVGIGYLSLLQVATFKGWTDIMYAAVDSRDVESQPIYEVNLYMYLYFVIFIIFGSFFTLNLFIGVI 1183          
BLAST of Sodium channel protein vs. UniProt/SwissProt
Match: sp|Q2XVR3|SC4AA_DANRE (Sodium channel protein type 4 subunit alpha A OS=Danio rerio OX=7955 GN=scn4aa PE=2 SV=2)

HSP 1 Score: 462.225 bits (1188), Expect = 6.506e-133
Identity = 276/762 (36.22%), Postives = 444/762 (58.27%), Query Frame = 3
Query:  297 PDPELVAGSILLEDKLGEFPEELLGKPLNEIDQNLK-DKSFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPIS---EYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWT---------HNPNN--WIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHDKDQMKDLKITNGMSD-ADSSLCKNTTS------IHENDDNFRFMDSEEEKEGKDCDNKAEYEDEVEIGNDTNNT---DTAEMNPTIDRNCQCC----------IKQNVLCSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSK-EYFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHT---QIFGD-NIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIR-ANSPLCLLIFI 2459
            P  +L AG  L     G+ P +LL  PL +ID   K  K+F+VI+   K   I+R+S+  +    +P+S +R+ A+ I  + +F  FIM+TIL NCVF+ ++N    S   EYVF  IYT E  +++ SRG  I  +T+LRDP+N +D ++I ++Y+   V+        NVS+LRT RVLRALKTIT++PGLKTI  ALI+S+K + +V+IL++F ++ FAL  LQ++ G LR KC++     + + + +++  VN    N T         +N  N  ++   ++ L CGN S AG C    P        G NPN+GYT++DNFGWA L++F+L+T D+WEN + L +RA+G   ++F+++V+F GSFYLINL+LAVV+M+Y        +        + K  + ++ L +  +  T         K Q +    T  + D AD  + K+         I     + + + +EE+++     +  +Y D+ ++   T +     TA M    D    C           +K +  C+ W+ F+  ++  V DPF DL I+ CI +NT+ MA EHYP    ++ +L   N++FT I+  E   K++A+    YF VGWNIFD ++V  S+++LG+  V  LS+ R+FRL RVFKLA+SW T+ +L+ II +++  +GNL++++ +++++FAV+G Q +  +Y     +I  D  +PRW+ +DF+HS ++VFRI+CGEWIE  +DC+  A + +CL++F+
Sbjct:   47 PSSDLEAGKCL-PMIYGDPPGDLLNTPLEDIDPFYKTQKTFIVIS---KGNTIFRFSSEPAMFCISPFSIVRRGAIKILIHSLFSMFIMITILSNCVFMTMSNPPAWSKTVEYVFTGIYTFEATVKVLSRGFCIGPFTFLRDPWNWLDFMVISMAYVTEFVDLG------NVSALRTFRVLRALKTITVIPGLKTIVGALIQSVKKMIDVMILTIFALAVFALIGLQLFMGNLRQKCIRWPILNSTIFDVYNSNMVNDTTLNVTDTFDFKAYINNEENQYFLEGSLDALLCGNSSDAGRC----PEGYTCMKAGRNPNYGYTSYDNFGWAFLALFRLMTQDFWENLFQLTLRAAGKTYMIFFVVVIFLGSFYLINLILAVVAMAY------DEQNEATLAEARDKEEEFQRLLEQLKNQETGSKASLASQKTQSRGSNRTGSLHDLADEDVIKDCNGRIVPRLIVNRVSSNKELSAEEDQKSLSSKHSMQYLDQPKLSKRTASALSVLTATMEGLEDAQRPCPPGWYKFADMFLKWDC-CAPWILFKKWVHFVVMDPFVDLGITICIVLNTLFMAMEHYPMSPHFEHVLSVGNLVFTGIFTAEMVFKLIAMDPYYYFQVGWNIFDSIIVTLSLVELGLANVQGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKDCVCKISEDCELPRWHMNDFFHSFLIVFRILCGEWIETMWDCMEVAGASMCLIVFM 787          

HSP 2 Score: 379.793 bits (974), Expect = 1.040e-105
Identity = 205/419 (48.93%), Postives = 280/419 (66.83%), Query Frame = 3
Query: 3021 CYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHT----WANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            C C+  DI    G +W   R     I EH  FE  I+  IL SS  L FEDI ++    +K  L   + +FTY+F +EM+LK ++ GFK YFT+ W  LDF IV +SL+SL  +++G+ +E+ A +SLRT+RALRPLRA+SR++GM++VVNAL+ AIPSIFNVLLVC++FWLIFSI GV  F GKF+ C+++ T ER+   VV NKS+C+   +T    W N  +N+DN   G+L+L QIATF+GWM+IM  A+DS  ++ QP  E  +  Y YFVIFI+ GSFF LNLFIGVIIDNFN+ K+K+ G   D+F+T  Q+ YYN MKKL  +K  K + RP  ++QG  +D      F++ I++LI LNMV MMIE   Q+A    VL  IN++F  +FT E ++K+  LR ++F   WN
Sbjct:  968 CACLSVDITEGWGKKWWNLRRTCFTIVEHDYFETFIIFMILLSSGALAFEDINIERRRVIKTILEYADKVFTYIFIVEMLLKWVAYGFKTYFTNAWCWLDFLIVDVSLVSLTANLMGY-SELGAIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIFNVLLVCLIFWLIFSIMGVNLFAGKFYHCINTTTEERIPMDVVNNKSDCMALMYTNEVRWVNVKVNYDNVGLGYLSLLQIATFKGWMDIMYAAVDSREVDEQPSYEINLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKSKFGGK--DIFMTEEQKKYYNAMKKLGAKKRPKPIPRPSNIIQGLVFDFISKQFFDIFIMVLICLNMVTMMIETDDQSAEKEYVLYQINLVFIVVFTSECVLKLFALRQYFFTIGWN 1383          

HSP 3 Score: 256.529 bits (654), Expect = 2.648e-67
Identity = 154/331 (46.53%), Postives = 216/331 (65.26%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQ-PPYCN------NTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVG--ITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFK 5355
            + + ++  F++PTL RV+R+ RIGRVLRLI+ AKGIR LLFAL++SLPALFNIG LL LI+FI+SI GMS F  +KK  G+DD+ NFETF  SI+ LF +TT+ GW+ +L  +    PP C+       T V           G+CG    GI++  ++I + +L+++NMYIAIILENFN  +AQEE G  + EDDF+MF   WE++D  A+Q+I+Y  L DFV  L EPL I KPN + L+S D+PIV GDK+H  DIL+A+ + V+G   D+ E   +K  +E K+    P       I TT++RK+E+ AA  +QR ++    +RA +
Sbjct: 1399 LSDIIEKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLIMFIFSIFGMSNFAYVKKQAGIDDIFNFETFGGSIICLFEITTSAGWDGLLLPILNSGPPDCDPDFENPGTDV----------RGNCGNPGMGIMFFCSYIIMSFLVVVNMYIAIILENFN--NAQEESGDPLCEDDFDMFDETWEKFDVDATQFIEYDRLFDFVDALQEPLRIAKPNRLKLISMDIPIVNGDKIHSQDILLAVTREVLG---DTIEMDAMKESIEAKFIMNNPTSASFEPIITTLRRKEEERAAIAVQRIYRRHLLKRAIR 1714          

HSP 4 Score: 95.1301 bits (235), Expect = 5.785e-18
Identity = 60/194 (30.93%), Postives = 110/194 (56.70%), Query Frame = 3
Query: 1830 QNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEV-----DALSIFRAFRLF---RVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFG-DNIPRWNFDDFWHSMILVFRI 2384
            Q  ++ F++  FFD+FI   I +N + M  E        + +L   N++F V++  EC LK+ AL + +F +GWN+FDFVVVI SI  L + ++      + ++FR  RL    RV +L +  + +R LL  +  ++  + N+ +++ L++++F++ G  ++   Y  +  G D+I  +NF+ F  S+I +F I
Sbjct: 1309 QGLVFDFISKQFFDIFIMVLICLNMVTMMIETDDQSAEKEYVLYQINLVFIVVFTSECVLKLFALRQYFFTIGWNVFDFVVVILSIAGLMLSDIIEKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLIMFIFSIFGMSNF--AYVKKQAGIDDI--FNFETFGGSIICLFEI 1498          

HSP 5 Score: 67.3958 bits (163), Expect = 1.645e-9
Identity = 44/172 (25.58%), Postives = 85/172 (49.42%), Query Frame = 3
Query: 1815 KWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEK--TWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIIDL-----GVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYH 2306
            KW   +   +  V   +F+ FI F I +++  +A E    E+      IL+Y++ +FT I+I+E  LK +A   K YF   W   DF++V  S++ L     G  E+ A+   R  R  R  +    ++ MR+++  +   I  + N+ ++ L+   +F+++G   +   ++
Sbjct:  982 KWWNLRRTCFTIVEHDYFETFIIFMILLSSGALAFEDINIERRRVIKTILEYADKVFTYIFIVEMLLKWVAYGFKTYFTNAWCWLDFLIVDVSLVSLTANLMGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIFNVLLVCLIFWLIFSIMGVNLFAGKFY 1153          

HSP 6 Score: 58.9214 bits (141), Expect = 6.064e-7
Identity = 70/323 (21.67%), Postives = 135/323 (41.80%), Query Frame = 3
Query:  495 WSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNND--------YPISEY---VFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSE--NHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWEN-QYNLV----IRASGSWNI-----LFYIIVVFFGSFYLINLMLAVV 1394
            W  +R+    I  +  F+ FI+  IL++   LA  +           I EY   VF  I+ +EM+++  + G      TY  + +  +D LI+ +S + +            + SLRTLR LR L+ ++   G++ + +AL+ ++  +F V+++ L     F++  + ++ G   + C+     + +  +  N+ ++ +   Y N       W+   +NY                                    DN G   LS+ Q+ T   W +  Y  V    +    S+ I     L+++I + FGSF+ +NL + V+
Sbjct:  983 WWNLRRTCFTIVEHDYFETFIIFMILLSSGALAFEDINIERRRVIKTILEYADKVFTYIFIVEMLLKWVAYGF----KTYFTNAWCWLDFLIVDVSLVSLTANLMGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIFNVLLVCLIFWLIFSIMGVNLFAGKFYH-CINTTTEERIPMDVVNNKSDCMALMYTNEVR----WVNVKVNY------------------------------------DNVGLGYLSLLQIATFKGWMDIMYAAVDSREVDEQPSYEINLYMYLYFVIFIIFGSFFTLNLFIGVI 1260          

HSP 7 Score: 57.3806 bits (137), Expect = 1.796e-6
Identity = 60/259 (23.17%), Postives = 113/259 (43.63%), Query Frame = 3
Query: 3183 DNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXX--XXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMA-----------YYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNK 3920
            D +   +  L  IN +F  +F  E +LK+ +L  + +FT  W +      I+SI+ L L + I  +    T FR +R  R  R LR I   +G++ ++ AL+ ++P++FN+ L+  +   IFSI G+  F                             +     +   NF+      + L++I T  GW  ++   ++S   +  P  EN                 +F  +I++    ++N++I +I++NFN  + +
Sbjct: 1342 DQSAEKEYVLYQINLVFIVVFTSECVLKLFALR-QYFFTIGWNVFDFVVVILSIAGLMLSDIIEKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLIMFIFSIFGMSNF--------------------------AYVKKQAGIDDIFNFETFGGSIICLFEITTSAGWDGLLLPILNSGPPDCDPDFENPGTDVRGNCGNPGMGIMFFCSYIIMSFLVVVNMYIAIILENFNNAQEE 1573          
BLAST of Sodium channel protein vs. UniProt/SwissProt
Match: sp|Q20JQ7|SC4AB_DANRE (Sodium channel protein type 4 subunit alpha B OS=Danio rerio OX=7955 GN=scn4ab PE=2 SV=1)

HSP 1 Score: 459.144 bits (1180), Expect = 5.062e-132
Identity = 286/772 (37.05%), Postives = 458/772 (59.33%), Query Frame = 3
Query:  231 DEGKLVDGELKFEVEDFSDNCQPDPELVAGSILLEDKLGEFPEELLGKPLNEIDQNLK-DKSFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYP----ISEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCV--KMVDW--------KNVMSENHSNEFVNAF-YYNWTHNPNNW--IRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-----XXXXXXXHDKDQMKDLKITNGMSDADSSLCKNTTSIHENDDNFRFMDSEEEKEGKDCDNKAEYEDEVEIGNDTNNTDTAEMNPTIDRNCQCCIKQNVLCSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSK-EYFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHT---QIFGD-NIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIR-ANSPLCLLIFI 2459
            ++ ++ +  +K   ED     +P  +L AG +L     G+ P  LL  P+ E+D   K  K+F+VI+ +     IYR++   +    +P++ +R+ A+ I  + +F   IMLTIL NCVF+A++ D P    I EYVF  IYT E ++++ SRG  I  +T+LRDP+N +D ++I ++Y+   V+        N+S+LRT RVLRALKTIT++PGLKTI  ALI+S+K L +V+IL++FC+S FAL  LQ++ G LR KCV    V W         N    N +    + F Y  + ++  N+  +   ++ L CGN S AG C +     ICL   G NPN+GYT++DNFGWA L++F+L+T D+WEN + L +RA+G   ++F+++++F GSFYLINL+LAVV+M+Y E+ EA + E +E++    K  ++ KK  ++ +         +S K   D DQM+        SD D    K  +  + +  N  +++  + +       K      VE   D          P   +     +K +  C  WV F+  +Y+FV DPF DL I+ CI +NT+ MA EHYP     +++L   N++FT I+  E  LK++AL    YF VGWNIFD ++V  S+++L + +V+ LS+ R+FRL RVFKLA+SW T+ +L+ II +++  +GNL++++ +++++FAV+G Q +  +Y     +I  D  +PRW+  DF+H+ +++FR++CGEWIE  +DC+  A   +C+++F+
Sbjct:   34 EQERMKEQNVKVAEEDLP---KPTSDLEAGKVL-PFIYGDPPPNLLNVPIEELDPYYKAQKTFIVIDKK---NTIYRFNTEPACYCLSPFNPVRRAAIRILIHSLFSLVIMLTILTNCVFMAMS-DPPGWSKILEYVFTGIYTFEAMVKVLSRGFCIGDFTFLRDPWNWLDFMVISMAYLTEFVDLG------NISALRTFRVLRALKTITVIPGLKTIVGALIQSVKKLADVMILTVFCLSVFALIGLQLFMGNLRQKCVLWPPVGWYSDNLTVLSNYTDINGNGTANSTFDYQKYINSEENYYYVPGQMDPLVCGNSSDAGLCPE---GYICL-KAGRNPNYGYTSYDNFGWAFLALFRLMTQDFWENLFQLTLRAAGKTYMIFFVVIIFLGSFYLINLILAVVAMAYAEQNEATAAEAKEKEEEYAKIMEQLKKQAEQKNGMVNGSKTSLSSKKKGDNDQMQ--------SDYDGIALKPLSKSNGSKGNINYLEVPDSQI-----RKPSVVSAVESALDAQEDIERPCPPGWYKFADIFLKWDC-CIPWVKFKRIVYLFVMDPFVDLGITLCIVLNTVFMAMEHYPMSVHVEEVLAIGNLVFTGIFAAEMVLKLIALDPYYYFQVGWNIFDSIIVTMSLVELMLADVEGLSVLRSFRLMRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYTDSVCKISSDCELPRWHMADFFHAFLIIFRVLCGEWIETMWDCMEVAGQGMCIIVFM 773          

HSP 2 Score: 381.719 bits (979), Expect = 1.897e-106
Identity = 211/421 (50.12%), Postives = 276/421 (65.56%), Query Frame = 3
Query: 3021 CYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVV-NALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSEC--LRQNHT---WANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            C C+  D+    G  W  FR     I EH  FE  I+  IL SS  L FEDIY++    +K  L   + +FTY+F +EM+LK ++ GFKVYFT+ W  LDF IV +SL+SL  +ILG+ +E+ A +SLRT+RALRPLRA+SR++GM++VV NAL+ AIPSIFNVLLVC++FWLIFSI GV  F GKF+ C +  + E     VV NK++C  L + H    W N  INFDN   G+LAL Q+ATF+GWM+IM  A+DS  I  QP  E  +  Y YFVIFI+ GSFF LNLFIGVIIDNFN+ K K  G   D+F+T  Q+ YYN MKKL ++KP+K + RP    QG  +D      F++ I+++I LNMV MM+E   Q+A    +L  IN  F  +FT E ++KI+ LR+HYF   WN
Sbjct:  943 CPCLDLDVSQGKGKAWWNFRKTCFAIVEHSYFETFIIFMILLSSGALAFEDIYIEQRRMIKIILEYADQVFTYVFVVEMLLKWVAYGFKVYFTNAWCWLDFLIVDVSLISLTANILGY-SELGAIKSLRTLRALRPLRALSRFEGMRVVVVNALVGAIPSIFNVLLVCLIFWLIFSIMGVNLFAGKFYYCFNETSEEVFDHNVVNNKTDCYELMEFHPEVRWMNGKINFDNVGMGYLALLQVATFKGWMDIMYSAVDSRAIESQPVYEANLYMYIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKAKLGGT--DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPTNCCQGLVFDFVTQQFFDIFIMVMICLNMVTMMVETDDQSAEIEEILFYINFAFIILFTGECVLKITALRYHYFSIGWN 1360          

HSP 3 Score: 290.426 bits (742), Expect = 9.816e-78
Identity = 157/325 (48.31%), Postives = 226/325 (69.54%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQPPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFKQMT 5364
            + + ++  F++PTL RV+R+ RIGRVLRLI+ AKGIR LLFAL++SLPALFNIG LL LI+FI+SI GMS F  +KK  G+DD++NFETF  SI+ +F +TT+ GW+ +L  +   PP C +  V   G   + + G+CG A  GI++  ++I + +L+++NMYIAIILENFN A  +    + EDDFEMFY  WE++DP ASQ+I Y  LS+F   L +PL IPKPN + L++ D+P+V GDK+HCLD+L+AL   V+G    S++   +K  ME K+    P++     IT+T+KRK+E++AA T+QRA++    +R  KQ +
Sbjct: 1376 LADLIEKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLIMFIFSIFGMSNFAYVKKEVGIDDMMNFETFGNSIICMFMITTSAGWDGLLAPILNSPPDC-DPDVDNPG---STTRGNCGNAAVGIVFFCSYIVMSFLVVVNMYIAIILENFNVATEESSDPLCEDDFEMFYETWEKFDPTASQFIDYNRLSEFCDTLKDPLRIPKPNTLKLITMDIPMVTGDKIHCLDLLLALTGEVLG---GSDQMDGMKATMEEKFMANNPSKASYEPITSTLKRKQEEVAASTIQRAYRSHILKRCVKQAS 1693          

HSP 4 Score: 104.76 bits (260), Expect = 7.551e-21
Identity = 72/255 (28.24%), Postives = 124/255 (48.63%), Query Frame = 3
Query: 1704 EDEVEIGNDTNNTDTAEMNPTIDRNCQCCIKQNVLCSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEV-----DALSIFRAFRLF---RVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIRANSPLC 2444
            E++ +  N      + +    I R   CC             Q  ++ FVT  FFD+FI   I +N + M  E        ++IL Y N  F +++  EC LKI AL   YF++GWNIFDFVVVI SI+ +G+ ++      + ++FR  RL    RV +L +  + +R LL  +  ++  + N+ +++ L++++F++ G  ++          D +   NF+ F +S+I +F I      +     I  + P C
Sbjct: 1257 EEQKKYYNAMKKLGSKKPQKPIPRPTNCC-------------QGLVFDFVTQQFFDIFIMVMICLNMVTMMVETDDQSAEIEEILFYINFAFIILFTGECVLKITALRYHYFSIGWNIFDFVVVILSILGIGLADLIEKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLIMFIFSIFGMSNFAYVKKEVGIDDMM---NFETFGNSIICMFMITTSAGWDGLLAPILNSPPDC 1495          

HSP 5 Score: 70.0922 bits (170), Expect = 2.611e-10
Identity = 66/279 (23.66%), Postives = 127/279 (45.52%), Query Frame = 3
Query: 1572 NGMSDADSSLCKNTTSIHENDDNFRFMDSEEEK-EGKDCDNKAEYEDEVEIGNDTNNTDTAEMNP-------------TIDRNC-------QC-CIKQNVLCSK---WVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASE--HYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIID-----LGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLT-IIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYH 2306
            N + ++ SS+ K   +  E+DD+     SE+E  EG+D + K +  DE      ++   T +  P             T   +C       +C C+  +V   K   W  F+   +  V   +F+ FI F I +++  +A E  +    +    IL+Y++ +FT ++++E  LK +A   K YF   W   DF++V  S+I      LG  E+ A+   R  R  R  +    ++ MR+++   +   I  + N+ ++ L+   +F+++G   +   ++
Sbjct:  857 NAIMNSSSSMVKVPIANGESDDDDGNGSSEDEDDEGRDINMKKKNGDE------SSTCSTVDKPPEVEDLVEEEEEDLTSPEDCYTENCIRRCPCLDLDVSQGKGKAWWNFRKTCFAIVEHSYFETFIIFMILLSSGALAFEDIYIEQRRMIKIILEYADQVFTYVFVVEMLLKWVAYGFKVYFTNAWCWLDFLIVDVSLISLTANILGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVVNALVGAIPSIFNVLLVCLIFWLIFSIMGVNLFAGKFY 1129          

HSP 6 Score: 68.5514 bits (166), Expect = 6.995e-10
Identity = 76/347 (21.90%), Postives = 144/347 (41.50%), Query Frame = 3
Query: 3018 CCYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKV----YFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFF-KCL-------------------DSNTRERLAATV--------------VPNKSE------------------CLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVI 3890
             CYC+         S ++  R  ++ I  H  F   I++ IL + + +   D      P      +++ Y+FT ++  E ++K++S GF +    +    W  LDF ++S++ L+          ++    +LRT R LR L+ I+   G+K +V ALI ++  + +V+++ +    +F++ G+Q F G    KC+                   D N      +T               VP + +                  CL+          ++DN    FLAL+++ T + W  + Q  + + G            Y  +FV+ I +GSF+++NL + V+
Sbjct:  109 ACYCL---------SPFNPVRRAAIRILIHSLFSLVIMLTILTNCVFMAMSD-----PPGWS---KILEYVFTGIYTFEAMVKVLSRGFCIGDFTFLRDPWNWLDFMVISMAYLTEF-------VDLGNISALRTFRVLRALKTITVIPGLKTIVGALIQSVKKLADVMILTVFCLSVFALIGLQLFMGNLRQKCVLWPPVGWYSDNLTVLSNYTDINGNGTANSTFDYQKYINSEENYYYVPGQMDPLVCGNSSDAGLCPEGYICLKAGRNPNYGYTSYDNFGWAFLALFRLMTQDFWENLFQLTLRAAG----------KTYMIFFVVIIFLGSFYLINLILAVV 421          

HSP 7 Score: 63.929 bits (154), Expect = 1.774e-8
Identity = 72/312 (23.08%), Postives = 132/312 (42.31%), Query Frame = 3
Query: 3006 KPFHCCYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXX--XXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIM----------QDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFN 3905
            +P +CC  +V D  T                   + F+  I+V I  + + +  E    D +  +++ L  IN+ F  LF  E +LKI +L +  YF+  W I      I+SI  + L + I  +    T FR +R  R  R LR I   +G++ ++ AL+ ++P++FN+ L+  +   IFSI G+  F                             +     +  +NF+   N  + ++ I T  GW  ++             +D+ G   +    N      +F  +I++    ++N++I +I++NFN
Sbjct: 1280 RPTNCCQGLVFDFVT------------------QQFFDIFIMVMICLNMVTMMVETD--DQSAEIEEILFYINFAFIILFTGECVLKITALRYH-YFSIGWNIFDFVVVILSILGIGLADLIEKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLIMFIFSIFGMSNF--------------------------AYVKKEVGIDDMMNFETFGNSIICMFMITTSAGWDGLLAPILNSPPDCDPDVDNPGSTTRGNCGNAAVGIVFFCSYIVMSFLVVVNMYIAIILENFN 1544          

HSP 8 Score: 57.3806 bits (137), Expect = 1.631e-6
Identity = 78/331 (23.56%), Postives = 143/331 (43.20%), Query Frame = 3
Query:  495 WSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYP--------ISEY---VFLAIYTLEMVIRMTSRGVII---NSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLK-TITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAG--NCSKTNPNSICLPHIGPNPNF----GYTNFDNFGWALLSMFQLITLDYWEN-QYNLV-IRASGSWNI--------LFYIIVVFFGSFYLINLMLAVV 1394
            W   RK    I  +  F+ FI+  IL++   LA  + Y         I EY   VF  ++ +EM+++  + G  +   N++ +L   + +VD+ +I L+  ++   +        + SLRTLR LR L+ ++   G++  + +AL+ ++  +F V+   L C+ F+ +F++                          N F   FYY                  C N++S    + +  N  + C   +  +P      G  NFDN G   L++ Q+ T   W +  Y+ V  RA  S  +        ++++I + FGSF+ +NL + V+
Sbjct:  958 WWNFRKTCFAIVEHSYFETFIIFMILLSSGALAFEDIYIEQRRMIKIILEYADQVFTYVFVVEMLLKWVAYGFKVYFTNAWCWLD--FLIVDVSLISLTANILGYSELGA-----IKSLRTLRALRPLRALSRFEGMRVVVVNALVGAIPSIFNVL---LVCLIFWLIFSIM-----------------------GVNLFAGKFYY------------------CFNETSEEVFDHNVVNNKTDCYELMEFHPEVRWMNGKINFDNVGMGYLALLQVATFKGWMDIMYSAVDSRAIESQPVYEANLYMYIYFVIFIIFGSFFTLNLFIGVI 1237          
BLAST of Sodium channel protein vs. TrEMBL
Match: A0A2Y9DGL0 (Sodium channel protein OS=Trichechus manatus latirostris OX=127582 GN=LOC101352965 PE=3 SV=1)

HSP 1 Score: 815.453 bits (2105), Expect = 0.000e+0
Identity = 530/1428 (37.11%), Postives = 807/1428 (56.51%), Query Frame = 3
Query:  261 KFEVEDFSDNCQPDPELVAGSILLEDKLGEFPEELLGKPLNEIDQNLKDK-SFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPIS---EYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVD--------------------------WKNVMSENHSNEFVNAFYYNW----THNPNNWIRNGIN-YLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHDKDQMKDLKITNGMSDADSSLCKNTTSIHENDDNFRFMDSEEEKEGKDCDNKAE-YEDEVEIGNDTNNTDTAEMNPTIDRNCQC------CIKQNVL---CSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSK-EYFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHT---QIFGD-NIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIR-ANSPLCLLIFIPTXXXX-XXXXXXXXXXXXXXXXXXXXXKNTADEDVSKLKIVIERLRNIYPMSRNNPLGINKGNQELDSTETLKDIVVNFG--CE--NAAELQNNHEKMRIIKNCKDLSTSNE--------LVNLLPSTGSLSKGNKLINNAIXXXXXXXXXXGKHLXXXXXXXXXXXXXXIDEESVNELKGCCCAIC-----------------YNPFQEKKPFHC----CY----CIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHT----WANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            + E+ED     +P  +L AG  L     G+ P E++G PL ++D    DK +F+V+N   K K I+R+SAT +  +  P+S IR+ A+ +  + +F  FIM+TIL NCVF+ +++  P S   EY F  IYT E +I++ ++G  I+ +T+LRDP+N +D  +I+++Y+   V+        N+S+LRT RVLRALKTIT++PGLKTI  ALI+S+K L +V+IL++FC+S FAL  LQ++ G LR KCV+                             W +  + N    +V+ F ++W    +   N +   G N  L CGN S AG+C    P        G NPN+GYTN+D F WA L++F+L+T DYWEN + L +RA+G   ++F+++++F GSFYLINL+LAVV+M+Y E+ EA   E +E+                              ++ Q    K      + + +         E D +           GKDC+   +    E      +++TD+A M    + + +C      C    ++   C+ W+ F+  +++ V DPF DL I+ CI +NT+ MA EHYP  + +D++L   N++FT I+  E  LK++A+   EYF  GWNIFD ++V  S+++LG+  V  LS+ R+FRL RVFKLA+SW T+ +L+ II +++  +GNL++++ +++++FAV+G Q +  +Y     +I  D ++PRW+ +DF+HS +++FRI+CGEWIE  +DC+  A   +CL +F+  +V+G   V+      LL +  A     +  D +++ L+I I R++     ++   LG+  G        + K+I+++ G  CE   A E     EK  +     D+    +        L +  P++  L   N  INN           +   L    + + +  +E  D +    L     ++C                  NP + ++P  C    C     C+  DI    G RW   R     I EH  FE  I+  IL SS  L FEDI+++  P ++  L   + +FTY+F +EM+LK ++ GFKVYFT+ W  LDF IV +S++SL+ + +G+ +E+   +SLRT+RALRPLRA+SR++GM++VVNAL+ AIPSI NVLLVC++FWLIFSI GV  F GKF+ C+++ T ER   + V NKSEC    HT    W N  +N+DN   G+L+L Q+ATF+GWM+IM  A+DS     QPK E  +  Y YFVIFI+ GSFF LNLFIGVIIDNFN+ K K+ G   D+F+T  Q+ YYN MKKL ++KP+K + RP+  +QG  YD+ M   F++ I+ILI LNMV MM+E   Q+    ++L  IN++F  IFT E ++K+  LR +YF   WN
Sbjct:   44 QMEIEDAEH--KPRSDLEAGKNL-PLIYGDPPPEVIGIPLEDLDPYYCDKKTFIVLN---KGKAIFRFSATPALYMLNPFSIIRRGAIKVLIHSLFSMFIMITILSNCVFMTMSDPPPWSKNVEYTFTGIYTFESLIKILAQGFCIDDFTFLRDPWNWLDFSVIVMAYLTEFVDLG------NISALRTFRVLRALKTITVIPGLKTIVGALIQSVKRLSDVMILTVFCLSVFALVGLQLFMGNLRQKCVRWPPPFNNTNTTWYGNDTWYGNDTWYGNDTWYSNDTWNSRESWVSNFPFDWDAYISDEGNFYFLEGSNDALLCGNSSDAGHC----PEGYKCIKTGRNPNYGYTNYDTFSWAFLALFRLMTQDYWENLFQLTLRAAGKTYMIFFVVIIFLGSFYLINLILAVVAMAYAEQNEATLAEAQEK-----------------------------EEEFQQMLQKFKKQQEELEKAKAAQALEGGEADGD--------PAHGKDCNGSLDTAPGEKGPPRQSHSTDSA-MEELEEAHQKCPPWWYKCAHTVLIWNCCTPWMKFRRIIHLIVMDPFVDLGITICIVLNTLFMAMEHYPMTEHFDNVLTVGNLVFTGIFTAEMVLKLIAMDPYEYFQQGWNIFDSIIVTLSLVELGLANVQGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKIAADCSLPRWHMNDFFHSFLIIFRILCGEWIETMWDCMEVAGQAMCLTVFLMVMVIGNLVVLNLFLALLLSSFSADSLAASDEDGEMNNLQIAIGRIKWGIGFAKAFLLGLVHGK-----VLSPKEIMLSLGEPCEAMEAGESAPEDEKKELPPEEGDIDLKKDNHILKHMGLADGSPTSVELDHLN-FINNPYLTIQVPIASEESDLEMPTEDETDTFSEPEDGKQPQPLYDGNSSVCSTADYKPPEEDPEEQAEENP-EGEQPEECFTEACVQRFPCLYVDISQGHGKRWWTLRRACFKIVEHNWFETFIVFMILLSSGALAFEDIHIEQRPVIRTILEYADKVFTYVFIMEMLLKWVAYGFKVYFTNAWCWLDFLIVDVSIISLVANWMGY-SELGPIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYYCINTTTSERFDISEVNNKSECESLMHTGQVRWLNVKVNYDNVGLGYLSLLQVATFKGWMDIMYAAVDSREKEEQPKYEVNIYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGK--DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPQNKIQGMVYDLVMKQAFDITIMILICLNMVTMMVETDDQSQLKVDILYNINMIFIIIFTGECVLKMFALRQYYFTIGWN 1407          

HSP 2 Score: 297.745 bits (761), Expect = 1.632e-77
Identity = 170/336 (50.60%), Postives = 227/336 (67.56%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQ-PPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFKQMTENATLSSRHD 5394
            + E ++  F++PTL RV+R+ RIGR+LRLI+ AKGIR LLFAL++SLPALFNIG LL L++FIYSI GMS F  +KK  G+DD+ NFETF  SI+ LF +TT+ GW+ +L  +    PP C+   +L +    +   GDCG    GI +  ++I I +LI++NMYIAIILENFN A  +    + EDDFEMFY  WE++DP A+Q+I Y+ LSDFV  L EPL I KPN I L++ DLP+V GDK+HCLDIL AL K V+G   DS E   +K+ ME K+    P++V    ITTT+KRK E++ A  +QRA++    QR+ KQ    A+   RH 
Sbjct: 1423 LSELIQKYFVSPTLFRVIRLARIGRILRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYSIFGMSNFAYVKKESGIDDMFNFETFGNSIICLFEITTSAGWDGLLNPILNSGPPDCD--PMLENP--GSSVRGDCGNPSIGICFFCSYIIISFLIVVNMYIAIILENFNVATEESSEPLCEDDFEMFYETWEKFDPEATQFIDYSRLSDFVNTLQEPLRISKPNKIKLITLDLPMVPGDKIHCLDILFALTKEVLG---DSGEMDALKQTMEEKFMAANPSKVSYEPITTTLKRKHEEVCAIKIQRAYRRHLLQRSMKQ----ASYMYRHS 1747          

HSP 3 Score: 84.7297 bits (208), Expect = 2.637e-12
Identity = 61/193 (31.61%), Postives = 104/193 (53.89%), Query Frame = 3
Query: 1830 QNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEV-----DALSIFRAFRLF---RVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRI 2384
            Q  +Y  V    FD+ I   I +N + M  E     +   DIL   N+IF +I+  EC LK+ AL + YF +GWNIFDFVVVI SI+ L + E+      + ++FR  RL    R+ +L +  + +R LL  +  ++  + N+ +++ LV++++++ G  ++          D    +NF+ F +S+I +F I
Sbjct: 1333 QGMVYDLVMKQAFDITIMILICLNMVTMMVETDDQSQLKVDILYNINMIFIIIFTGECVLKMFALRQYYFTIGWNIFDFVVVILSIVGLALSELIQKYFVSPTLFRVIRLARIGRILRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYSIFGMSNFAYVKKESGIDD---MFNFETFGNSIICLFEI 1522          
BLAST of Sodium channel protein vs. TrEMBL
Match: V4BZG2 (Sodium channel protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_118343 PE=3 SV=1)

HSP 1 Score: 717.998 bits (1852), Expect = 0.000e+0
Identity = 389/845 (46.04%), Postives = 537/845 (63.55%), Query Frame = 3
Query: 1767 IDRNCQCCIKQNVLCSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFG-DNIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIRANSPLCLLIFIPTXXX---XXXXXXXXXXXXXXXXXXXXXXKNTADEDVSKLKIVIERLRNI----YPMSRNNPLGINKGNQELDS---TETLKDIVVNFGCENAAELQNNHEKMRIIKNCKDLSTSNELVNLLPSTGSLSKGNKLINNAIXXXXXXXXXXGKHLXXXXXXXXXXXXXXIDEESVNELKGCCCAICYNPFQEKKPFHCCYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLR-QNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            +DRNC  C         W+ FQN ++ F+TDP  DLFI+ CI +NTIIMA E +   +T  + ++ SN +FT ++ +E  LKI+ALSK YF  GWNIFDFV+V+AS+IDLG+E++D LS+FR FRL RVF+LAQSW TMR+L++II +T   +GNL++++ +++Y+FAV G Q +  +Y    F  D IPRWNF  F+H+ +++FR++CGEWIEP +DC+RA   LC+L+F+P LVL       +    L     + + +  K +  +D S+ K+   R++++     P + N      +G +++     T   +D   +FG           + +  +K   DL    +  +       L  G+   ++                               + E   EL+ C    C       K F        D  TP G  W   R     I +++ FE  IL  I ASS+ L FED++L+ N  LK AL  +N IF  +F  EM+ K  + G   YFT+FWT+LDF IV IS+ SLI + LG  + +TAFRSLRT+RALRPLRAISR Q M+IVVNAL+ AIP+IFNV +VC+VFWLIFSI GVQFF GKF+KC+D N  E L  TVVPNK+ECLR  N+ W NSN+NFDN   G+LAL+Q+ATFEGWME+M+DAIDST +++QPK EN + YY YFV FI+ GSFF LNL IGVIIDNFN LK KY+G+Y+D+FLT +QRNYYNT+KKL N+KP+KT++RPK   QGFF+D+A SN+FEL I+++IFLNM+ + IE Y+Q+    + L ++NI+F+ IF LE ++K+ G+RWHYFR  WN
Sbjct:  383 VDRNCNICSSCCRCFVPWIKFQNIIHRFITDPLLDLFITLCILMNTIIMACESHEMSETTQETIRISNYVFTSVFTLEAILKIIALSKYYFASGWNIFDFVIVLASLIDLGLEDIDGLSVFRTFRLLRVFRLAQSWSTMRILISIIVNTFGALGNLTVVLFIIIYIFAVTGLQLFNRSYTADKFSPDGIPRWNFSSFFHAAMMIFRVLCGEWIEPLYDCMRAEDELCMLVFLPALVLGNFMVLNLFLALLLNAFATDSLNKHKESNKDDTSRFKLAFHRIKHLCCCCLPGNSNVVKPDERGEEDVIGQFETSEKRDKFADFG-----------KALDGMKKEVDLEKGEKKDDGDKDVDGLELGDTAEDHK------------------------------EGEEPPELRDCLPLCCTKGISCSKSF--------DPSTPFGKFWKRMREACSKIVDNKIFEYGILFVIFASSVTLAFEDVHLEENQELKLALYYLNIIFCVIFVAEMLFKWFAYGLWKYFTNFWTLLDFLIVCISVASLIAESLGI-SNLTAFRSLRTLRALRPLRAISRLQSMRIVVNALMRAIPAIFNVFIVCMVFWLIFSIMGVQFFAGKFYKCVDGNG-EILLNTVVPNKTECLRNSNYKWKNSNVNFDNVLQGYLALFQVATFEGWMEVMRDAIDSTEVDVQPKFENNIYYYLYFVAFIIFGSFFTLNLIIGVIIDNFNVLKKKYDGSYLDMFLTPNQRNYYNTLKKLGNKKPQKTIKRPKTKFQGFFFDIATSNKFELSIIVIIFLNMITLAIESYKQSDTIRDALKILNIIFTVIFILECMIKLIGMRWHYFRQFWN 1176          

HSP 2 Score: 386.341 bits (991), Expect = 7.135e-106
Identity = 201/330 (60.91%), Postives = 266/330 (80.61%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLD-DLVNFETFERSILLLFRLTTAGGWNDILEAMFIQPPYCN-NTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFKQMTENA 5373
            +++ L   F+TPTLLRV R+FRIGRVLRLIK AKG+RKLLFAL+ISLPA+ NIGALL LI++IY+I+GMS F NL+ +  ++ D+VNF+TF  SI+LLFRL+T+ GWN+IL+ + I+ P C+ +T  L +G     + G+CG  W  I YM T+IFI YL+IINMYIA+ILENFNQAH QEEVGITEDDF+MFY+VWERYDP A+Q+IKY  LSDF+A+L+EPLGIPKPN I +V+F+LPIVEGDK+HCLDIL+ALVK  +G ++++EE + + ++ME K+ ++FP+RV T   +TTM+RKKED+AA+TLQR W+  K Q+A K +T  A
Sbjct: 1192 LDDLLAGVFVTPTLLRVGRVFRIGRVLRLIKAAKGLRKLLFALIISLPAIVNIGALLALIMYIYAILGMSSFKNLRVSPMMNNDIVNFQTFANSIILLFRLSTSAGWNEILDPLLIEYPDCDPDTIELSNGQRIKQTYGECGIPWLAIPYMVTYIFIAYLVIINMYIAVILENFNQAHEQEEVGITEDDFDMFYVVWERYDPLATQFIKYDVLSDFLADLEEPLGIPKPNEITIVAFNLPIVEGDKLHCLDILMALVKKHLGSVDETEESKALHKKMETKFGDIFPSRVMTVKKSTTMQRKKEDVAARTLQRCWRSFKTQKALKNITSLA 1521          

HSP 3 Score: 340.502 bits (872), Expect = 3.696e-91
Identity = 181/337 (53.71%), Postives = 253/337 (75.07%), Query Frame = 3
Query:  408 KSFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPISE---YVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNV-NVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
            ++FVVI  RFK K+IYR+S+T +F L  PW+ +R+LA+ I+TNQ FDYF++LTI+VNCVF+ +  D  I+E   Y+FLAIY +EM+I++T+RG II+ YTYLRD +N +D ++I+L+++ I+++  Y   ++ N+  LRT RVLRALKT++I+PGLKTI +AL+++ KML +VI+L+ FC+  FALF LQ+YQG LR+KCV  + +        + E  +  Y N   N +NW     +Y+ CGN S AG C +   N  CLP IG NPN+GYTN+DNFGWA+L+ FQLITLD+WE+ Y+ VIRASG WN++F+I+VVFFGSFYLINLMLAVV++SY
Sbjct:   12 QTFVVIAKRFKKKFIYRFSSTSAFFLLPPWNPLRQLAVRIATNQFFDYFVILTIIVNCVFMTMP-DLQITETLEYIFLAIYVVEMLIKVTARGFIIDKYTYLRDGWNWLDFIVIVLAFVTILIQLIYPDLSIGNLQVLRTFRVLRALKTVSIVPGLKTIVNALLRAFKMLIDVIMLTFFCLMVFALFGLQVYQGVLRHKCVSDLPFD---PNTTTPETYDTLYANHIRNISNWYGEPNDYMLCGNTSGAGGCPE---NFTCLPDIGDNPNYGYTNYDNFGWAILNAFQLITLDFWEDNYDKVIRASGPWNVVFFILVVFFGSFYLINLMLAVVALSY 341          

HSP 4 Score: 112.849 bits (281), Expect = 7.065e-21
Identity = 68/214 (31.78%), Postives = 118/214 (55.14%), Query Frame = 3
Query: 1827 FQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEVDA--------LSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIRANSPLC 2444
            FQ   +   T   F+L I   IF+N I +A E Y    T  D LK  NIIFTVI+I+EC +K++ +   YF   WN+FDF++V+ S+  L ++++ A        L + R FR+ RV +L ++ + +R LL  +  ++  + N+  ++ L++Y++A++G  S++N   + +  ++I   NF  F +S+IL+FR+          D +    P C
Sbjct: 1101 FQGFFFDIATSNKFELSIIVIIFLNMITLAIESYKQSDTIRDALKILNIIFTVIFILECMIKLIGMRWHYFRQFWNVFDFIIVLLSVTGLILDDLLAGVFVTPTLLRVGRVFRIGRVLRLIKAAKGLRKLLFALIISLPAIVNIGALLALIMYIYAILGMSSFKNLRVSPMMNNDIV--NFQTFANSIILLFRLSTSAGWNEILDPLLIEYPDC 1312          

HSP 5 Score: 84.3445 bits (207), Expect = 2.896e-12
Identity = 80/294 (27.21%), Postives = 134/294 (45.58%), Query Frame = 3
Query: 3096 ITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXX--XXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAI------DSTGINLQPKKENQMAY---------YAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYE 3926
            I     FE +I+V I  + I L  E      + T++ AL+++N IFT +F +E ++K+I + +  YF  FW + DF IV +S+  LI    + G     T  R  R  R  R LR I   +G++ ++ ALI ++P+I N+  +  +   I++I G+  FK                          LR +    N  +NF    N  + L++++T  GW EI+   +      D   I L   +  +  Y           Y V +I +    I+N++I VI++NFN+   + E
Sbjct: 1108 IATSNKFELSIIVIIFLNMITLAIES--YKQSDTIRDALKILNIIFTVIFILECMIKLIGMRWH-YFRQFWNVFDFIIVLLSVTGLILDDLLAGVFVTPTLLRVGRVFRIGRVLRLIKAAKGLRKLLFALIISLPAIVNIGALLALIMYIYAILGMSSFKN-------------------------LRVSPMMNNDIVNFQTFANSIILLFRLSTSAGWNEILDPLLIEYPDCDPDTIELSNGQRIKQTYGECGIPWLAIPYMVTYIFIAYLVIINMYIAVILENFNQAHEQEE 1373          

HSP 6 Score: 83.5741 bits (205), Expect = 4.682e-12
Identity = 97/460 (21.09%), Postives = 192/460 (41.74%), Query Frame = 3
Query: 3066 WHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKV----YFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKF-FKCLDSNTRERLAATVVPNKSECLRQNHTWANSN--------------------------------------INFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVI-------IDNFNRLKNKYEGNYIDVFLTA--SQRNYYNTMK---KLSNRKPRKTVRRPKALV-----QGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            W+  R  ++ I  ++ F+  +++ I+ + + +   D+         Q    + YIF  ++ +EM++K+ + GF +    Y    W  LDF ++ ++ ++++  ++     +   + LRT R LR L+ +S   G+K +VNAL+ A   + +V+++     ++F++ G+Q ++G    KC+     +    T  P   + L  NH    SN                                       N+DN     L  +Q+ T + W +     I ++G    P                  GSF+++NL + V+        +N  ++   Y  N  + FL    S+++ ++ M    +L +R         +  V     Q   +        +L I + I +N ++M  E +  +      + + N +F+++FTLEAI+KI  L  +YF   WN
Sbjct:   41 WNPLRQLAVRIATNQFFDYFVILTIIVNCVFMTMPDL---------QITETLEYIFLAIYVVEMLIKVTARGFIIDKYTYLRDGWNWLDFIVIVLAFVTILIQLIYPDLSIGNLQVLRTFRVLRALKTVSIVPGLKTIVNALLRAFKMLIDVIMLTFFCLMVFALFGLQVYQGVLRHKCVSDLPFD--PNTTTPETYDTLYANHIRNISNWYGEPNDYMLCGNTSGAGGCPENFTCLPDIGDNPNYGYTNYDNFGWAILNAFQLITLDFWEDNYDKVIRASG----PWNVVFFILVV------FFGSFYLINLMLAVVALSYEEEAENAGKVNTMYT-NEKEAFLKHQDSRQSLHDAMSYDGQLVDRNCNICSSCCRCFVPWIKFQNIIHRFITDPLLDLFITLCILMNTIIMACESHEMSETTQETIRISNYVFTSVFTLEAILKIIALSKYYFASGWN 478          

HSP 7 Score: 73.9442 bits (180), Expect = 4.661e-9
Identity = 66/282 (23.40%), Postives = 119/282 (42.20%), Query Frame = 3
Query: 1707 DEVEIGNDTNNTDTAEMNPTIDRNCQCCIKQNVLCSK-----------WVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASE--HYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSK-EYFNVGWNIFDFVVV---IASII--DLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDN-------IP-----------RW-----NFDDFWHSMILVFRIICGE-WIEPSFDCI 2423
            D +E+G+   +    E  P +      C  + + CSK           W   +      V +  F+  I F IF +++ +A E  H    +     L Y NIIF VI++ E   K  A    +YF   W + DF++V   +AS+I   LG+  + A    R  R  R  +     Q+MR+++  +   I  + N+ I+ ++   +F+++G Q +   ++  + G+        +P           +W     NFD+     + +F++   E W+E   D I
Sbjct:  730 DGLELGDTAEDHKEGEEPPELRDCLPLCCTKGISCSKSFDPSTPFGKFWKRMREACSKIVDNKIFEYGILFVIFASSVTLAFEDVHLEENQELKLALYYLNIIFCVIFVAEMLFKWFAYGLWKYFTNFWTLLDFLIVCISVASLIAESLGISNLTAFRSLRTLRALRPLRAISRLQSMRIVVNALMRAIPAIFNVFIVCMVFWLIFSIMGVQFFAGKFYKCVDGNGEILLNTVVPNKTECLRNSNYKWKNSNVNFDNVLQGYLALFQVATFEGWMEVMRDAI 1011          

HSP 8 Score: 68.1662 bits (165), Expect = 2.552e-7
Identity = 81/336 (24.11%), Postives = 141/336 (41.96%), Query Frame = 3
Query:  462 SATKSFLLCAP----WSGIRKLALLISTNQIFDYFIMLTILVNCVFLAL-------NNDYPISEY----VFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRAS----------GSWNILFYIIVVFFGSFYLINLMLAVV 1394
            S +KSF    P    W  +R+    I  N+IF+Y I+  I  + V LA        N +  ++ Y    +F  I+  EM+ +  + G+    + Y  + + L+D LI+ +S   +I E     N     SLRTLR LR L+ I+ L  ++ + +AL++++  +F V I+ +     F++  +Q + G    KCV          + +    +N    N T               C  +S   N    N N                NFDN     L++FQ+ T + W       I ++            +  L+++  + FGSF+ +NL++ V+
Sbjct:  763 SCSKSFDPSTPFGKFWKRMREACSKIVDNKIFEYGILFVIFASSVTLAFEDVHLEENQELKLALYYLNIIFCVIFVAEMLFKWFAYGL----WKYFTNFWTLLDFLIVCISVASLIAESLGISNLTAFRSLRTLRALRPLRAISRLQSMRIVVNALMRAIPAIFNVFIVCMVFWLIFSIMGVQFFAGKFY-KCV----------DGNGEILLNTVVPNKTE--------------CLRNS---NYKWKNSN---------------VNFDNVLQGYLALFQVATFEGWMEVMRDAIDSTEVDVQPKFENNIYYYLYFVAFIIFGSFFTLNLIIGVI 1051          
BLAST of Sodium channel protein vs. TrEMBL
Match: K1PYF7 (Sodium channel protein OS=Crassostrea gigas OX=29159 GN=CGI_10003777 PE=3 SV=1)

HSP 1 Score: 714.531 bits (1843), Expect = 0.000e+0
Identity = 423/922 (45.88%), Postives = 589/922 (63.88%), Query Frame = 3
Query: 1590 DSSLCKNTTSIHENDDNFRFMDSEEEKEGKDCDNKAEYEDEVEIGNDTNNTDTAEMNPTIDRNCQCCIKQNVLCSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFG-DNIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIRANSPLCLLIFIPTXXXXXXXXXXXXXXXXXXXXXXXXXKN-TADEDVSKLKIVIERLRNI---------YPMSRNNPLGINKGNQE-------LDSTETLKDIVVNFGCENAAELQNNHEKMRIIKNCK-------DLSTSNELVNLLPSTGSLSKGNKLINNAIXXXXXXXXXXGKHLXXXXXXXXXXXXXXIDEESVNELKGCCCAICYNPFQEKKPFHCCYCIVCDI-ETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLR----QNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            DS    +++ IH  D +    D+E  K+          + E   G +  NT        +DRN +C          W+  QN ++I V+DP FDLFI+FCI INTI M  E++   +   D   ++N +FT+I+ +E  LK+ A  K YF+ GWN FD V+V+AS +D G+ +V+ +++ R FRL RVFKLAQ+W+TMR+LL+II +T+  +GNL++I+++++Y+FAVIG Q +RN+Y    FG D +PRWNF+ F+H+++L+FRI+CGEWIE  ++C+RA   LC+++F+PTLV G F+VLNLFLALLLN+F S+SLK    D +  KL +   +++N+            +R   +G ++ ++E       L+  +  KD  V  G   A  +++   K  + +  K       D   + +      ST S S           ++   +   G  L  E           +D+E  +E K      C  PF         + +  D  E+  G +W+ FR     I EH+AFE  ILVCI  SS+ L FED+YL   P L+ AL   N IF  LF +EM++K ++LGFK YFTSFWTILDF IV ISL SLI D  G G +++AFRSLRT+RA RPLRAISRWQ M+IVVNAL+ AIP+I NVL+VC+VFWLIFSI GVQFF G+F+KC DS + E L  +VV NKS+CL      N++W NSNINFDN  NG+LAL+Q+AT+EGWME+M DAIDST ++ QP  EN +  Y YFV FI+ GSFF LNL IGVIIDNFN LK KY+G+ +D+FLT  Q+NY NT+KKL ++KP+KT++RPKA +Q  FYDV++S++F+L IVI+IFLNM+ M ++HY+ T   +N+LD++NI+F+TIFTLE ++KI GLR HYFR  WN
Sbjct:  659 DSLANVSSSGIHLGDSD----DTESAKQKPKKPPPKIIKGEESTGKNEPNT-------LVDRNHECLAGCCKCYIPWLRVQNLVFILVSDPLFDLFITFCILINTIFMGIEYHNMPQGLVDATTWANFVFTIIFTLEAVLKLCAFGKFYFSNGWNNFDLVIVVASWLDFGLSDVEGVNVIRTFRLLRVFKLAQAWRTMRVLLSIIMNTLGALGNLTVILVIIIYIFAVIGLQLFRNSYTADKFGEDGVPRWNFNTFFHALMLIFRILCGEWIEELWNCMRAADELCMVVFLPTLVFGYFIVLNLFLALLLNAFGSESLKGGDTDAEDDKLALAFAKIKNLCCCCCSKFRKKTARTASVGPDEMDEEKQIGMTDLEDDKQAKDKPVANGTVKANGVKHKDGKEEVDEAFKAKRDKFSDFDAARKASKAKDSTASNSGSTSKAEKDGKDSKEKKDKDGMALGAEADG--------MDDED-DENKETVVEDCLPPF-----CMANHALWSDFDESNFGKKWNKFRFFMCKIVEHKAFEYFILVCIGLSSMSLAFEDVYLYTRPELEAALYYTNIIFAVLFTVEMLMKWVALGFKKYFTSFWTILDFAIVVISLASLIADATG-GEDISAFRSLRTLRAFRPLRAISRWQSMRIVVNALMLAIPAILNVLVVCMVFWLIFSIMGVQFFSGRFYKCKDS-SGEVLLPSVVANKSQCLAMAATHNYSWVNSNINFDNVLNGYLALFQVATYEGWMEVMDDAIDSTKVDEQPSFENNLFMYLYFVAFIIFGSFFTLNLIIGVIIDNFNALKKKYDGSALDMFLTQGQKNYMNTLKKLGSKKPQKTIKRPKAAIQAVFYDVSVSSKFDLCIVIVIFLNMIAMAVDHYKMTDYVSNILDILNILFTTIFTLECVIKIIGLRHHYFRQPWN 1553          

HSP 2 Score: 407.527 bits (1046), Expect = 8.145e-112
Identity = 210/337 (62.31%), Postives = 268/337 (79.53%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQPPYCNNTHVLR-DGVYK-AISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFKQMTENATLSSRHD 5394
            + + L  SF  PTLLRV+R+FRIGRVLRLIK AKGIRKLLFAL+ISLPAL NIGALL LI++IY+I+GMSVFGN+K    +DD VNF+TF  S +LL RL+T+ GWNDILE MF+  P C+     R DGV +   S GDCG+  FG+ YM ++I I +L++INMYIAIILENFNQAH  EEVGITEDDF+ FY+VWE+YDP A+Q+IKY +LS FV ELD PLGIP+PN IALV+FDLPIVEGDK+HCLD+LIAL K+V+G +E++EEF+++K QME K++E FP RV+T+  ++TM++KKED+AAKTLQRAW+  K Q+  + +T+ A   +  D
Sbjct: 1569 LADVLANSF-NPTLLRVLRVFRIGRVLRLIKAAKGIRKLLFALIISLPALINIGALLCLIMYIYAIIGMSVFGNMKIELPMDDTVNFQTFANSFVLLLRLSTSAGWNDILETMFLSEPDCDPDFATRPDGVSRFKYSTGDCGSPAFGVFYMVSYILIIFLVVINMYIAIILENFNQAHEAEEVGITEDDFDEFYVVWEKYDPLATQFIKYEHLSHFVGELDPPLGIPRPNEIALVAFDLPIVEGDKIHCLDVLIALCKNVLGRVEETEEFKELKSQMEEKFQETFPTRVNTSKTSSTMQKKKEDVAAKTLQRAWRTFKTQKQLRNLTKMALQKAEAD 1904          

HSP 3 Score: 383.645 bits (984), Expect = 3.383e-104
Identity = 217/401 (54.11%), Postives = 282/401 (70.32%), Query Frame = 3
Query:  243 LVDGELKFEVEDFSDNCQPDPELVAGSILLEDKLGEFPEELLGKPLNEIDQNLKDKSFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPIS---EYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVE-----KCYGQNN---VNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYN-WTHNPNNWIRNGIN-YLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
            LVDGELKFE ++       DP L  G+IL ++   EFP EL GKPL EID+ +KDK+FV I  RF  KYI+R+ ATK+  L  PW+ +RKL++ I+TNQ FDY ++LTIL NCVFLA+ +D P S   EYVFL IYT+E V+++ +RG+IIN +TYLRDP+N +D ++II +YI I+++        G+ +    N   LRT RVLRALKT++I+PGLKTI  AL+++ K+LFEVIIL+ FC+  FALF LQ+Y G LR KCV      +V +   +    N  YYN W  N +NW +N    YL CGN S++G C        CLP IG NPN+GYT+FD+FGWA+L+ FQLITLD+WE+ YN VIRA G  N+LF++IVVFFGSFYLINLMLAVV+MSY
Sbjct:   87 LVDGELKFEEDEEESKKTRDPALQEGNILPDELGDEFPSELYGKPLEEIDKYIKDKTFVAIAPRFSNKYIHRFHATKALGLLTPWNPVRKLSVYIATNQFFDYLVILTILCNCVFLAMPDD-PASETAEYVFLGIYTMECVVKILARGLIINKFTYLRDPWNWLDFIVIISAYITIVIDMTSTPSAEGEEDGSVFNPQMLRTFRVLRALKTVSIVPGLKTIVGALLRAFKLLFEVIILTTFCLMIFALFGLQVYLGVLRQKCV-----ADVPAYTATASLSNTAYYNDWIKNSSNWYQNEEGEYLICGNASASGECPG---GYTCLPDIGENPNYGYTSFDHFGWAMLTSFQLITLDFWEDTYNKVIRAMGPLNVLFFVIVVFFGSFYLINLMLAVVAMSY 478          

HSP 4 Score: 108.227 bits (269), Expect = 1.759e-19
Identity = 65/203 (32.02%), Postives = 106/203 (52.22%), Query Frame = 3
Query: 1797 QNVLCSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEVDA-------LSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRI 2384
            Q  +     A Q   Y       FDL I   IF+N I MA +HY       +IL   NI+FT I+ +EC +KI+ L   YF   WN+FDFVVV+ S++ + + +V A       L + R FR+ RV +L ++ + +R LL  +  ++  + N+  ++ L++Y++A+IG   + N        D +   NF  F +S +L+ R+
Sbjct: 1468 QKTIKRPKAAIQAVFYDVSVSSKFDLCIVIVIFLNMIAMAVDHYKMTDYVSNILDILNILFTTIFTLECVIKIIGLRHHYFRQPWNVFDFVVVVLSLLGIVLADVLANSFNPTLLRVLRVFRIGRVLRLIKAAKGIRKLLFALIISLPALINIGALLCLIMYIYAIIGMSVFGNMKIELPMDDTV---NFQTFANSFVLLLRL 1667          

HSP 5 Score: 82.4185 bits (202), Expect = 1.354e-11
Identity = 73/303 (24.09%), Postives = 134/303 (44.22%), Query Frame = 3
Query: 1536 HDKDQMKDLKITNGMSDADSSLCKNTTSIHENDDNFR--------FMDSEEEKEGKDCD-------NKAEYEDE----------VEIGNDTNNTDTA--EMNPTIDRNC--QCCIKQNVLCS---------KWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASE--HYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIIDL-----GVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYH 2306
             D  Q KD  + NG   A+    K+     E D+ F+        F  + +  + KD         +KAE + +          + +G + +  D    E   T+  +C    C+  + L S         KW  F+  +   V    F+ FI  CI ++++ +A E  +  +    +  L Y+NIIF V++ +E  +K +AL  K+YF   W I DF +V+ S+  L     G E++ A    R  R FR  +    WQ+MR+++  +   I  + N+ ++ ++   +F+++G Q +   ++
Sbjct: 1022 EDDKQAKDKPVANGTVKANG--VKHKDGKEEVDEAFKAKRDKFSDFDAARKASKAKDSTASNSGSTSKAEKDGKDSKEKKDKDGMALGAEADGMDDEDDENKETVVEDCLPPFCMANHALWSDFDESNFGKKWNKFRFFMCKIVEHKAFEYFILVCIGLSSMSLAFEDVYLYTRPELEAALYYTNIIFAVLFTVEMLMKWVALGFKKYFTSFWTILDFAIVVISLASLIADATGGEDISAFRSLRTLRAFRPLRAISRWQSMRIVVNALMLAIPAILNVLVVCMVFWLIFSIMGVQFFSGRFY 1322          
BLAST of Sodium channel protein vs. TrEMBL
Match: A0A177B2L2 (Sodium channel protein OS=Intoshia linei OX=1819745 GN=A3Q56_03758 PE=3 SV=1)

HSP 1 Score: 663.3 bits (1710), Expect = 0.000e+0
Identity = 402/854 (47.07%), Postives = 569/854 (66.63%), Query Frame = 3
Query: 1752 EMNPTIDRNCQCC-IKQNVLCSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKL---AQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGD-NIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIRANSPLCLLIFIPTXXXXXXXXXXXXXXXXXXXXXXXXXKNT---ADEDVSKLKIVIERLRNIYPMS----RNNPLGINKGNQELDSTETLKDIVVNFGCENAAELQNNHEKMRIIKNCKDLSTS----NELVNLLPSTGSLSKGNKLINNAIXXXXXXXXXXGKHLXXXXXXXXXXXXXXIDEESVNELKGCCCAICYNPFQEKKPFHCCYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            E    +DRNC  C I +     +W+ FQN LY  V D  F++ I+FCI +N ++MA E++    ++   LK +NI+FT I+IIE   K++ALSK+YF+  WNIFDF++V+ASIIDLGV+ VD LS+ RAFRL R+ ++   AQ+W TMR+LL II +T+  +GN+++++L+V+Y+FAVIG Q +  +Y    + D + P W+FDDF HS++L+FRI+CGEWIEP +DC+R N  LC+L+ +PTLV+GNF+VLNLFLALLL+SFASDSL +T    DED   ++  I++++N++  S    +N PL +      +D     + I +    +N      N  KM II+  K L+++    ++L N   +   +++  +L   ++  +        K L+ E           +++E+  E+  C   +        K F     I  D  T     W   R  S  ITEH++FE  IL  I ASSI LCFEDIY+D+NP LK AL  ++ IFT +F +EM+ K ISLGF  YFTSFW++LDFFIV ISL++L         ++++ R+LRT RA RPLRA+SRWQGM+IVVNAL+ +IPSI NV+LVC +FWLIFSI GVQ F GKF+KCLDS   E L A ++ NK+ CL   + W NS +NFDNA  G+LAL+Q+ATFEGWMEI+QDA     ++ QP  E+      +F++FI++GSFF LNL +GVIIDNFN  K KY+GNY+DVFLT +QR YYNT+K+L++++P K ++RPK  +Q  FYD+++S +FELVIVILI +N ++M IEHYRQ   ++ V+++ N++F+T F +EAIVKI G+RWHYFR  WN
Sbjct:  728 EAEKMVDRNCAVCSINKKKSYKRWLQFQNTLYNVVGDFIFEMVITFCIALNVLVMAMEYHDMNASFKYSLKIANIVFTSIFIIEAIFKLLALSKQYFSSKWNIFDFIIVLASIIDLGVDSVDGLSVLRAFRLLRLLRVFKLAQTWNTMRVLLYIIINTLGALGNITVVLLIVIYIFAVIGMQLFNGSYEPHFYIDKSKPAWHFDDFPHSLLLIFRILCGEWIEPLWDCMRPNGQLCILVIVPTLVIGNFMVLNLFLALLLSSFASDSLHHTNESTDEDSHMIR-GIKKIKNLFKKSSIVKKNKPLTL-----MIDHLANQRHITI-LNQQNKFVDSGNSGKMNIIQK-KALTSAIKKISKLENSDTTNSDIAENRQLGKTSLALSSNRPSLPVKELDEE-----------VEDEAKQEMTNCLPNL--------KIFEKL-NIKFD-STNFSKNWKRMRMYSFRITEHKSFEYFILAIIFASSISLCFEDIYIDDNPILKTALSNLDIIFTIIFMMEMVFKWISLGFYRYFTSFWSLLDFFIVVISLITLATQSDS--DQISSLRALRTFRAFRPLRAVSRWQGMRIVVNALMVSIPSIANVMLVCSLFWLIFSIAGVQLFGGKFYKCLDS-AGELLNANLIKNKTMCLNMGYRWQNSKVNFDNAIGGYLALFQVATFEGWMEIIQDATRVNDVDKQPFHESNFHANWFFMLFIIIGSFFTLNLLVGVIIDNFNCQKKKYDGNYLDVFLTPNQRGYYNTLKRLTSKRPIKNIKRPKGQLQNLFYDISISIKFELVIVILIVINTIIMTIEHYRQRITYSVVIEIANVLFTTTFLMEAIVKIIGMRWHYFRQGWN 1549          

HSP 2 Score: 377.867 bits (969), Expect = 1.628e-102
Identity = 199/397 (50.13%), Postives = 282/397 (71.03%), Query Frame = 3
Query:  234 EGKLVDGELKFEVEDFSDNCQPDPELVAGSILLEDKLGEFPEELLGKPLNEIDQNLKDKSFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYP--ISEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNV-NVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPN---NWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
            E KLVDGELKF+ ++  D  +    LV G++L +  +  FP++LLGKP++EID  L + SFVVI+ RFK  YI RYSA+K+  L +PW+ IR++AL I+T+Q+FDYFI+LTI+ NC+FL L  +     +EY+FL IYTLE ++++++RG+ +NSYTY RDP+N +D ++I  SYI+I+ E    Q ++ N++ LRT RVLRA KT +I+PGLKTI  AL+KSL+ +FEVI L++F M  ++LF LQ+Y G LRNKC+     K+V S +           +W  +     NW  +  +YL CGN + AG C +   N  CLP IG NPN+GYTNFD+FGWA+L++FQL+TLD+WE+ Y+ VIRA+G WN++F+ I VF  S+YLINLMLAVV+++Y
Sbjct:  106 EAKLVDGELKFDNQEEDDKPERMIALVEGNVLPDCYVEIFPKKLLGKPISEIDPYLSELSFVVISKRFKKFYINRYSASKALFLLSPWTPIRRVALRIATHQLFDYFIILTIITNCIFLTLKENAASVYAEYLFLGIYTLEAIVKISARGLFLNSYTYFRDPWNWLDFIVIASSYIVIVFEVIGNQKSLGNITGLRTFRVLRAFKTFSIVPGLKTIIGALLKSLRWVFEVITLTMFIMMVYSLFTLQVYNGVLRNKCILN---KDVFSSD----------MDWMLHKKIKANWYGSEGDYLLCGNVTGAGKCPQ---NYTCLPDIGENPNYGYTNFDSFGWAMLNIFQLVTLDFWEDLYDKVIRANGYWNVVFFAIAVFCSSYYLINLMLAVVAIAY 486          

HSP 3 Score: 358.992 bits (920), Expect = 1.614e-96
Identity = 200/331 (60.42%), Postives = 249/331 (75.23%), Query Frame = 1
Query: 4393 EETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQPPYCN-NTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAW-KHVKAQ-----RAFKQMT 5364
            EE ++  FITPTLLRVVR+FRIGR LRLIK AKGIRKL+FAL+IS PAL NIG LLLLI+FIYSI GMS+FG++K T G++DLVNF+TF  S L+L RLTTA GWN+IL+ + I  P C+ N      GV     NGDCG  +  I +M +FIF+ YLIIINMYIA+ILENF  AH QEEVGITEDDF+ +Y  W+ +DP+A+Q+IK+ +L DFV  +D PLGI KPN I+LV+ D+PIV GDK+HCLDILIAL KHV+G+IE S+E  ++K  ++  Y +VFP R    VI++TMKRKKED+AAKTLQRA+ KH  A      +A  QM 
Sbjct: 1566 EEAVRNIFITPTLLRVVRVFRIGRALRLIKWAKGIRKLMFALIISFPALVNIGMLLLLIIFIYSIFGMSLFGHVKNTFGMNDLVNFQTFPSSFLVLLRLTTAAGWNEILDPLMISEPDCDPNFWTNPQGVKVKGPNGDCGNYYIAIAFMVSFIFVTYLIIINMYIAVILENFTIAHEQEEVGITEDDFDSYYSSWKIFDPYATQFIKFEDLYDFVDTVDPPLGIRKPNEISLVALDIPIVIGDKIHCLDILIALCKHVLGNIEQSKELIQLKDALDAHYTKVFPIREGQIVISSTMKRKKEDVAAKTLQRAYRKHRNANISSNLKAITQMA 1896          

HSP 4 Score: 100.523 bits (249), Expect = 3.832e-17
Identity = 62/214 (28.97%), Postives = 110/214 (51.40%), Query Frame = 3
Query: 1827 FQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEV--------DALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIRANSPLC 2444
             QN  Y       F+L I   I INTIIM  EHY    T+  +++ +N++FT  +++E  +KI+ +   YF  GWNIFDF++VI SI+ +  EE           L + R FR+ R  +L +  + +R L+  +  +   + N+ +++LL+++++++ G   + +  +T  FG N    NF  F  S +++ R+          D +  + P C
Sbjct: 1474 LQNLFYDISISIKFELVIVILIVINTIIMTIEHYRQRITYSVVIEIANVLFTTTFLMEAIVKIIGMRWHYFRQGWNIFDFIIVITSILSVIFEEAVRNIFITPTLLRVVRVFRIGRALRLIKWAKGIRKLMFALIISFPALVNIGMLLLLIIFIYSIFGMSLFGHVKNT--FGMN-DLVNFQTFPSSFLVLLRLTTAAGWNEILDPLMISEPDC 1684          
BLAST of Sodium channel protein vs. TrEMBL
Match: B4QCM1 (Sodium channel protein (Fragment) OS=Drosophila simulans OX=7240 GN=Dsim\GD11909 PE=3 SV=1)

HSP 1 Score: 659.833 bits (1701), Expect = 0.000e+0
Identity = 401/840 (47.74%), Postives = 541/840 (64.40%), Query Frame = 3
Query: 1770 DRNCQCCIKQNVLCSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFG-DNIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIRA----NSPLCLLIFIPTXXXXXXXXXXXXXXXXXXXXXXXXXKNTADE--DVSKLKIVIERLRNIYPMSRNNPLGINKGNQELDSTETLKDIVVNFGCENAAELQNNHEKMRIIKNCK-DLSTSNELVNLLPSTGSLSKGNKLINNAIXXXXXXXXXXGKHLXXXXXXXXXXXXXXIDEESVNELKGCCCAICYNPFQEKKPFHCCYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            DRNC  C+        W+ FQN LY  V DP F+L I+ CI +NT  +A EH+   +++ + L   N +FT I+  EC +K+MALSK++F  GWNIFD ++V AS++D+  E VD LS+ R  RL RV KLAQSW TM++LL+II STI  +GNL++I+++V+Y+FAVIG Q +   Y  + F  D +PRWNF+DF+HS +++FRI+CGEWIEP +DC+RA     +  C  IF+PTLV+GNF+VLNLFLALLLNSF S+ LK+  +E  + SKL   IER+R++    R       K  +E    E  + IV++   +  A+  ++H  + + +  K  +    +   L     + ++  +   + +     D    G+  +                ++      C    CY+ F     F C + + C ++T     W   R   L + +  AFE  +LV I ASSI LCFEDI LD N TLK+ L  IN+ F  +F +EMILK ++LGF  YFTSFWTILDF IV +S+ SL+ +       +   RSLRT+RALRPLRAISRWQGM+IVVNAL+YAIPSIFNVLLVC+VFWLIFSI GVQFF GKFFKC++    E L  T V +K +C+ QN+TW NS I FD+   G+LAL Q+ATFEGWME+M DA+D+ G++LQP++E  +  Y YFVIFI+ GSFF LNLFIGVIIDNFN LK KYEG  +++FLT SQ++YY  MKKL  +KP+K ++RP       FYD++ S RFE+ I +LIFLNM+ M IEHY Q  A   +L++ N  F+T+F LEAIVKI GLR+HYF   WN
Sbjct:  647 DRNCDRCVHWCTDYESWLQFQNCLYKVVRDPLFELAITLCIVLNTAFLAMEHHGMSESFRNALDVGNKVFTSIFTFECIVKLMALSKDFFLCGWNIFDLLIVTASLLDIIFELVDGLSVLRGLRLLRVLKLAQSWTTMKVLLSIIISTIGALGNLTLILVIVIYIFAVIGMQLFSKDYTPEKFDPDPVPRWNFNDFFHSFMMIFRILCGEWIEPLWDCMRAEEEQGASTCFAIFLPTLVMGNFMVLNLFLALLLNSFNSEELKSKKEEVGEESKLARSIERVRDLIRKKRQE----RKDRKERKFAEKFQQIVLD-AQQAHAQTHSHHAAVGLERGDKPGVLAETKFHRLSYQPSAFTRLTEKPWHCLVSYVDDLTVGGRRNSQGAYNDPMTFPSYGATKAAKVPDDCFPQKCYDHFY----FRCPWFMSC-MDTQSAKHWTRVRTAVLTVVDTPAFEWFVLVLIFASSITLCFEDINLDKNKTLKRVLYWINFSFCLIFVVEMILKWLALGFSKYFTSFWTILDFIIVFVSVFSLLIEE---NENLKVLRSLRTLRALRPLRAISRWQGMRIVVNALMYAIPSIFNVLLVCLVFWLIFSIMGVQFFGGKFFKCVNE-MGELLPITEVNDKWDCIEQNYTWINSKITFDHVGMGYLALLQVATFEGWMEVMADAVDARGVDLQPQREANLYAYIYFVIFIVCGSFFTLNLFIGVIIDNFNMLKKKYEGGVLEMFLTESQKHYYTAMKKLGRKKPQKVIKRPINHFLAMFYDLSNSRRFEIAIFVLIFLNMLTMGIEHYDQPHAVFFILEVSNAFFTTVFGLEAIVKIVGLRYHYFTVPWN 1472          

HSP 2 Score: 367.466 bits (942), Expect = 2.446e-99
Identity = 188/313 (60.06%), Postives = 245/313 (78.27%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQPPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWK 5328
            ME+ +    I+PTLLRVVR+FRIGR+LRLIK AKGIRKLLFALV+SLPALFNIGALL LI FIY+I+GMS+FGN+K  G LDD+VNF+TF RS+ LLFRL T+ GWND+LE++ IQPP C       D      +NG+CG     I Y T+FI I Y+I+INMYIAIILENFNQAH +EE+GI EDD EMFY+ W +YDPHA+Q+I ++ LSDF+A LD PLGI KPN +ALVSF+LPI  G+K+HCLDIL ALVKHV+G +E+++ F++++ QM++K+++ FP R    ++++T   K+++ AAKT+Q  WK
Sbjct: 1488 MEDIMIDLPISPTLLRVVRVFRIGRILRLIKAAKGIRKLLFALVVSLPALFNIGALLGLITFIYAILGMSLFGNVKLQGALDDMVNFQTFGRSMQLLFRLMTSAGWNDVLESLMIQPPDC-------DPFIHGHTNGNCGHPLLAITYFTSFIIISYMIVINMYIAIILENFNQAHQEEEIGIVEDDLEMFYIRWSKYDPHATQFIHFSQLSDFIASLDPPLGISKPNNVALVSFNLPISRGNKIHCLDILHALVKHVLGHVEETDNFKQLQEQMDVKFKKQFPTRKELEIVSSTRIWKRQEKAAKTIQTGWK 1793          

HSP 3 Score: 314.694 bits (805), Expect = 9.501e-83
Identity = 176/363 (48.48%), Postives = 249/363 (68.60%), Query Frame = 3
Query:  327 LLEDKLGEFPEELLGKPLNEIDQNLKDKSFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPISEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMV--DWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINY-LTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
            +L  K   FPE + GKPL EID  + +++F V++ RF+  YI+R++ TKS  L  PWS  R++ + I+TNQ FDY +M TIL NC+FLA+      +EY+FLAIY++EMVI++ ++G ++N YTYLR+P+N +D ++I   Y  I      G    N++ LRT RVLRALKT++I+PGLKTI +AL+ S + L EV+ L++FC+  FALFALQ+Y G LRNKCV+ V  DW NV   +H++      +  W ++ +NW+ +     + CGN + A +C       +CL  +G NPN GYTNFDNF W++L+ FQLITLDYWEN YN+V+   G  ++ F+ +VVFFGSFYLINLMLAVV++SY
Sbjct:   45 VLPRKFEPFPEHMYGKPLEEIDTFIYEETFCVVSKRFRKNYIHRFTGTKSLFLFYPWSPARRVCVYIATNQFFDYCVMATILFNCIFLAMTETVEEAEYIFLAIYSIEMVIKIIAKGFLLNKYTYLRNPWNWLDFVVITSGYATI------GMEVGNLAGLRTFRVLRALKTVSIMPGLKTIINALLHSFRQLAEVMTLTIFCLMVFALFALQVYMGELRNKCVRQVPTDWTNV---SHTD------WQIWVNDTDNWLYDEDELPVLCGNLTGARHCPF---EYVCLC-VGENPNHGYTNFDNFMWSMLTTFQLITLDYWENVYNMVLATCGPMSVSFFTVVVFFGSFYLINLMLAVVALSY 388          

HSP 4 Score: 95.1301 bits (235), Expect = 1.625e-15
Identity = 57/201 (28.36%), Postives = 103/201 (51.24%), Query Frame = 3
Query: 1866 FDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEV--------DALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIRANSPLC 2444
            F++ I   IF+N + M  EHY        IL+ SN  FT ++ +E  +KI+ L   YF V WN+FDF++V+ASI  + +E++          L + R FR+ R+ +L ++ + +R LL  +  ++  + N+  ++ L+ +++A++G   + N        D +   NF  F  SM L+FR++         + +    P C
Sbjct: 1410 FEIAIFVLIFLNMLTMGIEHYDQPHAVFFILEVSNAFFTTVFGLEAIVKIVGLRYHYFTVPWNVFDFLLVLASIFGILMEDIMIDLPISPTLLRVVRVFRIGRILRLIKAAKGIRKLLFALVVSLPALFNIGALLGLITFIYAILGMSLFGNVKLQGALDDMV---NFQTFGRSMQLLFRLMTSAGWNDVLESLMIQPPDC 1607          
BLAST of Sodium channel protein vs. Ensembl Cavefish
Match: ENSAMXT00000044886.1 (sodium channel protein type 4 subunit alpha B-like [Source:NCBI gene;Acc:103028834])

HSP 1 Score: 421.394 bits (1082), Expect = 3.958e-120
Identity = 277/779 (35.56%), Postives = 430/779 (55.20%), Query Frame = 3
Query:  258 LKFEVEDFSDNCQPDPELVAGSILLEDKLGEFPEELLGKPLNEIDQNLK-DKSFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNND---YPISEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVM-------SENHSNEFVNAFYYNWTHNPNNWIRNGINY---------LTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHDKDQMKDLKITNGMSDADSSLCKN-TTSIHE--NDDNFRFM---DSEEEKEGKDCDNKAEYEDEVEIGNDTNNTDTAEMNP-----TIDRNCQCC--------IKQNVLCSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEY-FNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHT---QIFGD-NIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIR-ANSPLCLLIFI 2459
            L  EV +  D  +P  +L AG  L     G+ P ELL  PL ++D   K  K+F+VI+   K   I R++A  +  +  P+S +R+ A+ I  + +F  FIM+TIL NCVF+ ++N      I EYVF  IYT E +I++ SRG  I  +T+LRDP+N +D ++I ++Y+   V+        NVS+LRT RVLRALKTIT++PGLKTI  ALI+S+K L +V+IL++FC+S FAL  LQ++ G LR KCV    W  V        + N +  F +  Y N + +   +I N  NY         L CGN S +G C +     +CL   G NPN+GYT++DNFGWA L++F+L+T D+WEN              LF + +   G  Y+I  ++ +   S+       +        +        K   ++  I  +   K    K  M      NG   + SS  K+  +S H+  +D   R     DS   KE    +      + +++ N  N   +   +       ++R C  C        +K +  C+ W+ F+  +Y  V DPF DL I+ CI +NT+ MA EHYP    ++ +L   N++FT I+  E  LK++A+   Y F VGWNIFD ++V  S+++LG+  V+ LS+ R+FRL RVFKLA+SW T+ +L+ II +++  +GNL++++ +++++FAV+G Q +  +Y +   +I  D  +PRW+  DF+HS ++VFRI+CGEWIE  +DC+  A   +C+++F+
Sbjct:   92 LNIEVAE-EDLPKPSSDLEAGKSL-PFIYGDPPPELLNVPLEDLDPYYKAQKTFIVIS---KGNTINRFNAESACYILNPFSPVRRGAIRILIHSLFSMFIMVTILSNCVFMTMSNPPEWSKIMEYVFTGIYTFEALIKVLSRGFCIGDFTFLRDPWNWLDFMVISMAYLTEFVDLG------NVSALRTFRVLRALKTITVIPGLKTIVGALIQSVKKLADVMILTVFCLSVFALIGLQLFMGNLRQKCVV---WPPVFPLINGTTNMNATASFSDKLYANSSFDYEEYINNEENYYFIPGSMDALLCGNSSDSGRCPE---GYMCL-KAGRNPNYGYTSYDNFGWAFLALFRLMTQDFWEN--------------LFQLTLRSAGKTYMIFFVVIIFLGSFYLINLILAVVAMAYAEQNEATKAEAKAKEEEYEIMLEQLRKHAEQKKGM-----ANGSCTSLSSKKKDDGSSEHDLTDDGGGRVRTQHDSIALKEVSKLNGSKASMNHLDVTNGHNRKPSVAGSAIDELEELERPCPPCWYTFADIFLKWDC-CTPWIRFKKFVYFIVMDPFVDLGITICIVLNTVFMAMEHYPMTAEFESVLSVGNLVFTGIFTAEMVLKLIAMDPYYYFQVGWNIFDSIIVTMSLVELGLANVEGLSVLRSFRLMRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFAGSYKSCVCKISEDCELPRWHMTDFFHSFLIVFRILCGEWIETMWDCMEVAGQGMCIVVFM 832          

HSP 2 Score: 384.03 bits (985), Expect = 5.529e-108
Identity = 212/433 (48.96%), Postives = 280/433 (64.67%), Query Frame = 3
Query: 2982 CYNPFQEKKPFHCCYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECL-----RQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            CY     +K    C C+  DI    G  W AFR    LI EH  FE  I+  IL SS  L FEDIYL+   T+K  L   + +FTY+F +EM+LK  + GFK YFT+ W  LDF IV +SL+SL  +ILG+ +E+   +SLRT+RALRPLRA+SR++GM++VVNAL+ AIPSIFNV+LVC++FWLIFSI GV  F GKF+ C+++ + E     VV NKSEC        +  W N  +N+DN   G+L+L Q+ATF+GWM+IM  A+DS  +  QP  E  +  Y YFVIFI+ GSFF LNLFIGVIIDNFN+ K+K  G   D+F+T  Q+ YYN MKKL ++KP+K + RP+   QGF +D+     F+++I++LI LNM+ MM E   Q+     +L  IN  F  IFT E  +KI  LR +YF   WN
Sbjct: 1010 CYT----EKCIRRCPCLDLDITQGRGKSWWAFRKTCFLIVEHNYFETFIIFMILLSSGALAFEDIYLEQRRTIKIILEYADQVFTYIFVVEMLLKWCAYGFKTYFTNAWCWLDFLIVDVSLISLTANILGY-SELGPIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIFNVMLVCLIFWLIFSIMGVNLFAGKFYHCINTTSEELFPPEVVNNKSECFLLIEGGYDARWVNQKVNYDNVGMGYLSLLQVATFKGWMDIMYAAVDSRNVEDQPSYEINLYMYIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKSKLGGQ--DLFMTEDQKKYYNAMKKLGSKKPQKPIPRPQNCCQGFVFDLVTKQFFDILIMVLICLNMITMMAETDEQSIEVEEILFYINFAFIVIFTGECALKIIALRQYYFSVGWN 1435          

HSP 3 Score: 293.123 bits (749), Expect = 1.954e-79
Identity = 164/326 (50.31%), Postives = 225/326 (69.02%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMF-IQPPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFKQMT 5364
            + + ++  F++PTL RV+R+ RIGRVLRLI+ AKGIR LLFAL++SLPALFNIG LL LI+FI+SI GMS F  +KK  G+DD+ NFETF  SI+ LF +TT+ GW+ +L  +    PP C +  +   G   +   G+CG    GI++  T+I I +L+++NMYIAIILENFN A  +    + EDDFEMFY  WER+DP ASQ+I Y++LSDF   L +PL IPKPN I L++ DLP+V GDK+HCLDIL+AL   V+G   +SE    +K  ME K+    P++V    ITTT++RK+E++AA  +QRA++    +R  KQ +
Sbjct: 1451 LADIIEKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLIMFIFSIFGMSNFAYVKKEMGIDDMFNFETFGNSIICLFMITTSAGWDGLLSPILNSAPPDC-DPDIQNPG---SDVRGNCGNPAVGIVFFCTYIVISFLVVVNMYIAIILENFNVATEESGEPLCEDDFEMFYETWERFDPDASQFIAYSSLSDFCDTLKDPLRIPKPNTIKLITMDLPMVPGDKIHCLDILLALTAEVLG---ESEAMDSLKATMEEKFMANNPSKVSYEPITTTLRRKQEEVAAVVIQRAYRKHVLKRTLKQAS 1769          

HSP 4 Score: 103.219 bits (256), Expect = 1.964e-21
Identity = 70/235 (29.79%), Postives = 120/235 (51.06%), Query Frame = 3
Query: 1704 EDEVEIGNDTNNTDTAEMNPTIDRNCQCCIKQNVLCSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEV-----DALSIFRAFRLF---RVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRI 2384
            ED+ +  N      + +    I R   CC             Q  ++  VT  FFD+ I   I +N I M +E        ++IL Y N  F VI+  EC+LKI+AL + YF+VGWNIFDF+VVI SI+ + + ++      + ++FR  RL    RV +L +  + +R LL  +  ++  + N+ +++ L++++F++ G  ++          D    +NF+ F +S+I +F I
Sbjct: 1332 EDQKKYYNAMKKLGSKKPQKPIPRPQNCC-------------QGFVFDLVTKQFFDILIMVLICLNMITMMAETDEQSIEVEEILFYINFAFIVIFTGECALKIIALRQYYFSVGWNIFDFIVVILSILGIVLADIIEKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLIMFIFSIFGMSNFAYVKKEMGIDD---MFNFETFGNSIICLFMI 1550          

HSP 5 Score: 74.3294 bits (181), Expect = 1.426e-12
Identity = 59/251 (23.51%), Postives = 110/251 (43.82%), Query Frame = 3
Query: 1653 DSEEEKEGKDCDNKAEYEDEVEIGNDTNNTDTAEMNPTID----------------------RNCQCC---IKQNVLCSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASE--HYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIID-----LGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYH 2306
            D   + E K  D K++ +D    G D ++  T +  P ++                      R C C    I Q      W AF+   ++ V   +F+ FI F I +++  +A E  +    +T   IL+Y++ +FT I+++E  LK  A   K YF   W   DF++V  S+I      LG  E+  +   R  R  R  +    ++ MR+++  +   I  + N+ ++ L+   +F+++G   +   ++
Sbjct:  958 DDTSDDEDKKADEKSKLKDS---GGDDSSCSTVDKPPEVEEAESEEEEDPTTPEDCYTEKCIRRCPCLDLDITQG-RGKSWWAFRKTCFLIVEHNYFETFIIFMILLSSGALAFEDIYLEQRRTIKIILEYADQVFTYIFVVEMLLKWCAYGFKTYFTNAWCWLDFLIVDVSLISLTANILGYSELGPIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIFNVMLVCLIFWLIFSIMGVNLFAGKFY 1204          

HSP 6 Score: 62.7734 bits (151), Expect = 4.938e-9
Identity = 73/313 (23.32%), Postives = 132/313 (42.17%), Query Frame = 3
Query: 3006 KPFHCCYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXX--XXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKE-----------NQMAYYAYFVIFILVGSFFILNLFIGVIIDNFN 3905
            +P +CC   V D+ T                   + F+  I+V I  + I +  E    + +  +++ L  IN+ F  +F  E  LKII+L  + YF+  W I      I+SI  + L + I  +    T FR +R  R  R LR I   +G++ ++ AL+ ++P++FN+ L+  +   IFSI G+  F                             +     +   NF+   N  + L+ I T  GW  ++   ++S   +  P  +           N      +F  +I++    ++N++I +I++NFN
Sbjct: 1355 RPQNCCQGFVFDLVT------------------KQFFDILIMVLICLNMITMMAETD--EQSIEVEEILFYINFAFIVIFTGECALKIIALR-QYYFSVGWNIFDFIVVILSILGIVLADIIEKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLIMFIFSIFGMSNF--------------------------AYVKKEMGIDDMFNFETFGNSIICLFMITTSAGWDGLLSPILNSAPPDCDPDIQNPGSDVRGNCGNPAVGIVFFCTYIVISFLVVVNMYIAIILENFN 1620          

HSP 7 Score: 61.2326 bits (147), Expect = 1.165e-8
Identity = 72/321 (22.43%), Postives = 130/321 (40.50%), Query Frame = 3
Query:  495 WSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYP--------ISEY---VFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWEN-QYNLV----IRASGSWNI-----LFYIIVVFFGSFYLINLMLAVV 1394
            W   RK   LI  +  F+ FI+  IL++   LA  + Y         I EY   VF  I+ +EM+++  + G      TY  + +  +D LI+ +S I +            + SLRTLR LR L+ ++   G++ + +AL+ ++  +F V+++ L     F++  + ++ G   + C+     + +      N     F          W+   +NY                                    DN G   LS+ Q+ T   W +  Y  V    +    S+ I     ++++I + FGSF+ +NL + V+
Sbjct: 1034 WWAFRKTCFLIVEHNYFETFIIFMILLSSGALAFEDIYLEQRRTIKIILEYADQVFTYIFVVEMLLKWCAYGF----KTYFTNAWCWLDFLIVDVSLISLTANILGYSELGPIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIFNVMLVCLIFWLIFSIMGVNLFAGKFYH-CINTTS-EELFPPEVVNNKSECFLLIEGGYDARWVNQKVNY------------------------------------DNVGMGYLSLLQVATFKGWMDIMYAAVDSRNVEDQPSYEINLYMYIYFVIFIIFGSFFTLNLFIGVI 1312          

HSP 8 Score: 56.225 bits (134), Expect = 3.898e-7
Identity = 30/76 (39.47%), Postives = 46/76 (60.53%), Query Frame = 3
Query: 4041 QGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGL-RWHYFRYMWN 4265
            + F Y + M    +L I I I LN V M +EHY  TA F +VL + N++F+ IFT E ++K+  +  ++YF+  WN
Sbjct:  617 KKFVYFIVMDPFVDLGITICIVLNTVFMAMEHYPMTAEFESVLSVGNLVFTGIFTAEMVLKLIAMDPYYYFQVGWN 692          

HSP 9 Score: 54.299 bits (129), Expect = 1.672e-6
Identity = 63/290 (21.72%), Postives = 124/290 (42.76%), Query Frame = 3
Query: 3003 KKPFHCCYCIVCDI--ETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFI 3866
            ++P   C+    DI  +  C + W  F+     I      +  I +CI+ +++ +  E  +       +  L V N +FT +F  EM+LK+I++    YF   W I D  IV++SL+ L          +     LR+ R +R  +    W  + +++  +  ++ ++ N+ LV  +   IF++ G+Q F G +  C+            +    E  R + T         +  + FL +++I   E W+E M D ++  G         Q      F++ +++G+  +
Sbjct:  590 ERPCPPCWYTFADIFLKWDCCTPWIRFKKFVYFIVMDPFVDLGITICIVLNTVFMAME--HYPMTAEFESVLSVGNLVFTGIFTAEMVLKLIAMDPYYYFQVGWNIFDSIIVTMSLVELGL------ANVEGLSVLRSFRLMRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFAGSYKSCV----------CKISEDCELPRWHMT---------DFFHSFLIVFRILCGE-WIETMWDCMEVAG---------QGMCIVVFMMVMVIGNLVV 842          
BLAST of Sodium channel protein vs. Ensembl Cavefish
Match: ENSAMXT00000006401.2 (sodium channel protein type 4 subunit alpha B-like [Source:NCBI gene;Acc:103028834])

HSP 1 Score: 415.616 bits (1067), Expect = 2.425e-118
Identity = 275/779 (35.30%), Postives = 428/779 (54.94%), Query Frame = 3
Query:  258 LKFEVEDFSDNCQPDPELVAGSILLEDKLGEFPEELLGKPLNEIDQNLK-DKSFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNND---YPISEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVM-------SENHSNEFVNAFYYNWTHNPNNWIRNGINY---------LTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHDKDQMKDLKITNGMSDADSSLCKN-TTSIHE--NDDNFRFM---DSEEEKEGKDCDNKAEYEDEVEIGNDTNNTDTAEMNP-----TIDRNCQCC--------IKQNVLCSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEY-FNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHT---QIFGD-NIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIR-ANSPLCLLIFI 2459
            L  EV +  D  +P  +L AG  L     G+ P ELL  PL ++D   K  K+F+VI+   K   I R++A  +  +  P+S +R+ A+ I  + +F  FIM+TIL NCVF+ ++N      I EYVF  IYT E +I++ SRG  I  +T+LRDP+N +D ++I ++Y+   V+        NVS+LRT RVLRALKTIT++PGLKTI  ALI+S+K L +V+IL++FC+S FAL  LQ++ G LR KCV    W  V        + N +  F +  Y N + +   +I N  NY         L CGN S +G C +     +CL   G NPN+GYT++DNFGWA L++F+L+T D+              W  LF + +   G  Y+I  ++ +   S+       +        +        K   ++  I  +   K    K  M      NG   + SS  K+  +S H+  +D   R     DS   KE    +      + +++ N  N   +   +       ++R C  C        +K +  C+ W+ F+  +Y  V DPF DL I+ CI +NT+ MA EHYP    ++ +L   N++FT I+  E  LK++A+   Y F VGWNIFD ++V  S+++LG+  V+ LS+ R+FRL RVFKLA+SW T+ +L+ II +++  +GNL++++ +++++FAV+G Q +  +Y +   +I  D  +PRW+  DF+HS ++VFRI+CGEWIE  +DC+  A   +C+++F+
Sbjct:   41 LNIEVAE-EDLPKPSSDLEAGKSL-PFIYGDPPPELLNVPLEDLDPYYKAQKTFIVIS---KGNTINRFNAESACYILNPFSPVRRGAIRILIHSLFSMFIMVTILSNCVFMTMSNPPEWSKIMEYVFTGIYTFEALIKVLSRGFCIGDFTFLRDPWNWLDFMVISMAYLTEFVDLG------NVSALRTFRVLRALKTITVIPGLKTIVGALIQSVKKLADVMILTVFCLSVFALIGLQLFMGNLRQKCVV---WPPVFPLINGTTNMNATASFSDKLYANSSFDYEEYINNEENYYFIPGSMDALLCGNSSDSGRCPE---GYMCL-KAGRNPNYGYTSYDNFGWAFLALFRLMTQDF--------------WENLFQLTLRSAGKTYMIFFVVIIFLGSFYLINLILAVVAMAYAEQNEATKAEAKAKEEEYEIMLEQLRKHAEQKKGM-----ANGSCTSLSSKKKDDGSSEHDLTDDGGGRVRTQHDSIALKEVSKLNGSKASMNHLDVTNGHNRKPSVAGSAIDELEELERPCPPCWYTFADIFLKWDC-CTPWIRFKKFVYFIVMDPFVDLGITICIVLNTVFMAMEHYPMTAEFESVLSVGNLVFTGIFTAEMVLKLIAMDPYYYFQVGWNIFDSIIVTMSLVELGLANVEGLSVLRSFRLMRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFAGSYKSCVCKISEDCELPRWHMTDFFHSFLIVFRILCGEWIETMWDCMEVAGQGMCIVVFM 781          

HSP 2 Score: 384.415 bits (986), Expect = 3.670e-108
Identity = 212/433 (48.96%), Postives = 280/433 (64.67%), Query Frame = 3
Query: 2982 CYNPFQEKKPFHCCYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECL-----RQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            CY     +K    C C+  DI    G  W AFR    LI EH  FE  I+  IL SS  L FEDIYL+   T+K  L   + +FTY+F +EM+LK  + GFK YFT+ W  LDF IV +SL+SL  +ILG+ +E+   +SLRT+RALRPLRA+SR++GM++VVNAL+ AIPSIFNV+LVC++FWLIFSI GV  F GKF+ C+++ + E     VV NKSEC        +  W N  +N+DN   G+L+L Q+ATF+GWM+IM  A+DS  +  QP  E  +  Y YFVIFI+ GSFF LNLFIGVIIDNFN+ K+K  G   D+F+T  Q+ YYN MKKL ++KP+K + RP+   QGF +D+     F+++I++LI LNM+ MM E   Q+     +L  IN  F  IFT E  +KI  LR +YF   WN
Sbjct:  959 CYT----EKCIRRCPCLDLDITQGRGKSWWAFRKTCFLIVEHNYFETFIIFMILLSSGALAFEDIYLEQRRTIKIILEYADQVFTYIFVVEMLLKWCAYGFKTYFTNAWCWLDFLIVDVSLISLTANILGY-SELGPIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIFNVMLVCLIFWLIFSIMGVNLFAGKFYHCINTTSEELFPPEVVNNKSECFLLIEGGYDARWVNQKVNYDNVGMGYLSLLQVATFKGWMDIMYAAVDSRNVEDQPSYEINLYMYIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKSKLGGQ--DLFMTEDQKKYYNAMKKLGSKKPQKPIPRPQNCCQGFVFDLVTKQFFDILIMVLICLNMITMMAETDEQSIEVEEILFYINFAFIVIFTGECALKIIALRQYYFSVGWN 1384          

HSP 3 Score: 293.508 bits (750), Expect = 1.492e-79
Identity = 164/326 (50.31%), Postives = 225/326 (69.02%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMF-IQPPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFKQMT 5364
            + + ++  F++PTL RV+R+ RIGRVLRLI+ AKGIR LLFAL++SLPALFNIG LL LI+FI+SI GMS F  +KK  G+DD+ NFETF  SI+ LF +TT+ GW+ +L  +    PP C +  +   G   +   G+CG    GI++  T+I I +L+++NMYIAIILENFN A  +    + EDDFEMFY  WER+DP ASQ+I Y++LSDF   L +PL IPKPN I L++ DLP+V GDK+HCLDIL+AL   V+G   +SE    +K  ME K+    P++V    ITTT++RK+E++AA  +QRA++    +R  KQ +
Sbjct: 1400 LADIIEKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLIMFIFSIFGMSNFAYVKKEMGIDDMFNFETFGNSIICLFMITTSAGWDGLLSPILNSAPPDC-DPDIQNPG---SDVRGNCGNPAVGIVFFCTYIVISFLVVVNMYIAIILENFNVATEESGEPLCEDDFEMFYETWERFDPDASQFIAYSSLSDFCDTLKDPLRIPKPNTIKLITMDLPMVPGDKIHCLDILLALTAEVLG---ESEAMDSLKATMEEKFMANNPSKVSYEPITTTLRRKQEEVAAVVIQRAYRKHVLKRTLKQAS 1718          

HSP 4 Score: 103.605 bits (257), Expect = 1.715e-21
Identity = 70/235 (29.79%), Postives = 120/235 (51.06%), Query Frame = 3
Query: 1704 EDEVEIGNDTNNTDTAEMNPTIDRNCQCCIKQNVLCSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEV-----DALSIFRAFRLF---RVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRI 2384
            ED+ +  N      + +    I R   CC             Q  ++  VT  FFD+ I   I +N I M +E        ++IL Y N  F VI+  EC+LKI+AL + YF+VGWNIFDF+VVI SI+ + + ++      + ++FR  RL    RV +L +  + +R LL  +  ++  + N+ +++ L++++F++ G  ++          D    +NF+ F +S+I +F I
Sbjct: 1281 EDQKKYYNAMKKLGSKKPQKPIPRPQNCC-------------QGFVFDLVTKQFFDILIMVLICLNMITMMAETDEQSIEVEEILFYINFAFIVIFTGECALKIIALRQYYFSVGWNIFDFIVVILSILGIVLADIIEKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLIMFIFSIFGMSNFAYVKKEMGIDD---MFNFETFGNSIICLFMI 1499          

HSP 5 Score: 74.3294 bits (181), Expect = 1.383e-12
Identity = 59/251 (23.51%), Postives = 110/251 (43.82%), Query Frame = 3
Query: 1653 DSEEEKEGKDCDNKAEYEDEVEIGNDTNNTDTAEMNPTID----------------------RNCQCC---IKQNVLCSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASE--HYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIID-----LGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYH 2306
            D   + E K  D K++ +D    G D ++  T +  P ++                      R C C    I Q      W AF+   ++ V   +F+ FI F I +++  +A E  +    +T   IL+Y++ +FT I+++E  LK  A   K YF   W   DF++V  S+I      LG  E+  +   R  R  R  +    ++ MR+++  +   I  + N+ ++ L+   +F+++G   +   ++
Sbjct:  907 DDTSDDEDKKADEKSKLKDS---GGDDSSCSTVDKPPEVEEAESEEEEDPTTPEDCYTEKCIRRCPCLDLDITQG-RGKSWWAFRKTCFLIVEHNYFETFIIFMILLSSGALAFEDIYLEQRRTIKIILEYADQVFTYIFVVEMLLKWCAYGFKTYFTNAWCWLDFLIVDVSLISLTANILGYSELGPIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIFNVMLVCLIFWLIFSIMGVNLFAGKFY 1153          

HSP 6 Score: 62.7734 bits (151), Expect = 4.916e-9
Identity = 73/313 (23.32%), Postives = 132/313 (42.17%), Query Frame = 3
Query: 3006 KPFHCCYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXX--XXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKE-----------NQMAYYAYFVIFILVGSFFILNLFIGVIIDNFN 3905
            +P +CC   V D+ T                   + F+  I+V I  + I +  E    + +  +++ L  IN+ F  +F  E  LKII+L  + YF+  W I      I+SI  + L + I  +    T FR +R  R  R LR I   +G++ ++ AL+ ++P++FN+ L+  +   IFSI G+  F                             +     +   NF+   N  + L+ I T  GW  ++   ++S   +  P  +           N      +F  +I++    ++N++I +I++NFN
Sbjct: 1304 RPQNCCQGFVFDLVT------------------KQFFDILIMVLICLNMITMMAETD--EQSIEVEEILFYINFAFIVIFTGECALKIIALR-QYYFSVGWNIFDFIVVILSILGIVLADIIEKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLIMFIFSIFGMSNF--------------------------AYVKKEMGIDDMFNFETFGNSIICLFMITTSAGWDGLLSPILNSAPPDCDPDIQNPGSDVRGNCGNPAVGIVFFCTYIVISFLVVVNMYIAIILENFN 1569          

HSP 7 Score: 61.6178 bits (148), Expect = 9.723e-9
Identity = 73/321 (22.74%), Postives = 132/321 (41.12%), Query Frame = 3
Query:  495 WSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYP--------ISEY---VFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWEN-QYNLV----IRASGSWNI-----LFYIIVVFFGSFYLINLMLAVV 1394
            W   RK   LI  +  F+ FI+  IL++   LA  + Y         I EY   VF  I+ +EM+++  + G      TY  + +  +D LI+ +S I +            + SLRTLR LR L+ ++   G++ + +AL+ ++  +F V+++ L     F++  + ++ G   + C+     +    E  +N+    F          W+   +NY                                    DN G   LS+ Q+ T   W +  Y  V    +    S+ I     ++++I + FGSF+ +NL + V+
Sbjct:  983 WWAFRKTCFLIVEHNYFETFIIFMILLSSGALAFEDIYLEQRRTIKIILEYADQVFTYIFVVEMLLKWCAYGF----KTYFTNAWCWLDFLIVDVSLISLTANILGYSELGPIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIFNVMLVCLIFWLIFSIMGVNLFAGKFYH-CINTTSEELFPPEVVNNK-SECFLLIEGGYDARWVNQKVNY------------------------------------DNVGMGYLSLLQVATFKGWMDIMYAAVDSRNVEDQPSYEINLYMYIYFVIFIIFGSFFTLNLFIGVI 1261          

HSP 8 Score: 56.225 bits (134), Expect = 3.818e-7
Identity = 30/76 (39.47%), Postives = 46/76 (60.53%), Query Frame = 3
Query: 4041 QGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGL-RWHYFRYMWN 4265
            + F Y + M    +L I I I LN V M +EHY  TA F +VL + N++F+ IFT E ++K+  +  ++YF+  WN
Sbjct:  566 KKFVYFIVMDPFVDLGITICIVLNTVFMAMEHYPMTAEFESVLSVGNLVFTGIFTAEMVLKLIAMDPYYYFQVGWN 641          

HSP 9 Score: 54.299 bits (129), Expect = 1.722e-6
Identity = 63/290 (21.72%), Postives = 124/290 (42.76%), Query Frame = 3
Query: 3003 KKPFHCCYCIVCDI--ETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFI 3866
            ++P   C+    DI  +  C + W  F+     I      +  I +CI+ +++ +  E  +       +  L V N +FT +F  EM+LK+I++    YF   W I D  IV++SL+ L          +     LR+ R +R  +    W  + +++  +  ++ ++ N+ LV  +   IF++ G+Q F G +  C+            +    E  R + T         +  + FL +++I   E W+E M D ++  G         Q      F++ +++G+  +
Sbjct:  539 ERPCPPCWYTFADIFLKWDCCTPWIRFKKFVYFIVMDPFVDLGITICIVLNTVFMAME--HYPMTAEFESVLSVGNLVFTGIFTAEMVLKLIAMDPYYYFQVGWNIFDSIIVTMSLVELGL------ANVEGLSVLRSFRLMRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFAGSYKSCV----------CKISEDCELPRWHMT---------DFFHSFLIVFRILCGE-WIETMWDCMEVAG---------QGMCIVVFMMVMVIGNLVV 791          
BLAST of Sodium channel protein vs. Ensembl Cavefish
Match: ENSAMXT00000051500.1 (sodium channel protein type 4 subunit alpha B-like [Source:NCBI gene;Acc:103028834])

HSP 1 Score: 403.675 bits (1036), Expect = 3.833e-114
Identity = 277/815 (33.99%), Postives = 430/815 (52.76%), Query Frame = 3
Query:  258 LKFEVEDFSDNCQPDPELVAGSILLEDKLGEFPEELLGKPLNEIDQNLK-DKSFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNND---YPISEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVM-------SENHSNEFVNAFYYNWTHNPNNWIRNGINY---------LTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHDKDQMKDLKITNGMSDADSSLCKN-TTSIHE--NDDNFRFM---DSEEEKEGKDCDNKAEYEDEVEIGNDTNNTDTAEMNP-----TIDRNCQCC--------IKQNVLCSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSK-EYFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFR------------------------------------LFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHT---QIFGD-NIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIR-ANSPLCLLIFI 2459
            L  EV +  D  +P  +L AG  L     G+ P ELL  PL ++D   K  K+F+VI+   K   I R++A  +  +  P+S +R+ A+ I  + +F  FIM+TIL NCVF+ ++N      I EYVF  IYT E +I++ SRG  I  +T+LRDP+N +D ++I ++Y+   V+        NVS+LRT RVLRALKTIT++PGLKTI  ALI+S+K L +V+IL++FC+S FAL  LQ++ G LR KCV    W  V        + N +  F +  Y N + +   +I N  NY         L CGN S +G C +     +CL   G NPN+GYT++DNFGWA L++F+L+T D+WEN              LF + +   G  Y+I  ++ +   S+       +        +        K   ++  I  +   K    K  M      NG   + SS  K+  +S H+  +D   R     DS   KE    +      + +++ N  N   +   +       ++R C  C        +K +  C+ W+ F+  +Y  V DPF DL I+ CI +NT+ MA EHYP    ++ +L   N++FT I+  E  LK++A+    YF VGWNIFD ++V  S+++LG+  V+ LS+ R+FR                                    L RVFKLA+SW T+ +L+ II +++  +GNL++++ +++++FAV+G Q +  +Y +   +I  D  +PRW+  DF+HS ++VFRI+CGEWIE  +DC+  A   +C+++F+
Sbjct:   92 LNIEVAE-EDLPKPSSDLEAGKSL-PFIYGDPPPELLNVPLEDLDPYYKAQKTFIVIS---KGNTINRFNAESACYILNPFSPVRRGAIRILIHSLFSMFIMVTILSNCVFMTMSNPPEWSKIMEYVFTGIYTFEALIKVLSRGFCIGDFTFLRDPWNWLDFMVISMAYLTEFVDLG------NVSALRTFRVLRALKTITVIPGLKTIVGALIQSVKKLADVMILTVFCLSVFALIGLQLFMGNLRQKCVV---WPPVFPLINGTTNMNATASFSDKLYANSSFDYEEYINNEENYYFIPGSMDALLCGNSSDSGRCPE---GYMCL-KAGRNPNYGYTSYDNFGWAFLALFRLMTQDFWEN--------------LFQLTLRSAGKTYMIFFVVIIFLGSFYLINLILAVVAMAYAEQNEATKAEAKAKEEEYEIMLEQLRKHAEQKKGM-----ANGSCTSLSSKKKDDGSSEHDLTDDGGGRVRTQHDSIALKEVSKLNGSKASMNHLDVTNGHNRKPSVAGSAIDELEELERPCPPCWYTFADIFLKWDC-CTPWIRFKKFVYFIVMDPFVDLGITICIVLNTVFMAMEHYPMTAEFESVLSVGNLVFTGIFTAEMVLKLIAMDPYYYFQVGWNIFDSIIVTMSLVELGLANVEGLSVLRSFRLHNGENEEFELQSADVLIGHEELGESKPIGGLHTFVLMRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFAGSYKSCVCKISEDCELPRWHMTDFFHSFLIVFRILCGEWIETMWDCMEVAGQGMCIVVFM 868          

HSP 2 Score: 384.415 bits (986), Expect = 5.803e-108
Identity = 212/433 (48.96%), Postives = 280/433 (64.67%), Query Frame = 3
Query: 2982 CYNPFQEKKPFHCCYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECL-----RQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            CY     +K    C C+  DI    G  W AFR    LI EH  FE  I+  IL SS  L FEDIYL+   T+K  L   + +FTY+F +EM+LK  + GFK YFT+ W  LDF IV +SL+SL  +ILG+ +E+   +SLRT+RALRPLRA+SR++GM++VVNAL+ AIPSIFNV+LVC++FWLIFSI GV  F GKF+ C+++ + E     VV NKSEC        +  W N  +N+DN   G+L+L Q+ATF+GWM+IM  A+DS  +  QP  E  +  Y YFVIFI+ GSFF LNLFIGVIIDNFN+ K+K  G   D+F+T  Q+ YYN MKKL ++KP+K + RP+   QGF +D+     F+++I++LI LNM+ MM E   Q+     +L  IN  F  IFT E  +KI  LR +YF   WN
Sbjct: 1046 CYT----EKCIRRCPCLDLDITQGRGKSWWAFRKTCFLIVEHNYFETFIIFMILLSSGALAFEDIYLEQRRTIKIILEYADQVFTYIFVVEMLLKWCAYGFKTYFTNAWCWLDFLIVDVSLISLTANILGY-SELGPIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIFNVMLVCLIFWLIFSIMGVNLFAGKFYHCINTTSEELFPPEVVNNKSECFLLIEGGYDARWVNQKVNYDNVGMGYLSLLQVATFKGWMDIMYAAVDSRNVEDQPSYEINLYMYIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKSKLGGQ--DLFMTEDQKKYYNAMKKLGSKKPQKPIPRPQNCCQGFVFDLVTKQFFDILIMVLICLNMITMMAETDEQSIEVEEILFYINFAFIVIFTGECALKIIALRQYYFSVGWN 1471          

HSP 3 Score: 292.738 bits (748), Expect = 2.427e-79
Identity = 164/326 (50.31%), Postives = 225/326 (69.02%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMF-IQPPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFKQMT 5364
            + + ++  F++PTL RV+R+ RIGRVLRLI+ AKGIR LLFAL++SLPALFNIG LL LI+FI+SI GMS F  +KK  G+DD+ NFETF  SI+ LF +TT+ GW+ +L  +    PP C +  +   G   +   G+CG    GI++  T+I I +L+++NMYIAIILENFN A  +    + EDDFEMFY  WER+DP ASQ+I Y++LSDF   L +PL IPKPN I L++ DLP+V GDK+HCLDIL+AL   V+G   +SE    +K  ME K+    P++V    ITTT++RK+E++AA  +QRA++    +R  KQ +
Sbjct: 1487 LADIIEKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLIMFIFSIFGMSNFAYVKKEMGIDDMFNFETFGNSIICLFMITTSAGWDGLLSPILNSAPPDC-DPDIQNPG---SDVRGNCGNPAVGIVFFCTYIVISFLVVVNMYIAIILENFNVATEESGEPLCEDDFEMFYETWERFDPDASQFIAYSSLSDFCDTLKDPLRIPKPNTIKLITMDLPMVPGDKIHCLDILLALTAEVLG---ESEAMDSLKATMEEKFMANNPSKVSYEPITTTLRRKQEEVAAVVIQRAYRKHVLKRTLKQAS 1805          

HSP 4 Score: 103.605 bits (257), Expect = 1.895e-21
Identity = 70/235 (29.79%), Postives = 120/235 (51.06%), Query Frame = 3
Query: 1704 EDEVEIGNDTNNTDTAEMNPTIDRNCQCCIKQNVLCSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEV-----DALSIFRAFRLF---RVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRI 2384
            ED+ +  N      + +    I R   CC             Q  ++  VT  FFD+ I   I +N I M +E        ++IL Y N  F VI+  EC+LKI+AL + YF+VGWNIFDF+VVI SI+ + + ++      + ++FR  RL    RV +L +  + +R LL  +  ++  + N+ +++ L++++F++ G  ++          D    +NF+ F +S+I +F I
Sbjct: 1368 EDQKKYYNAMKKLGSKKPQKPIPRPQNCC-------------QGFVFDLVTKQFFDILIMVLICLNMITMMAETDEQSIEVEEILFYINFAFIVIFTGECALKIIALRQYYFSVGWNIFDFIVVILSILGIVLADIIEKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLIMFIFSIFGMSNFAYVKKEMGIDD---MFNFETFGNSIICLFMI 1586          

HSP 5 Score: 74.3294 bits (181), Expect = 1.432e-12
Identity = 59/251 (23.51%), Postives = 110/251 (43.82%), Query Frame = 3
Query: 1653 DSEEEKEGKDCDNKAEYEDEVEIGNDTNNTDTAEMNPTID----------------------RNCQCC---IKQNVLCSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASE--HYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIID-----LGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYH 2306
            D   + E K  D K++ +D    G D ++  T +  P ++                      R C C    I Q      W AF+   ++ V   +F+ FI F I +++  +A E  +    +T   IL+Y++ +FT I+++E  LK  A   K YF   W   DF++V  S+I      LG  E+  +   R  R  R  +    ++ MR+++  +   I  + N+ ++ L+   +F+++G   +   ++
Sbjct:  994 DDTSDDEDKKADEKSKLKDS---GGDDSSCSTVDKPPEVEEAESEEEEDPTTPEDCYTEKCIRRCPCLDLDITQG-RGKSWWAFRKTCFLIVEHNYFETFIIFMILLSSGALAFEDIYLEQRRTIKIILEYADQVFTYIFVVEMLLKWCAYGFKTYFTNAWCWLDFLIVDVSLISLTANILGYSELGPIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIFNVMLVCLIFWLIFSIMGVNLFAGKFY 1240          

HSP 6 Score: 62.7734 bits (151), Expect = 4.830e-9
Identity = 73/313 (23.32%), Postives = 132/313 (42.17%), Query Frame = 3
Query: 3006 KPFHCCYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXX--XXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKE-----------NQMAYYAYFVIFILVGSFFILNLFIGVIIDNFN 3905
            +P +CC   V D+ T                   + F+  I+V I  + I +  E    + +  +++ L  IN+ F  +F  E  LKII+L  + YF+  W I      I+SI  + L + I  +    T FR +R  R  R LR I   +G++ ++ AL+ ++P++FN+ L+  +   IFSI G+  F                             +     +   NF+   N  + L+ I T  GW  ++   ++S   +  P  +           N      +F  +I++    ++N++I +I++NFN
Sbjct: 1391 RPQNCCQGFVFDLVT------------------KQFFDILIMVLICLNMITMMAETD--EQSIEVEEILFYINFAFIVIFTGECALKIIALR-QYYFSVGWNIFDFIVVILSILGIVLADIIEKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLIMFIFSIFGMSNF--------------------------AYVKKEMGIDDMFNFETFGNSIICLFMITTSAGWDGLLSPILNSAPPDCDPDIQNPGSDVRGNCGNPAVGIVFFCTYIVISFLVVVNMYIAIILENFN 1656          

HSP 7 Score: 61.6178 bits (148), Expect = 1.111e-8
Identity = 72/321 (22.43%), Postives = 130/321 (40.50%), Query Frame = 3
Query:  495 WSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYP--------ISEY---VFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWEN-QYNLV----IRASGSWNI-----LFYIIVVFFGSFYLINLMLAVV 1394
            W   RK   LI  +  F+ FI+  IL++   LA  + Y         I EY   VF  I+ +EM+++  + G      TY  + +  +D LI+ +S I +            + SLRTLR LR L+ ++   G++ + +AL+ ++  +F V+++ L     F++  + ++ G   + C+     + +      N     F          W+   +NY                                    DN G   LS+ Q+ T   W +  Y  V    +    S+ I     ++++I + FGSF+ +NL + V+
Sbjct: 1070 WWAFRKTCFLIVEHNYFETFIIFMILLSSGALAFEDIYLEQRRTIKIILEYADQVFTYIFVVEMLLKWCAYGF----KTYFTNAWCWLDFLIVDVSLISLTANILGYSELGPIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIFNVMLVCLIFWLIFSIMGVNLFAGKFYH-CINTTS-EELFPPEVVNNKSECFLLIEGGYDARWVNQKVNY------------------------------------DNVGMGYLSLLQVATFKGWMDIMYAAVDSRNVEDQPSYEINLYMYIYFVIFIIFGSFFTLNLFIGVI 1348          

HSP 8 Score: 56.225 bits (134), Expect = 3.778e-7
Identity = 30/76 (39.47%), Postives = 46/76 (60.53%), Query Frame = 3
Query: 4041 QGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGL-RWHYFRYMWN 4265
            + F Y + M    +L I I I LN V M +EHY  TA F +VL + N++F+ IFT E ++K+  +  ++YF+  WN
Sbjct:  617 KKFVYFIVMDPFVDLGITICIVLNTVFMAMEHYPMTAEFESVLSVGNLVFTGIFTAEMVLKLIAMDPYYYFQVGWN 692          
BLAST of Sodium channel protein vs. Ensembl Cavefish
Match: ENSAMXT00000006399.2 (sodium channel protein type 4 subunit alpha B-like [Source:NCBI gene;Acc:103028834])

HSP 1 Score: 384.03 bits (985), Expect = 4.573e-108
Identity = 212/433 (48.96%), Postives = 280/433 (64.67%), Query Frame = 3
Query: 2982 CYNPFQEKKPFHCCYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECL-----RQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            CY     +K    C C+  DI    G  W AFR    LI EH  FE  I+  IL SS  L FEDIYL+   T+K  L   + +FTY+F +EM+LK  + GFK YFT+ W  LDF IV +SL+SL  +ILG+ +E+   +SLRT+RALRPLRA+SR++GM++VVNAL+ AIPSIFNV+LVC++FWLIFSI GV  F GKF+ C+++ + E     VV NKSEC        +  W N  +N+DN   G+L+L Q+ATF+GWM+IM  A+DS  +  QP  E  +  Y YFVIFI+ GSFF LNLFIGVIIDNFN+ K+K  G   D+F+T  Q+ YYN MKKL ++KP+K + RP+   QGF +D+     F+++I++LI LNM+ MM E   Q+     +L  IN  F  IFT E  +KI  LR +YF   WN
Sbjct:  933 CYT----EKCIRRCPCLDLDITQGRGKSWWAFRKTCFLIVEHNYFETFIIFMILLSSGALAFEDIYLEQRRTIKIILEYADQVFTYIFVVEMLLKWCAYGFKTYFTNAWCWLDFLIVDVSLISLTANILGY-SELGPIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIFNVMLVCLIFWLIFSIMGVNLFAGKFYHCINTTSEELFPPEVVNNKSECFLLIEGGYDARWVNQKVNYDNVGMGYLSLLQVATFKGWMDIMYAAVDSRNVEDQPSYEINLYMYIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKSKIRGQ--DLFMTEDQKKYYNAMKKLGSKKPQKPIPRPQNCCQGFVFDLVTKQFFDILIMVLICLNMITMMAETDEQSIEVEEILFYINFAFIVIFTGECALKIIALRQYYFSVGWN 1358          

HSP 2 Score: 293.123 bits (749), Expect = 1.838e-79
Identity = 164/326 (50.31%), Postives = 225/326 (69.02%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMF-IQPPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFKQMT 5364
            + + ++  F++PTL RV+R+ RIGRVLRLI+ AKGIR LLFAL++SLPALFNIG LL LI+FI+SI GMS F  +KK  G+DD+ NFETF  SI+ LF +TT+ GW+ +L  +    PP C +  +   G   +   G+CG    GI++  T+I I +L+++NMYIAIILENFN A  +    + EDDFEMFY  WER+DP ASQ+I Y++LSDF   L +PL IPKPN I L++ DLP+V GDK+HCLDIL+AL   V+G   +SE    +K  ME K+    P++V    ITTT++RK+E++AA  +QRA++    +R  KQ +
Sbjct: 1374 LADIIEKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLIMFIFSIFGMSNFAYVKKEMGIDDMFNFETFGNSIICLFMITTSAGWDGLLSPILNSAPPDC-DPDIQNPG---SDVRGNCGNPAVGIVFFCTYIVISFLVVVNMYIAIILENFNVATEESGEPLCEDDFEMFYETWERFDPDASQFIAYSSLSDFCDTLKDPLRIPKPNTIKLITMDLPMVPGDKIHCLDILLALTAEVLG---ESEAMDSLKATMEEKFMANNPSKVSYEPITTTLRRKQEEVAAVVIQRAYRKHVLKRTLKQAS 1692          

HSP 3 Score: 274.248 bits (700), Expect = 1.134e-73
Identity = 171/419 (40.81%), Postives = 250/419 (59.67%), Query Frame = 3
Query:  258 LKFEVEDFSDNCQPDPELVAGSILLEDKLGEFPEELLGKPLNEIDQNLK-DKSFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTN----------------QIFDYFIMLTILVNCVFLALNND---YPISEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMS-------ENHSNEFVNAFYYNWTHNPNNWIRNGINY---------LTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
            L  EV +  D  +P  +L AG  L     G+ P ELL  PL ++D   K  K+F+VI+   K   I R++A  +  +  P+S +R+ A+ I  +                ++F  FIM+TIL NCVF+ ++N      I EYVF  IYT E +I++ SRG  I  +T+LRDP+N +D ++I ++Y+   V+        NVS+LRT RVLRALKTIT++PGLKTI  ALI+S+K L +V+IL++FC+S FAL  LQ++ G LR KCV    W  V          N +  F +  Y N + +   +I N  NY         L CGN S +G C +     +CL   G NPN+GYT++DNFGWA L++F+L+T D+WEN + L +R++G   ++F+++++F GSFYLINL+LAVV+M+Y
Sbjct:   41 LNIEVAE-EDLPKPSSDLEAGKSL-PFIYGDPPPELLNVPLEDLDPYYKAQKTFIVIS---KGNTINRFNAESACYILNPFSPVRRGAIRILIHSYPLNIFLIVCHFLKVKLFSMFIMVTILSNCVFMTMSNPPEWSKIMEYVFTGIYTFEALIKVLSRGFCIGDFTFLRDPWNWLDFMVISMAYLTEFVDLG------NVSALRTFRVLRALKTITVIPGLKTIVGALIQSVKKLADVMILTVFCLSVFALIGLQLFMGNLRQKCVV---WPPVFPLINGTTNMNATASFSDKLYANSSFDYEEYINNEENYYFIPGSMDALLCGNSSDSGRCPE---GYMCL-KAGRNPNYGYTSYDNFGWAFLALFRLMTQDFWENLFQLTLRSAGKTYMIFFVVIIFLGSFYLINLILAVVAMAY 441          

HSP 4 Score: 210.69 bits (535), Expect = 4.035e-54
Identity = 95/223 (42.60%), Postives = 155/223 (69.51%), Query Frame = 3
Query: 1809 CSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEY-FNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHT---QIFGD-NIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIR-ANSPLCLLIFI 2459
            C+ W+ F+  +Y  V DPF DL I+ CI +NT+ MA EHYP    ++ +L   N++FT I+  E  LK++A+   Y F VGWNIFD ++V  S+++LG+  V+ LS+ R+FRL RVFKLA+SW T+ +L+ II +++  +GNL++++ +++++FAV+G Q +  +Y +   +I  D  +PRW+  DF+HS ++VFRI+CGEWIE  +DC+  A   +C+++F+
Sbjct:  539 CTPWIRFKKFVYFIVMDPFVDLGITICIVLNTVFMAMEHYPMTAEFESVLSVGNLVFTGIFTAEMVLKLIAMDPYYYFQVGWNIFDSIIVTMSLVELGLANVEGLSVLRSFRLMRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFAGSYKSCVCKISEDCELPRWHMTDFFHSFLIVFRILCGEWIETMWDCMEVAGQGMCIVVFM 761          

HSP 5 Score: 103.219 bits (256), Expect = 2.161e-21
Identity = 70/235 (29.79%), Postives = 120/235 (51.06%), Query Frame = 3
Query: 1704 EDEVEIGNDTNNTDTAEMNPTIDRNCQCCIKQNVLCSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEV-----DALSIFRAFRLF---RVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRI 2384
            ED+ +  N      + +    I R   CC             Q  ++  VT  FFD+ I   I +N I M +E        ++IL Y N  F VI+  EC+LKI+AL + YF+VGWNIFDF+VVI SI+ + + ++      + ++FR  RL    RV +L +  + +R LL  +  ++  + N+ +++ L++++F++ G  ++          D    +NF+ F +S+I +F I
Sbjct: 1255 EDQKKYYNAMKKLGSKKPQKPIPRPQNCC-------------QGFVFDLVTKQFFDILIMVLICLNMITMMAETDEQSIEVEEILFYINFAFIVIFTGECALKIIALRQYYFSVGWNIFDFIVVILSILGIVLADIIEKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLIMFIFSIFGMSNFAYVKKEMGIDD---MFNFETFGNSIICLFMI 1473          

HSP 6 Score: 70.8626 bits (172), Expect = 1.654e-11
Identity = 49/189 (25.93%), Postives = 91/189 (48.15%), Query Frame = 3
Query: 1773 RNCQCC---IKQNVLCSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASE--HYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIID-----LGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYH 2306
            R C C    I Q      W AF+   ++ V   +F+ FI F I +++  +A E  +    +T   IL+Y++ +FT I+++E  LK  A   K YF   W   DF++V  S+I      LG  E+  +   R  R  R  +    ++ MR+++  +   I  + N+ ++ L+   +F+++G   +   ++
Sbjct:  940 RRCPCLDLDITQG-RGKSWWAFRKTCFLIVEHNYFETFIIFMILLSSGALAFEDIYLEQRRTIKIILEYADQVFTYIFVVEMLLKWCAYGFKTYFTNAWCWLDFLIVDVSLISLTANILGYSELGPIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIFNVMLVCLIFWLIFSIMGVNLFAGKFY 1127          

HSP 7 Score: 62.3882 bits (150), Expect = 6.054e-9
Identity = 61/249 (24.50%), Postives = 110/249 (44.18%), Query Frame = 3
Query: 3198 LKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXX--XXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKE-----------NQMAYYAYFVIFILVGSFFILNLFIGVIIDNFN 3905
            +++ L  IN+ F  +F  E  LKII+L  + YF+  W I      I+SI  + L + I  +    T FR +R  R  R LR I   +G++ ++ AL+ ++P++FN+ L+  +   IFSI G+  F                             +     +   NF+   N  + L+ I T  GW  ++   ++S   +  P  +           N      +F  +I++    ++N++I +I++NFN
Sbjct: 1322 VEEILFYINFAFIVIFTGECALKIIALR-QYYFSVGWNIFDFIVVILSILGIVLADIIEKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLIMFIFSIFGMSNF--------------------------AYVKKEMGIDDMFNFETFGNSIICLFMITTSAGWDGLLSPILNSAPPDCDPDIQNPGSDVRGNCGNPAVGIVFFCTYIVISFLVVVNMYIAIILENFN 1543          

HSP 8 Score: 61.6178 bits (148), Expect = 9.300e-9
Identity = 73/321 (22.74%), Postives = 132/321 (41.12%), Query Frame = 3
Query:  495 WSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYP--------ISEY---VFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWEN-QYNLV----IRASGSWNI-----LFYIIVVFFGSFYLINLMLAVV 1394
            W   RK   LI  +  F+ FI+  IL++   LA  + Y         I EY   VF  I+ +EM+++  + G      TY  + +  +D LI+ +S I +            + SLRTLR LR L+ ++   G++ + +AL+ ++  +F V+++ L     F++  + ++ G   + C+     +    E  +N+    F          W+   +NY                                    DN G   LS+ Q+ T   W +  Y  V    +    S+ I     ++++I + FGSF+ +NL + V+
Sbjct:  957 WWAFRKTCFLIVEHNYFETFIIFMILLSSGALAFEDIYLEQRRTIKIILEYADQVFTYIFVVEMLLKWCAYGF----KTYFTNAWCWLDFLIVDVSLISLTANILGYSELGPIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIFNVMLVCLIFWLIFSIMGVNLFAGKFYH-CINTTSEELFPPEVVNNK-SECFLLIEGGYDARWVNQKVNY------------------------------------DNVGMGYLSLLQVATFKGWMDIMYAAVDSRNVEDQPSYEINLYMYIYFVIFIIFGSFFTLNLFIGVI 1235          

HSP 9 Score: 59.3066 bits (142), Expect = 5.269e-8
Identity = 49/216 (22.69%), Postives = 98/216 (45.37%), Query Frame = 3
Query:  486 CAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYP----------ISEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRN 1103
            C PW   +K    I  +   D  I + I++N VF+A+ + YP          +   VF  I+T EMV+++    + ++ Y Y +  +N+ D +I+ +S + + +    G     +S LR+ R++R  K     P L  +   +  S+  L  + ++    +  FA+  +Q++ G+ ++ CV  +     +   H  +F ++F   +      WI  
Sbjct:  539 CTPWIRFKKFVYFIVMDPFVDLGITICIVLNTVFMAMEH-YPMTAEFESVLSVGNLVFTGIFTAEMVLKL----IAMDPYYYFQVGWNIFDSIIVTMSLVELGLANVEG-----LSVLRSFRLMRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFAGSYKS-CVCKISEDCELPRWHMTDFFHSFLIVFRILCGEWIET 743          

HSP 10 Score: 56.225 bits (134), Expect = 4.396e-7
Identity = 30/76 (39.47%), Postives = 46/76 (60.53%), Query Frame = 3
Query: 4041 QGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGL-RWHYFRYMWN 4265
            + F Y + M    +L I I I LN V M +EHY  TA F +VL + N++F+ IFT E ++K+  +  ++YF+  WN
Sbjct:  546 KKFVYFIVMDPFVDLGITICIVLNTVFMAMEHYPMTAEFESVLSVGNLVFTGIFTAEMVLKLIAMDPYYYFQVGWN 621          

HSP 11 Score: 53.9138 bits (128), Expect = 2.176e-6
Identity = 63/290 (21.72%), Postives = 124/290 (42.76%), Query Frame = 3
Query: 3003 KKPFHCCYCIVCDI--ETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFI 3866
            ++P   C+    DI  +  C + W  F+     I      +  I +CI+ +++ +  E  +       +  L V N +FT +F  EM+LK+I++    YF   W I D  IV++SL+ L          +     LR+ R +R  +    W  + +++  +  ++ ++ N+ LV  +   IF++ G+Q F G +  C+            +    E  R + T         +  + FL +++I   E W+E M D ++  G         Q      F++ +++G+  +
Sbjct:  519 ERPCPPCWYTFADIFLKWDCCTPWIRFKKFVYFIVMDPFVDLGITICIVLNTVFMAME--HYPMTAEFESVLSVGNLVFTGIFTAEMVLKLIAMDPYYYFQVGWNIFDSIIVTMSLVELGL------ANVEGLSVLRSFRLMRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFAGSYKSCV----------CKISEDCELPRWHMT---------DFFHSFLIVFRILCGE-WIETMWDCMEVAG---------QGMCIVVFMMVMVIGNLVV 771          
BLAST of Sodium channel protein vs. Ensembl Cavefish
Match: scn1lab (sodium channel, voltage-gated, type I like, alpha b [Source:ZFIN;Acc:ZDB-GENE-060906-1])

HSP 1 Score: 382.489 bits (981), Expect = 2.399e-107
Identity = 209/420 (49.76%), Postives = 277/420 (65.95%), Query Frame = 3
Query: 3012 FHCCYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHT--WANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            F CC     DIE      W   R    +I EH  FE  I+  IL SS  L FEDIY++   T+K  L   + +FTY+F +EM+LK ++ GF  YFT+ W  LDF IV +SL+SL+   LG+ +E++A +SLRT+RALRPLRA+SR++GM++VVNAL+ AIPSI NVLLVC++FWLIFSI GV  F GK++ C++S T E    + V NKSECL  N +  W N  INFDN   G+LAL Q+ATF+GWM+IM  A+DS  +  QP  E  +  Y YFVIFI+ GSFF LNLFIGVIIDNFN+ K K      D+F+T  Q+ YYN MKKL ++KP+K + RP    QG  +D+     F+++I+ILI LNMV MM+E   QT    N+L  IN++F  +FT E ++K+  LR ++F   WN
Sbjct: 1157 FQCCQV---DIEKGKWKSWWTLRKTCFIIVEHNWFESFIIFMILLSSGALAFEDIYIEQRKTIKTVLEYADKVFTYIFILEMLLKWVAYGFVKYFTNAWCWLDFLIVDVSLVSLVATALGY-SELSAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKYYHCVNSTTDEMFPISEVNNKSECLALNESARWKNVKINFDNVGAGYLALLQVATFKGWMDIMYAAVDSRNVEDQPDYEVNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKMSQ---DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPTNKFQGLIFDLITKQAFDIIIMILICLNMVTMMVETDDQTKEMDNILYWINLVFIVLFTGECVLKMVSLRHYFFTVGWN 1569          

HSP 2 Score: 287.73 bits (735), Expect = 1.048e-77
Identity = 156/327 (47.71%), Postives = 227/327 (69.42%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMF-IQPPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFKQMTE 5367
            + E ++  F++PTL RV+R+ RIGR+LRLIK AKGIR LLFAL++SLPALFNIG LL L++FIY+I GMS F  +K   G+DD+ NFETF  S+L LF++TT+ GW+ +L  +   + P C++        Y+    GDCG    GI +  ++I IC+LI++NMYIA+ILENF+ A  +    ++EDDFEMFY VWER+DP+A+Q+++Y  LSDF   LD PL IPKPN I L++ DLP+V GD++HCLDIL A    V+G   +  E   ++ QME ++    P++V    ITTT++RK+E+++A  +QRA++H + +   K+ ++
Sbjct: 1585 LSEVIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAFVKHEAGIDDMFNFETFGNSMLCLFQITTSAGWDGLLAPILNKREPDCDSETEHPGNSYR----GDCGNPSVGIFFFVSYIIICFLIVVNMYIAVILENFSVATEESAEPLSEDDFEMFYEVWERFDPNATQFVEYDKLSDFADSLDPPLRIPKPNKIQLIAMDLPMVSGDRIHCLDILFAFTLRVLG---EEGEMDALRGQMEERFMASNPSKVSYEPITTTLRRKQEEMSAIIIQRAFRHYRIRLTVKKASD 1904          

HSP 3 Score: 265.003 bits (676), Expect = 8.511e-71
Identity = 156/392 (39.80%), Postives = 244/392 (62.24%), Query Frame = 3
Query:  273 EDFSDNCQPDPELVAGSILLEDKLGEFPEELLGKPLNEIDQNLKDKS-FVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPIS---EYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDW-KNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINY---------LTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
            +D  +  +P+ +L AG  L     G+ P  L+  PL ++D   ++++ F+V+N   + K I+R++AT +    + ++ +R++A+     ++  + IM TIL NC F+ L+N    +   EY F  IYT E +I++ +RG  +  +T+LRDP+N +D  +I+++Y+   V+        NVS+LRT RVLRALKTI+++PGLKTI  ALI+S+K L +V+IL++FC+S FAL  LQ++ G LR KCV+   W ++  ++N+S E      YN T N   +I +  NY         L CGN S AG C    P        G NP++GYT+FD F WA LS+F+L+T D+WEN Y   +RA+G   ++F+++V+F GSFYL+NL+LAVV+M+Y
Sbjct:   45 DDDENGPKPNSDLEAGKSL-PFIYGDIPPGLVSVPLEDLDPYYQNQTTFIVLN---RGKAIFRFNATPALYFLSAFNPLRRVAI-----KVLVFVIMCTILTNCAFMTLSNPPEWAKNVEYTFTGIYTFESLIKILARGFCVGHFTFLRDPWNWLDFSVIVMAYVTEFVDLG------NVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRQKCVR---WPQSNGTQNYSMELN---LYNSTFNWTEYILDDRNYYYLPNRRDALLCGNASDAGQC----PEGYTCIKAGRNPDYGYTSFDTFSWAFLSLFRLMTQDFWENLYQQTLRAAGKPYMVFFVLVIFLGSFYLVNLILAVVAMAY 411          

HSP 4 Score: 186.037 bits (471), Expect = 1.524e-46
Identity = 92/226 (40.71%), Postives = 145/226 (64.16%), Query Frame = 3
Query: 1809 CSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEK---TWDDILKYSNIIFTVIYIIECSLKIMALSKEY-FNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHT---QIFGD-NIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIR-ANSPLCLLIFI 2459
            C  W+  +  + + V DPF DL I+ CI +NT+ MA EHYP  K   TW             I+  E  LK++AL   Y F  GWNIFD ++V  S+++LG+  V+ LS+ R+FRL RVFKLA+SW T+ +L+ II +++  +GNL++++ +++++FAV+G Q +  +Y     +I  D  +PRW+  DF+HS ++VFR++CGEWIE  +DC+  A   +CL++F+
Sbjct:  722 CPMWLKVKTIVKMIVMDPFVDLAITICIVLNTLFMAMEHYPMTKESTTW-------------IFTAEMCLKVIALDPYYYFQEGWNIFDGIIVSLSLMELGLANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYRECVCKIAEDCELPRWHMVDFFHSFLIVFRVLCGEWIETMWDCMEVAGQTMCLIVFM 934          

HSP 5 Score: 104.375 bits (259), Expect = 1.046e-21
Identity = 61/194 (31.44%), Postives = 110/194 (56.70%), Query Frame = 3
Query: 1827 FQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEV-----DALSIFRAFRLF---RVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRI 2384
            FQ  ++  +T   FD+ I   I +N + M  E     K  D+IL + N++F V++  EC LK+++L   +F VGWN+FDFVVVI SI+ + + EV      + ++FR  RL    R+ +L +  + +R LL  +  ++  + N+ +++ LV++++A+ G  ++    H     D    +NF+ F +SM+ +F+I
Sbjct: 1494 FQGLIFDLITKQAFDIIIMILICLNMVTMMVETDDQTKEMDNILYWINLVFIVLFTGECVLKMVSLRHYFFTVGWNVFDFVVVILSIVGMFLSEVIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAFVKHEAGIDD---MFNFETFGNSMLCLFQI 1684          

HSP 6 Score: 72.4034 bits (176), Expect = 5.103e-12
Identity = 60/243 (24.69%), Postives = 115/243 (47.33%), Query Frame = 3
Query: 1653 DSEEEKEGKDCDN--KAEYEDEVEIGNDTNNTDTAEMNP--TID-RNC---------QCCIKQNVLCSKWVAF---QNRLYIFVTDPFFDLFISFCIFINTIIMASE--HYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIID-----LGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYH 2306
            D E  KE    DN   +     V+I       ++ E+ P  ++D  +C         QCC + ++   KW ++   +   +I V   +F+ FI F I +++  +A E  +    KT   +L+Y++ +FT I+I+E  LK +A    +YF   W   DF++V  S++      LG  E+ A+   R  R  R  +    ++ MR+++  +   I  + N+ ++ L+   +F+++G   +   Y+
Sbjct: 1101 DVEGSKEKLPEDNVLSSSEGSTVDIRPPGEGAESVELEPEESLDPEDCFTEGCVMRFQCC-QVDIEKGKWKSWWTLRKTCFIIVEHNWFESFIIFMILLSSGALAFEDIYIEQRKTIKTVLEYADKVFTYIFILEMLLKWVAYGFVKYFTNAWCWLDFLIVDVSLVSLVATALGYSELSAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKYY 1342          

HSP 7 Score: 66.6254 bits (161), Expect = 3.290e-10
Identity = 62/268 (23.13%), Postives = 118/268 (44.03%), Query Frame = 3
Query: 3219 INYIFTYLFCIEMILKIISLGFKV-YFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFF-KCLD------------------------------------SNTRERLA------ATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVI 3890
            + Y FT ++  E ++KI++ GF V +FT      ++   S+ +++ + + +  G       +LRT R LR L+ IS   G+K +V ALI ++  + +V+++ +    +F++ G+Q F G    KC+                                      N R+ L       A   P    C++          +FD  +  FL+L+++ T + W  + Q  + + G   +P       Y  +FV+ I +GSF+++NL + V+
Sbjct:  154 VEYTFTGIYTFESLIKILARGFCVGHFTFLRDPWNWLDFSVIVMAYVTEFVDLGN----VSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRQKCVRWPQSNGTQNYSMELNLYNSTFNWTEYILDDRNYYYLPNRRDALLCGNASDAGQCPEGYTCIKAGRNPDYGYTSFDTFSWAFLSLFRLMTQDFWENLYQQTLRAAG---KP-------YMVFFVLVIFLGSFYLVNLILAVV 407          

HSP 8 Score: 60.4622 bits (145), Expect = 2.102e-8
Identity = 72/328 (21.95%), Postives = 139/328 (42.38%), Query Frame = 3
Query:  495 WSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDY--------PISEY---VFLAIYTLEMVIRMTSRGVI---INSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVN-VSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNI-------------LFYIIVVFFGSFYLINLMLAVV 1394
            W  +RK   +I  +  F+ FI+  IL++   LA  + Y         + EY   VF  I+ LEM+++  + G +    N++ +L   + +VD+ ++ L      V    G + ++ + SLRTLR LR L+ ++   G++ + +AL+ ++  +  V+++ L     F++  + ++ G   + CV              N   +  +      P + + N    L     +   N                       NFDN G   L++ Q+ T   W    +++  A  S N+             L+++I + FGSF+ +NL + V+
Sbjct: 1172 WWTLRKTCFIIVEHNWFESFIIFMILLSSGALAFEDIYIEQRKTIKTVLEYADKVFTYIFILEMLLKWVAYGFVKYFTNAWCWLD--FLIVDVSLVSL------VATALGYSELSAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKYYH-CV--------------NSTTDEMF------PISEVNNKSECLALNESARWKNVK--------------------INFDNVGAGYLALLQVATFKGW---MDIMYAAVDSRNVEDQPDYEVNLYMYLYFVIFIIFGSFFTLNLFIGVI 1447          
BLAST of Sodium channel protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008004.1 (pep scaffold:Pmarinus_7.0:GL477228:88466:118438:1 gene:ENSPMAG00000007222.1 transcript:ENSPMAT00000008004.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 346.28 bits (887), Expect = 7.930e-97
Identity = 187/422 (44.31%), Postives = 268/422 (63.51%), Query Frame = 3
Query: 3009 PFHCCYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSEC---LRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            P  CC          C   +HA R     +     F G +L  ++ SS  L  +D Y  +N  L Q LR ++  +   F +EM LK+I LG   YFTSFWT+LD F+V +S L+ +   +     + + RSLRT+RALRPLRAISRW+GM++VVNAL+ +IPSI NV+L+C++FW++F I GVQ F GKFF+C+D+    RL AT V N++ C     + + W N+ IN+DN  + +LAL Q+AT EGW+E M DA DSTG++ QP     +    +F+IF+++GSFFILNLFIGV+IDNFN + +K EG  +   LT  Q+ +Y TM++L   KP K++ +P+  V  FFY +     FE +   +I LNMV++  EHY+Q+ +FTN+  +IN++F+ +F LEA +KI G R HYFR  W+
Sbjct:  996 PSGCC--------GGCVGAFHAVRRMVFRLCHTTGFNGLVLFMVIMSSFTLTLDDKYNSSNAQLMQVLRYMDIFYMAFFSMEMFLKMIGLGLHKYFTSFWTLLDCFLVLVSWLNQLASAV---PALKSLRSLRTLRALRPLRAISRWKGMRLVVNALVTSIPSISNVMLMCLLFWMVFGIAGVQLFGGKFFRCIDAEG-NRLPATEVANRTVCESLAAEGYLWVNAIINYDNILSAYLALLQVATLEGWIEQMADASDSTGVDQQPSYNANIYSQMFFIIFVIIGSFFILNLFIGVVIDNFNSV-HKREGALM-ALLTEDQQKFYKTMRRLYRSKPSKSIPQPQNRVLRFFYLLVHRRLFEYISTAVISLNMVMLASEHYKQSESFTNITKIINLVFTGLFMLEAALKILGNRIHYFRQPWD 1403          

HSP 2 Score: 209.92 bits (533), Expect = 1.214e-54
Identity = 127/290 (43.79%), Postives = 185/290 (63.79%), Query Frame = 1
Query: 4477 IKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQPPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQR 5346
            I+  +GIRKL++ LVISLPAL NIG LLLLI+F+Y ++G+S+F +L  +G + ++VNFETF  S+ LLFRL TAGGWND++ +            VL      AI           I Y TTF+    +IIINMY+AIILENFN+A  QEE G+T+DD +MFY VW ++DP A+Q++    L +F   L  P  IPKPN + + +  L IVEG+K+HCLD+L  + + + G +  +E  R++ RQ + K    FP R   +V++TT+  ++E+ AA  +QRA++H +  +
Sbjct: 1448 IRSVEGIRKLIYTLVISLPALINIGLLLLLIMFMYGVLGVSIFRDLPYSGSITNMVNFETFANSMTLLFRLNTAGGWNDVMGS------------VLGTKTQNAI---------LVIAYFTTFVIFSNIIIINMYVAIILENFNEAQEQEETGVTDDDIDMFYRVWGKFDPLATQFLACEQLPNFFDALKRPFRIPKPNTVKIAALQLAIVEGNKVHCLDVLKTMTRVIFGRVVKTEHLRQLSRQAQEKVMRRFPLRRIMHVVSTTLALRREEKAAHVIQRAFRHWRGHQ 1716          

HSP 3 Score: 194.126 bits (492), Expect = 9.211e-50
Identity = 106/250 (42.40%), Postives = 153/250 (61.20%), Query Frame = 3
Query:  621 YVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNW-IRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFY 1367
            Y+F AIYT E +I+  +RG + + Y+YLR+ +N +D ++IIL+Y+ I      G        L  LR  RALK I ILP LKTI  A+ KS  +L  V++L +F +   +LF LQI++G LR KCV        +    ++   +A + N+  N +NW I + I  + CGN +   +C     N  CLP IG NPN G T+FDNFGWA+++ FQ+IT+DYWEN YN+V+RASG + I F+I+V+  G +Y
Sbjct:    1 YIFTAIYTGEFLIKTLARGFVFHPYSYLRNAWNWLDFIVIILAYMTIAFPFLPG--------LSALRAFRALKMIAILPALKTIVGAIFKSAGLLLNVMLLMIFALIIISLFGLQIFRGVLRQKCV-------FLPNPGTSSLSDAEWSNYVQNKSNWLITDDIEIMVCGNGTGTSHCPA---NYTCLPDIGENPNHGATSFDNFGWAMMTSFQIITIDYWENCYNMVLRASGQYFIGFFIVVIMLGGYY 232          

HSP 4 Score: 184.496 bits (467), Expect = 7.308e-47
Identity = 100/236 (42.37%), Postives = 148/236 (62.71%), Query Frame = 3
Query: 1785 CCIKQNVLCSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMAL-SKEYFNVGWNIFDFVVVIASIIDLGVEEVDA----LSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSY-RNTYH--TQIFGDNIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIR-ANSPLCLLIFIPT 2465
             C+     CS +VAF+ RL   VT   F+ FI+  I  NT++MA ++Y     +   L   N + T I+I E  LK+ AL  + YF++GWNIFDF VVI S+++  ++ +      +SI R FR+ RVFKLA+ W+T+ LL+ ++ S I EM NL++I  LV+Y+FAVIG Q   R+ YH   +     +PRWNF DF+ S ++VFR++CGEWIEP ++C+  +N   C+ +FI T
Sbjct:  543 ACLNSLRCCSAFVAFRQRLRTLVTSSVFETFITILIITNTVMMAIDYY--NAPYSSALDIGNTVLTTIFIAEAVLKLTALFPRVYFHLGWNIFDFCVVITSVVEWILDSMSNTNINISIIRTFRILRVFKLAKKWKTLNLLIRVMKSAIGEMRNLTVIFALVIYIFAVIGMQLIGRDYYHNRNKFSSGQVPRWNFLDFYSSFLMVFRVLCGEWIEPLYECLVCSNIYYCIPLFILT 776          

HSP 5 Score: 72.7886 bits (177), Expect = 8.646e-13
Identity = 58/203 (28.57%), Postives = 114/203 (56.16%), Query Frame = 3
Query: 1830 QNRL----YIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRA--------FRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRI-ICGEW 2399
            QNR+    Y+ V    F+   +  I +N +++ASEHY   +++ +I K  N++FT ++++E +LKI+     YF   W+IFDF VV  S+ ++ +E + +   F           RL R+ +L +S + +R L+  +  ++  + N+ +++LL+++M+ V+G   +R+  ++    + +   NF+ F +SM L+FR+   G W
Sbjct: 1325 QNRVLRFFYLLVHRRLFEYISTAVISLNMVMLASEHYKQSESFTNITKIINLVFTGLFMLEAALKILGNRIHYFRQPWDIFDFFVVCISLTEIVLETMASQVNFSPAILRVFRVVRLVRLLRLIRSVEGIRKLIYTLVISLPALINIGLLLLLIMFMYGVLGVSIFRDLPYSGSITNMV---NFETFANSMTLLFRLNTAGGW 1524          

HSP 6 Score: 53.9138 bits (128), Expect = 3.836e-7
Identity = 32/138 (23.19%), Postives = 68/138 (49.28%), Query Frame = 3
Query: 1902 TIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQS---WQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTY 2303
            T+ +  ++  S      +L+Y +I +   + +E  LK++ L   +YF   W + D  +V+ S ++     V AL   R+ R  R  +  ++   W+ MRL++  + ++I  + N+ ++ LL   +F + G Q +   +
Sbjct: 1037 TLTLDDKYNSSNAQLMQVLRYMDIFYMAFFSMEMFLKMIGLGLHKYFTSFWTLLDCFLVLVSWLNQLASAVPALKSLRSLRTLRALRPLRAISRWKGMRLVVNALVTSIPSISNVMLMCLLFWMVFGIAGVQLFGGKF 1174          

HSP 7 Score: 52.7582 bits (125), Expect = 9.524e-7
Identity = 63/323 (19.50%), Postives = 134/323 (41.49%), Query Frame = 3
Query:  489 APWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPIS-----------EYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASG-----SWNI-----LFYIIVVFFGSFYLINLMLAVV 1394
              +  +R++   +     F+  ++  ++++   L L++ Y  S           +  ++A +++EM ++M   G+    + Y    + L+D  ++++S++  +        ++   SLRTLR LR L+ I+   G++ + +AL+ S+  +  V+++ L     F +  +Q++ G    +C+     +   +E  +     +           W+   INY                                    DN   A L++ Q+ TL+ W  Q      ++G     S+N      +F+II V  GSF+++NL + VV
Sbjct: 1005 GAFHAVRRMVFRLCHTTGFNGLVLFMVIMSSFTLTLDDKYNSSNAQLMQVLRYMDIFYMAFFSMEMFLKMIGLGL----HKYFTSFWTLLDCFLVLVSWLNQLASAVPALKSLR--SLRTLRALRPLRAISRWKGMRLVVNALVTSIPSISNVMLMCLLFWMVFGIAGVQLFGGKF-FRCIDAEGNRLPATEVANRTVCESL----AAEGYLWVNAIINY------------------------------------DNILSAYLALLQVATLEGWIEQMADASDSTGVDQQPSYNANIYSQMFFIIFVIIGSFFILNLFIGVV 1280          

HSP 8 Score: 50.0618 bits (118), Expect = 6.548e-6
Identity = 24/87 (27.59%), Postives = 45/87 (51.72%), Query Frame = 3
Query: 3681 INFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYID 3941
            +NF+   N    L+++ T  GW ++M       G  L  K +N +   AYF  F++  +  I+N+++ +I++NFN  + + E    D
Sbjct: 1503 VNFETFANSMTLLFRLNTAGGWNDVM-------GSVLGTKTQNAILVIAYFTTFVIFSNIIIINMYVAIILENFNEAQEQEETGVTD 1582          
BLAST of Sodium channel protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002303.1 (pep scaffold:Pmarinus_7.0:GL476946:177796:226078:1 gene:ENSPMAG00000002078.1 transcript:ENSPMAT00000002303.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 284.263 bits (726), Expect = 1.604e-77
Identity = 155/357 (43.42%), Postives = 233/357 (65.27%), Query Frame = 3
Query:  345 GEFPEELLGKPLNEIDQNLKDK-SFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPISEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQ--NNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
            GE P++++ +PL ++D   ++K +F+V+N   K K I+R++A K+  L   ++ IR++++ I T+ +F   IM TIL NCVF+A+N +  + EYVF AIY  E ++++ +RG    ++TYLRDP+N +D+ ++        V  C+       N+S+LR  RV+RALKTI+++PGLKTI  ALI+S+K L +V IL+LFC+S FAL ALQ+++G L+NKCV+   W    + N    F+N   Y    + +N+  +    L C N S    C    P+       G NPN+GYTN+DNFGWA LS+F+L+T DYWEN Y L +RASG   ++F+++V+F GSFYLINL+LAVV+ SY
Sbjct:   65 GEVPQKMISEPLEDLDPYYRNKMTFLVLN---KGKTIFRFNACKALCLFTVFNPIRRISIKILTHTLFTILIMATILTNCVFMAINTELKVVEYVFTAIYMFEALVKILARGFFFGAFTYLRDPWNWLDLAVL--------VIACFTSIPGFANLSALRMFRVMRALKTISVVPGLKTIVRALIQSVKKLSDVTILTLFCLSIFALIALQLFKGNLKNKCVR---WPIPGNSN----FINISQY--LEDKDNYYFHKNVPLLCSNSSENNTC----PDGFICFKAGKNPNYGYTNYDNFGWAFLSLFRLMTQDYWENLYQLTLRASGKVYMIFFVMVIFLGSFYLINLILAVVAKSY 397          

HSP 2 Score: 276.944 bits (707), Expect = 2.965e-75
Identity = 148/310 (47.74%), Postives = 219/310 (70.65%), Query Frame = 1
Query: 4408 ASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFI-QPPYC--NNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWK 5328
            ++ + PTL RVVR+FR+GR+LRLI+ A+GIR LLFAL++SLPALFNIG LL +++FI+S+ GMS FG LK T G+D++ NFETF  S+L LF++TT+ GW+ +L    + + P C     HV  + V      G+CG    G  +  T+I I +LI++NMYIA+ILENFN A A+    ++EDDFEMFY +W ++DP+A+Q+I +  L +F+  LDEPL +PKPN +A+   DLPIVEGD++HCL++L AL K V+G  E  E  R+   QME ++    P +V+   +TTT++R+++++AA  +Q+A++
Sbjct: 1441 SNIVEPTLFRVVRLFRVGRILRLIRGAQGIRTLLFALLMSLPALFNIGLLLFVVMFIFSVFGMSNFGYLKHTAGIDEIFNFETFGGSMLCLFQITTSAGWDGLLAPTLLSKEPDCEPEAVHVGTNVV------GNCGNKAIGCAFFVTYIIISFLIVVNMYIAVILENFNVATAESSEPLSEDDFEMFYDIWGKFDPNATQFISFTELPNFIDSLDEPLRVPKPNQLAVAVMDLPIVEGDRIHCLEVLFALTKRVLGQGEGLEGLRE---QMEERFIAANPEQVNLEPVTTTLQRQQQEMAALKIQKAYR 1741          

HSP 3 Score: 262.692 bits (670), Expect = 7.506e-71
Identity = 142/272 (52.21%), Postives = 191/272 (70.22%), Query Frame = 3
Query: 3459 KIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHT--WANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINL-QPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            ++VVNAL+ AIPSI NVLLVC++FWLIFSI GV FFKGKF KC++S     +  +++PN++ CL Q+ +  W N  +NFDN  +G+LAL Q++TF+GWM+IM  A+DS   N  QP+ E  + YY +FVIFI+ G+FFILNLFIGVIIDNFN+ K K+ G   D+FLT  QR Y+N MKKL ++KPRK V RP    QG  YD+     FE+ I++LI LNM+ MMIE   Q+ A    L++ NI+F  IFT E ++K+  LR ++F + WN
Sbjct: 1149 QVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNFFKGKFSKCVNSTDDSTMNESIIPNQNACLEQSPSLRWKNLPVNFDNVASGYLALLQVSTFKGWMDIMYAAVDSRQNNTEQPRFEESLGYYLFFVIFIIFGAFFILNLFIGVIIDNFNQQKKKFGGE--DIFLTEEQRKYHNAMKKLGSKKPRKPVPRPNNKYQGMAYDLVHWQAFEIGIMVLICLNMLTMMIEADEQSEAMKTALNITNIVFIGIFTTECVLKMFALRQYFFTFPWN 1418          

HSP 4 Score: 91.6633 bits (226), Expect = 1.548e-18
Identity = 61/195 (31.28%), Postives = 101/195 (51.79%), Query Frame = 3
Query: 1827 FQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEVDALS------IFRAFRLFRV---FKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRI 2384
            +Q   Y  V    F++ I   I +N + M  E     +     L  +NI+F  I+  EC LK+ AL + +F   WN+FDF VV  S+ DL + +   LS      +FR  RLFRV    +L +  Q +R LL  +  ++  + N+ +++ +V+++F+V G  ++    HT    D I  +NF+ F  SM+ +F+I
Sbjct: 1343 YQGMAYDLVHWQAFEIGIMVLICLNMLTMMIEADEQSEAMKTALNITNIVFIGIFTTECVLKMFALRQYFFTFPWNVFDFAVVTLSVFDLAMADNSWLSNIVEPTLFRVVRLFRVGRILRLIRGAQGIRTLLFALLMSLPALFNIGLLLFVVMFIFSVFGMSNFGYLKHTAGI-DEI--FNFETFGGSMLCLFQI 1534          

HSP 5 Score: 78.1814 bits (191), Expect = 1.992e-14
Identity = 76/281 (27.05%), Postives = 133/281 (47.33%), Query Frame = 3
Query: 3108 RAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGT---EMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNI-NFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKK-----------ENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFN 3905
            +AFE  I+V I  + + +  E    + +  +K AL + N +F  +F  E +LK+ +L  + +FT  W + DF +V++S+  L      + +   E T FR +R  R  R LR I   QG++ ++ AL+ ++P++FN+ L+  V   IFS+ G+  F   + K                         HT     I NF+      L L+QI T  GW  ++   + S   + +P+             N+    A+FV +I++    ++N++I VI++NFN
Sbjct: 1354 QAFEIGIMVLICLNMLTMMIEAD--EQSEAMKTALNITNIVFIGIFTTECVLKMFALR-QYFFTFPWNVFDFAVVTLSVFDLAMADNSWLSNIVEPTLFRVVRLFRVGRILRLIRGAQGIRTLLFALLMSLPALFNIGLLLFVVMFIFSVFGMSNF--GYLK-------------------------HTAGIDEIFNFETFGGSMLCLFQITTSAGWDGLLAPTLLSKEPDCEPEAVHVGTNVVGNCGNKAIGCAFFVTYIIISFLIVVNMYIAVILENFN 1604          

HSP 6 Score: 70.8626 bits (172), Expect = 3.311e-12
Identity = 74/315 (23.49%), Postives = 138/315 (43.81%), Query Frame = 3
Query: 3066 WHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXX---XXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFF-KC--------------------------------LDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNF 3902
            ++  R  S+ I  H  F   I+  IL + + +            +   L+V+ Y+FT ++  E ++KI++ GF  +F +F  + D      +++ +++    I GF   ++A R  R MRAL+    IS   G+K +V ALI ++  + +V ++ +    IF++  +Q FKG    KC                                L SN+ E       P+   C +          N+DN    FL+L+++ T + W  + Q  + ++G            Y  +FV+ I +GSF+++NL + V+  ++
Sbjct:  113 FNPIRRISIKILTHTLFTILIMATILTNCVFM-----------AINTELKVVEYVFTAIYMFEALVKILARGF--FFGAFTYLRDPWNWLDLAVLVIACFTSIPGFAN-LSALRMFRVMRALK---TISVVPGLKTIVRALIQSVKKLSDVTILTLFCLSIFALIALQLFKGNLKNKCVRWPIPGNSNFINISQYLEDKDNYYFHKNVPLLCSNSSEN---NTCPDGFICFKAGKNPNYGYTNYDNFGWAFLSLFRLMTQDYWENLYQLTLRASG----------KVYMIFFVMVIFLGSFYLINLILAVVAKSY 397          
BLAST of Sodium channel protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007955.1 (pep scaffold:Pmarinus_7.0:GL476358:329878:417380:1 gene:ENSPMAG00000007100.1 transcript:ENSPMAT00000007955.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 281.182 bits (718), Expect = 2.235e-76
Identity = 151/326 (46.32%), Postives = 222/326 (68.10%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQP-PYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFKQMT 5364
            + + ++  F++PTL RV+R+ RIGR+LRLI+ AKGIR LLFAL++SLPALFNIG LL L++FIYSI GMS F  +KK  G+DD+ NFETF  S++ LF++TT+ GW+ +L  +     P C +  +   G   ++  GDCG    GI++  ++I I +L+++NMYIAIILENF+ A  +    ++EDDFEMFY +WE++DP A+Q+I +  L DF   LDEPL +PKPN I L++ DLP+V  D++HCLDIL A  K V+G   +      +K QME ++    P++     ITTT++RK+E++A + +QRA++     R+ KQ +
Sbjct: 1559 LADMIQKYFVSPTLFRVIRLARIGRILRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYSIFGMSNFAYVKKESGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSGVPDC-DPEIEHPG---SLVKGDCGNPMVGIIFFVSYIIISFLVVVNMYIAIILENFSVATEESSEPLSEDDFEMFYEIWEKFDPDATQFIAWERLPDFADALDEPLRVPKPNKIKLIAMDLPMVINDRIHCLDILFAFTKRVLG---EGAGMDALKTQMEDRFMAANPSKTSYEPITTTLRRKQEEVAVRVIQRAYRRHILHRSLKQAS 1877          

HSP 2 Score: 278.485 bits (711), Expect = 1.373e-75
Identity = 163/393 (41.48%), Postives = 247/393 (62.85%), Query Frame = 3
Query:  264 FEVEDFSDNCQPDPELVAGSILLEDKLGEFPEELLGKPLNEIDQNLK-DKSFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQ----IFDYFIMLTILVNCVFLALNNDYPIS---EYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCV--KMVDWKNVMSENHSNEFVNAFYYNWTHNPNNW--IRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
            FE ED  D  +P  +L  G  L     G+ P E + +PL ++D      K+F+V+N+    K I+R+SAT +  +  P++ +R+ A+ I T+     +F  FIM TIL NCVF+ ++     +   EY F  IYT E ++++ +RG  ++ +T+LRDP+N +D  +I+++Y+   ++        NVS+LRT RVLRALKTI+++PGLKTI  ALI+++K L +V+IL++FC+S FAL  LQ++ G LR+KC+   + +  NV   N + E  N  + N+ +N +N   +    + L CGN S AG+C    P        G NPN+GYT+FD F WA LS+F+L+T DYWEN Y L +RA+G   I F+++V+F GSFYLINL+LAVV+M+Y
Sbjct:   40 FESED--DQPKPSSDLEVGKSL-PFMYGDMPPECVAEPLEDLDPFYSTQKTFIVLNSG---KAIFRFSATPALYILTPFNPVRRYAIKILTHSWQRTLFSIFIMFTILTNCVFMTMSEPPTWTKNVEYTFTGIYTFESMVKILARGFCLHPFTFLRDPWNWLDFCVIVMAYVTEFIDLG------NVSALRTFRVLRALKTISVIPGLKTIVGALIQAVKQLSDVMILTVFCLSVFALIGLQLFMGNLRHKCILWPIANQTNVTEFNETAEPFN--WENYVNNEDNQYKLEGSKDALLCGNGSDAGSC----PEKFVCVKGGRNPNYGYTSFDTFSWAFLSLFRLMTQDYWENLYQLTLRAAGKPYI-FFMVVIFLGSFYLINLILAVVAMAY 413          

HSP 3 Score: 229.565 bits (584), Expect = 1.511e-60
Identity = 138/305 (45.25%), Postives = 189/305 (61.97%), Query Frame = 3
Query: 3024 YCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHT-----WANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDS--TGIN--LQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRL 3911
            YC + D+ T  G  W   R     I EH  FE  I+  IL SS  L FEDIY++   T+K  L   + +FTY+F +EM+LK ++ GF+ YFT+ W  LDF IV IS++SL+   LG+  +++A +SLRT+RALRPLRA+SR++GM++VVNAL+ AIPSI NVLLVC++FWLIFSI GV  F GK++ CL+    +RL  ++V N S C+  N T     W N  +NFDN   G+LAL Q+ATF+GWM+IM  A+DS  T +N  + P        Y  F++     S    +L+       FN L
Sbjct: 1175 YCRL-DVGTDRGRSWWNLRRACYRIVEHNWFESVIVFMILLSSGALAFEDIYIEQRKTIKTVLEYADKVFTYVFILEMLLKWVAYGFQKYFTNAWCWLDFLIVDISIVSLMATALGY-DQLSAIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFSGKYYYCLNKTDGQRLPISIVDNYSMCIALNDTTNETLWKNVKVNFDNVGIGYLALLQVATFKGWMDIMYAAVDSRDTRVNVLVVPHYSTAALIYEMFILACFFHSSLKAHLYRPFSSSTFNSL 1477          

HSP 4 Score: 202.986 bits (515), Expect = 1.968e-52
Identity = 96/223 (43.05%), Postives = 149/223 (66.82%), Query Frame = 3
Query: 1809 CSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEY-FNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQI--FGDN--IPRWNFDDFWHSMILVFRIICGEWIEPSFDCIR-ANSPLCLLIFI 2459
            CS W+  +  L + V DPF DL I+ CI +NT+ MA EHYP    +D+ L   N++FT I+  E  LKI A    Y F  GWNIFD ++V  S+++LG+  VD LS+ R+FRL RVFKLA+SW T+ +L+ II +++  +GNL++++ +++++FAV+G Q +   Y   +    +N  +PRW+  DF+HS ++VFR++CGEWIE  +DC+  A   +CL++F+
Sbjct:  735 CSLWMKVKEILKMIVMDPFVDLSITICIILNTLFMALEHYPMTPEFDNALFVGNLVFTGIFTAEMVLKIAAQDPYYYFQQGWNIFDSIIVSLSLMELGLSSVDGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKMYKECVCKISENCTLPRWHMHDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMCLIVFM 957          

HSP 5 Score: 67.0106 bits (162), Expect = 5.002e-11
Identity = 42/171 (24.56%), Postives = 86/171 (50.29%), Query Frame = 3
Query: 1818 WVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASE--HYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIID-----LGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYH 2306
            W   +   Y  V   +F+  I F I +++  +A E  +    KT   +L+Y++ +FT ++I+E  LK +A   ++YF   W   DF++V  SI+      LG +++ A+   R  R  R  +    ++ MR+++  +   I  + N+ ++ L+   +F+++G   +   Y+
Sbjct: 1188 WWNLRRACYRIVEHNWFESVIVFMILLSSGALAFEDIYIEQRKTIKTVLEYADKVFTYVFILEMLLKWVAYGFQKYFTNAWCWLDFLIVDISIVSLMATALGYDQLSAIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFSGKYY 1358          

HSP 6 Score: 63.929 bits (154), Expect = 3.966e-10
Identity = 61/269 (22.68%), Postives = 121/269 (44.98%), Query Frame = 3
Query: 3219 INYIFTYLFCIEMILKIISLGFKVYFTSF----WTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKF-FKCL---------------------------DSNTRERLA-------------ATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVI 3890
            + Y FT ++  E ++KI++ GF ++  +F    W  LDF ++ ++ ++          ++    +LRT R LR L+ IS   G+K +V ALI A+  + +V+++ +    +F++ G+Q F G    KC+                           + + + +L              A   P K  C++          +FD  +  FL+L+++ T + W  + Q  + + G   +P        Y +F++ I +GSF+++NL + V+
Sbjct:  159 VEYTFTGIYTFESMVKILARGFCLHPFTFLRDPWNWLDFCVIVMAYVTEF-------IDLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQAVKQLSDVMILTVFCLSVFALIGLQLFMGNLRHKCILWPIANQTNVTEFNETAEPFNWENYVNNEDNQYKLEGSKDALLCGNGSDAGSCPEKFVCVKGGRNPNYGYTSFDTFSWAFLSLFRLMTQDYWENLYQLTLRAAG---KP--------YIFFMVVIFLGSFYLINLILAVV 409          

HSP 7 Score: 57.7658 bits (138), Expect = 2.875e-8
Identity = 47/202 (23.27%), Postives = 98/202 (48.51%), Query Frame = 3
Query:  486 CAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYP----------ISEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAF 1061
            C+ W  ++++  +I  +   D  I + I++N +F+AL + YP          +   VF  I+T EMV+++ ++    + Y Y +  +N+ D +I+ LS + + +    G     +S LR+ R+LR  K     P L  +   +  S+  L  + ++    +  FA+  +Q++ G +  +CV  +     +   H ++F ++F
Sbjct:  735 CSLWMKVKEILKMIVMDPFVDLSITICIILNTLFMALEH-YPMTPEFDNALFVGNLVFTGIFTAEMVLKIAAQ----DPYYYFQQGWNIFDSIIVSLSLMELGLSSVDG-----LSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLF-GKMYKECVCKISENCTLPRWHMHDFFHSF 925          

HSP 8 Score: 55.8398 bits (133), Expect = 1.233e-7
Identity = 49/177 (27.68%), Postives = 85/177 (48.02%), Query Frame = 3
Query: 3054 CGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFK 3584
            C S W   +    +I      + +I +CI+ +++ +  E  +    P    AL V N +FT +F  EM+LKI +     YF   W I D  IVS+SL+ L        + +     LR+ R LR  +    W  + +++  +  ++ ++ N+ LV  +   IF++ G+Q F GK +K
Sbjct:  734 CCSLWMKVKEILKMIVMDPFVDLSITICIILNTLFMALE--HYPMTPEFDNALFVGNLVFTGIFTAEMVLKIAAQDPYYYFQQGWNIFDSIIVSLSLMELGL------SSVDGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLF-GKMYK 901          

HSP 9 Score: 52.373 bits (124), Expect = 1.257e-6
Identity = 44/149 (29.53%), Postives = 71/149 (47.65%), Query Frame = 3
Query: 1863 FFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSK-----EYFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLY---MFAVIGKQ 2285
             F +FI F I  N + M     P   TW   ++Y+   FT IY  E  +KI+A         +    WN  DF V++ + +    E +D L    A R FRV +  ++   +  L TI+ + I  +  LS +++L ++   +FA+IG Q
Sbjct:  131 LFSIFIMFTILTNCVFMTMSEPP---TWTKNVEYT---FTGIYTFESMVKILARGFCLHPFTFLRDPWNWLDFCVIVMAYV---TEFID-LGNVSALRTFRVLRALKTISVIPGLKTIVGALIQAVKQLSDVMILTVFCLSVFALIGLQ 269          

HSP 10 Score: 50.8322 bits (120), Expect = 3.659e-6
Identity = 27/70 (38.57%), Postives = 41/70 (58.57%), Query Frame = 3
Query: 4059 VAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGL-RWHYFRYMWN 4265
            + M    +L I I I LN + M +EHY  T  F N L + N++F+ IFT E ++KI+    ++YF+  WN
Sbjct:  748 IVMDPFVDLSITICIILNTLFMALEHYPMTPEFDNALFVGNLVFTGIFTAEMVLKIAAQDPYYYFQQGWN 817          
BLAST of Sodium channel protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002291.1 (pep scaffold:Pmarinus_7.0:GL476946:177790:226078:1 gene:ENSPMAG00000002078.1 transcript:ENSPMAT00000002291.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 276.559 bits (706), Expect = 3.963e-75
Identity = 148/310 (47.74%), Postives = 219/310 (70.65%), Query Frame = 1
Query: 4408 ASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFI-QPPYC--NNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWK 5328
            ++ + PTL RVVR+FR+GR+LRLI+ A+GIR LLFAL++SLPALFNIG LL +++FI+S+ GMS FG LK T G+D++ NFETF  S+L LF++TT+ GW+ +L    + + P C     HV  + V      G+CG    G  +  T+I I +LI++NMYIA+ILENFN A A+    ++EDDFEMFY +W ++DP+A+Q+I +  L +F+  LDEPL +PKPN +A+   DLPIVEGD++HCL++L AL K V+G  E  E  R+   QME ++    P +V+   +TTT++R+++++AA  +Q+A++
Sbjct: 1358 SNIVEPTLFRVVRLFRVGRILRLIRGAQGIRTLLFALLMSLPALFNIGLLLFVVMFIFSVFGMSNFGYLKHTAGIDEIFNFETFGGSMLCLFQITTSAGWDGLLAPTLLSKEPDCEPEAVHVGTNVV------GNCGNKAIGCAFFVTYIIISFLIVVNMYIAVILENFNVATAESSEPLSEDDFEMFYDIWGKFDPNATQFISFTELPNFIDSLDEPLRVPKPNQLAVAVMDLPIVEGDRIHCLEVLFALTKRVLGQGEGLEGLRE---QMEERFIAANPEQVNLEPVTTTLQRQQQEMAALKIQKAYR 1658          

HSP 2 Score: 276.174 bits (705), Expect = 4.461e-75
Identity = 157/389 (40.36%), Postives = 235/389 (60.41%), Query Frame = 3
Query:  345 GEFPEELLGKPLNEIDQNLKDK-SFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPISEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQ--NNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYY-------NWTHNPNNWIRNGINY-------------------------LTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
            GE P++++ +PL ++D   ++K +F+V+N   K K I+R++A K+  L   ++ IR++++ I T+ +F   IM TIL NCVF+A+N +  + EYVF AIY  E ++++ +RG    ++TYLRDP+N +D+ ++        V  C+       N+S+LR  RV+RALKTI+++PGLKTI  ALI+S+K L +V IL+LFC+S FAL ALQ+++G L+NKCV+     N    N S    +  +Y       N T   N  ++ G ++                         L C N S    C    P+       G NPN+GYTN+DNFGWA LS+F+L+T DYWEN Y L +RASG   ++F+++V+F GSFYLINL+LAVV+ SY
Sbjct:   67 GEVPQKMISEPLEDLDPYYRNKMTFLVLN---KGKTIFRFNACKALCLFTVFNPIRRISIKILTHTLFTILIMATILTNCVFMAINTELKVVEYVFTAIYMFEALVKILARGFFFGAFTYLRDPWNWLDLAVL--------VIACFTSIPGFANLSALRMFRVMRALKTISVVPGLKTIVRALIQSVKKLSDVTILTLFCLSIFALIALQLFKGNLKNKCVRWPIPGNSNFINISQYLEDKEFYRKRKRSCNVTWLGNRTLQTGFSFPCVSARLSPSYFISTDNYYFHKNVPLLCSNSSENNTC----PDGFICFKAGKNPNYGYTNYDNFGWAFLSLFRLMTQDYWENLYQLTLRASGKVYMIFFVMVIFLGSFYLINLILAVVAKSY 440          

HSP 3 Score: 262.307 bits (669), Expect = 8.712e-71
Identity = 142/272 (52.21%), Postives = 191/272 (70.22%), Query Frame = 3
Query: 3459 KIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHT--WANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINL-QPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            ++VVNAL+ AIPSI NVLLVC++FWLIFSI GV FFKGKF KC++S     +  +++PN++ CL Q+ +  W N  +NFDN  +G+LAL Q++TF+GWM+IM  A+DS   N  QP+ E  + YY +FVIFI+ G+FFILNLFIGVIIDNFN+ K K+ G   D+FLT  QR Y+N MKKL ++KPRK V RP    QG  YD+     FE+ I++LI LNM+ MMIE   Q+ A    L++ NI+F  IFT E ++K+  LR ++F + WN
Sbjct: 1066 QVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNFFKGKFSKCVNSTDDSTMNESIIPNQNACLEQSPSLRWKNLPVNFDNVASGYLALLQVSTFKGWMDIMYAAVDSRQNNTEQPRFEESLGYYLFFVIFIIFGAFFILNLFIGVIIDNFNQQKKKFGGE--DIFLTEEQRKYHNAMKKLGSKKPRKPVPRPNNKYQGMAYDLVHWQAFEIGIMVLICLNMLTMMIEADEQSEAMKTALNITNIVFIGIFTTECVLKMFALRQYFFTFPWN 1335          

HSP 4 Score: 91.6633 bits (226), Expect = 1.462e-18
Identity = 61/195 (31.28%), Postives = 101/195 (51.79%), Query Frame = 3
Query: 1827 FQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEVDALS------IFRAFRLFRV---FKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRI 2384
            +Q   Y  V    F++ I   I +N + M  E     +     L  +NI+F  I+  EC LK+ AL + +F   WN+FDF VV  S+ DL + +   LS      +FR  RLFRV    +L +  Q +R LL  +  ++  + N+ +++ +V+++F+V G  ++    HT    D I  +NF+ F  SM+ +F+I
Sbjct: 1260 YQGMAYDLVHWQAFEIGIMVLICLNMLTMMIEADEQSEAMKTALNITNIVFIGIFTTECVLKMFALRQYFFTFPWNVFDFAVVTLSVFDLAMADNSWLSNIVEPTLFRVVRLFRVGRILRLIRGAQGIRTLLFALLMSLPALFNIGLLLFVVMFIFSVFGMSNFGYLKHTAGI-DEI--FNFETFGGSMLCLFQI 1451          

HSP 5 Score: 77.7962 bits (190), Expect = 2.331e-14
Identity = 76/281 (27.05%), Postives = 133/281 (47.33%), Query Frame = 3
Query: 3108 RAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGT---EMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNI-NFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKK-----------ENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFN 3905
            +AFE  I+V I  + + +  E    + +  +K AL + N +F  +F  E +LK+ +L  + +FT  W + DF +V++S+  L      + +   E T FR +R  R  R LR I   QG++ ++ AL+ ++P++FN+ L+  V   IFS+ G+  F   + K                         HT     I NF+      L L+QI T  GW  ++   + S   + +P+             N+    A+FV +I++    ++N++I VI++NFN
Sbjct: 1271 QAFEIGIMVLICLNMLTMMIEAD--EQSEAMKTALNITNIVFIGIFTTECVLKMFALR-QYFFTFPWNVFDFAVVTLSVFDLAMADNSWLSNIVEPTLFRVVRLFRVGRILRLIRGAQGIRTLLFALLMSLPALFNIGLLLFVVMFIFSVFGMSNF--GYLK-------------------------HTAGIDEIFNFETFGGSMLCLFQITTSAGWDGLLAPTLLSKEPDCEPEAVHVGTNVVGNCGNKAIGCAFFVTYIIISFLIVVNMYIAVILENFN 1521          

HSP 6 Score: 52.373 bits (124), Expect = 1.221e-6
Identity = 38/115 (33.04%), Postives = 58/115 (50.43%), Query Frame = 3
Query: 3381 EMTAFRSLRTMRALRPLRAISRWQGMK---------IVVNALIY-AIPSIFNVLLVCIVF-------WLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLR--QNHTW 3668
            ++TA +SLRT+RALRPLRA+SR++GM+         I++ +L Y A+P +    L+   F         +F + GV  F   +   LDS     L   + P  +   R  Q+H W
Sbjct:  643 QLTAIKSLRTLRALRPLRALSRFEGMRGDSLSFKLVIILFSLFYVALPRVTKSSLLAFEFEPIVYTPLFVFELLGVYAFCSAY--TLDSYAAALLPFVLQPQMTGATRDKQHHRW 755          

HSP 7 Score: 51.9878 bits (123), Expect = 1.828e-6
Identity = 45/170 (26.47%), Postives = 85/170 (50.00%), Query Frame = 3
Query: 3066 WHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKV-YFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKG 3572
            ++  R  S+ I  H  F   I+  IL + + +            +   L+V+ Y+FT ++  E ++KI++ GF    FT      ++  +++ +++    I GF   ++A R  R MRAL+    IS   G+K +V ALI ++  + +V ++ +    IF++  +Q FKG
Sbjct:  115 FNPIRRISIKILTHTLFTILIMATILTNCVFM-----------AINTELKVVEYVFTAIYMFEALVKILARGFFFGAFTYLRDPWNWLDLAVLVIACFTSIPGFAN-LSALRMFRVMRALK---TISVVPGLKTIVRALIQSVKKLSDVTILTLFCLSIFALIALQLFKG 269          
BLAST of Sodium channel protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000617.1 (pep scaffold:Pmarinus_7.0:GL477322:572:57208:-1 gene:ENSPMAG00000000554.1 transcript:ENSPMAT00000000617.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 262.692 bits (670), Expect = 1.535e-73
Identity = 152/364 (41.76%), Postives = 231/364 (63.46%), Query Frame = 3
Query:  345 GEFPEELLGKPLNEID---QNLKDKSFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTN-QIFDYFIMLTILVNCVFLALNN--DYPI----SEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
            G+ P+EL+ +PL ++D   +N     F+V+N +   K IYR++AT S  L +P++ +R++A+ I  +   F   I+ TIL NCVF+A++   + P+    S Y    IY +E+VI++ +RG  +  +T+LRDP+N +D+L++I + +       Y      +SSL+T RVLR LKTI++ PGLKTI  ALI+S+K LF+VIIL++FC+S FAL   Q++ G L+NKCV    W N       N   +     +  + NN+ ++    + CGN S AG C +     +CL  IG NPNFG+TN+D+FGWA LS+F+L+T D WE  Y   +R+SG   ++F+++V+F GSFYLINL+LAVV+ SY
Sbjct:   68 GDVPKELISEPLEDLDPFYRNQMTSPFLVMNRK---KRIYRFNATNSLYLFSPFNPVRRIAIKILIHIYPFTMVIVGTILTNCVFMAMDKKLNMPLWNKNSRYTMNTIYMMEVVIKVLARGFFMGQFTFLRDPWNWLDLLVVIFTIV------TYVNPKQKMSSLKTFRVLRVLKTISVFPGLKTIVKALIQSVKKLFDVIILTIFCLSIFALIGQQLFMGNLKNKCVL---WPN------GNRTWDNETLAYLKDTNNYYKSDNQPILCGNSSGAGECPE---GYLCL-KIGENPNFGFTNYDHFGWAFLSLFRLMTQDSWEYLYQQTLRSSGKVYMIFFVMVIFLGSFYLINLILAVVAKSY 409          

HSP 2 Score: 85.1149 bits (209), Expect = 9.162e-17
Identity = 41/113 (36.28%), Postives = 65/113 (57.52%), Query Frame = 3
Query: 1809 CSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSK-EYFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRL 2144
            C  W+  +    +  +DPF DL I+ CI +NT+ M+ EH    + +  +L+  N+ FT  +  E  LKI+A+    YF   WN FD VVV  S++++ + + D LS+ R+FRL
Sbjct:  710 CPVWIRIKRLAKLVASDPFMDLAITLCIVLNTVFMSLEHDSMSEDFKKVLRNGNVFFTGTFTAEMVLKIIAMDPYYYFQEKWNQFDSVVVTVSLVEMWLPDFDNLSVLRSFRL 822          

HSP 3 Score: 70.4774 bits (171), Expect = 2.830e-12
Identity = 65/256 (25.39%), Postives = 116/256 (45.31%), Query Frame = 3
Query: 3225 YIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFF-KCL---------DSNTRERL--------------------AATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNF 3902
            Y    ++ +E+++K+++ GF   F   +T L      + LL +I  I+ +        SL+T R LR L+ IS + G+K +V ALI ++  +F+V+++ I    IF++ G Q F G    KC+         D+ T   L                     A   P    CL+          N+D+    FL+L+++ T + W  + Q  + S+G            Y  +FV+ I +GSF+++NL + V+  ++
Sbjct:  167 YTMNTIYMMEVVIKVLARGF---FMGQFTFLRDPWNWLDLLVVIFTIVTYVNPKQKMSSLKTFRVLRVLKTISVFPGLKTIVKALIQSVKKLFDVIILTIFCLSIFALIGQQLFMGNLKNKCVLWPNGNRTWDNETLAYLKDTNNYYKSDNQPILCGNSSGAGECPEGYLCLKIGENPNFGFTNYDHFGWAFLSLFRLMTQDSWEYLYQQTLRSSG----------KVYMIFFVMVIFLGSFYLINLILAVVAKSY 409          
BLAST of Sodium channel protein vs. Ensembl Yeast
Match: CCH1 (Voltage-gated high-affinity calcium channel; involved in calcium influx in response to some environmental stresses as well as exposure to mating pheromones; interacts and partially co-localizes with Mid1p; however, evidence suggests CCH1 is not required for Mid1p function [Source:SGD;Acc:S000003449])

HSP 1 Score: 78.1814 bits (191), Expect = 1.138e-14
Identity = 65/299 (21.74%), Postives = 134/299 (44.82%), Query Frame = 3
Query: 3396 RSLRTMRALRPLRAISRWQGMKIVVNALIY-AIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNK--SECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPK-ALVQGFFYDVAMSNR---FELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFST-IFTLEAIVKISGLRWH-YFRYMWN 4265
            R  + + ALR LR ++     +   N +++  +  IF   L+ +     F++ G+  FKG+   C D +           N      +     +    ++ D+  + F +LYQI + EGW++++++ ++S+GI              + V+F  +   FILNLF+  I++N  R            + T  ++ +  + K LS  KP+      + + V+ FFY +A+  +   +   + ++++L++++++   Y            +  MFST +F ++  + + G     YFR  WN
Sbjct: 1305 RIFKGLTALRALRCLTISNTARQTFNLVMFDGLNKIFEAGLISLSLLFPFTVWGLSIFKGRLGTCNDGSLGRADCYNEYSNSVFQWDIMSPRVYQQPYLHLDSFASAFSSLYQIISLEGWVDLLENMMNSSGIGTPATVMGSAGNALFLVLFNFLSMVFILNLFVSFIVNNQARTTGS-------AYFTIEEKAWLESQKLLSQAKPKAIPNLIELSRVRQFFYQLAVEKKNFYYASFLQVVLYLHIIMLLSRSYNPGNLIG--YQGVYFMFSTSVFLIQEALHMCGEGPRLYFRQKWN 1594          

HSP 2 Score: 65.855 bits (159), Expect = 6.297e-11
Identity = 52/216 (24.07%), Postives = 92/216 (42.59%), Query Frame = 3
Query: 3387 TAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFK-----------------------CLDSNTRERL-------------AATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYE 3926
            T  R  + +  LR LR ++   GM  ++  L Y IP + NV  + + FW+ F I GVQ F+G F +                        LD  T+ +                 + P  S+C+   + + N  I+FDN  N    ++ I +   + ++M   +DS          ++MA   +F++ I V + ++LNL I V++ +F     +Y+
Sbjct:  520 TGIRIFKPLAILRILRLVNVDTGMPSILRGLKYGIPQLVNVSSMLVYFWIFFGILGVQIFQGSFRRQCVWFNPEDPTDTYQYDMQFCGGYLDPVTKRKQNYIYEDGSEGSVSKGFLCPQYSKCVSNANPY-NGRISFDNIVNSMELVFVIMSANTFTDLMYYTMDS----------DEMAACLFFIVCIFVLTIWLLNLLIAVLVSSFEIANEEYK 724          

HSP 3 Score: 59.6918 bits (143), Expect = 5.266e-9
Identity = 46/199 (23.12%), Postives = 94/199 (47.24%), Query Frame = 1
Query: 4468 LRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQPPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAH--AQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLG 5058
            L +I     + +LL   + SLP + ++     ++  +Y+I    +FG  +      D +NF T  +S+++LFR +   GWN I+  + +  PYC++     +  Y      DCG+  +  L + ++  I   I +NM++++I+ NF+  +       GI   + + +   W ++D   +  ++ + L   +   D PL 
Sbjct: 1634 LFIIPQNDTLTELLETAMASLPPILSLTYTWGVLFLVYAIALNQIFGLTRLGSNTTDNINFRTVIKSMIVLFRCSFGEGWNYIMADLTVSEPYCSSDD---NSTYT-----DCGSETYAYLLLMSWNIISMYIFVNMFVSLIIGNFSYVYRSGGSRSGINRSEIKKYIEAWSKFDTDGTGELELSYLPRIMHSFDGPLS 1824          

HSP 4 Score: 57.3806 bits (137), Expect = 2.517e-8
Identity = 65/276 (23.55%), Postives = 119/276 (43.12%), Query Frame = 3
Query:  624 VFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSL-RTLRVLRALKTITIL-PGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAG--NCSKTNPNS-----ICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASG----------SWNILFYIIVVFFGSFYLINLMLAVV 1394
             F+  +++E +++  + G I +   YLR+P+N +D  ++I  +I +I    Y +NN N+S + + L  LRAL+ +TI     +T    +   L  +FE  ++SL  +  F ++ L I++G L                                             TC ND S G  +C     NS     I  P +   P   Y + D+F  A  S++Q+I+L+ W +    ++ +SG          + N LF ++  F    +++NL ++ +
Sbjct: 1248 AFIGAFSIEFIVKTVADGFIYSPNAYLRNPWNFIDFCVLISMWINLI---AYLKNNGNLSRIFKGLTALRALRCLTISNTARQTFNLVMFDGLNKIFEAGLISLSLLFPFTVWGLSIFKGRLG--------------------------------------------TC-NDGSLGRADCYNEYSNSVFQWDIMSPRVYQQP---YLHLDSFASAFSSLYQIISLEGWVDLLENMMNSSGIGTPATVMGSAGNALFLVLFNFLSMVFILNLFVSFI 1472          

HSP 5 Score: 55.0694 bits (131), Expect = 1.365e-7
Identity = 46/203 (22.66%), Postives = 92/203 (45.32%), Query Frame = 3
Query:  807 LRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKT---NPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
             + L +LR L+ + +  G+ +I   L   +  L  V  + ++   FF +  +QI+QG+ R +CV         +  +  +F   +    T    N+I           D S G+ SK       S C+ +   NP  G  +FDN   ++  +F +++ + + +     + +      LF+I+ +F  + +L+NL++AV+  S+
Sbjct:  525 FKPLAILRILRLVNVDTGMPSILRGLKYGIPQLVNVSSMLVYFWIFFGILGVQIFQGSFRRQCVWFNPEDPTDTYQYDMQFCGGYLDPVTKRKQNYIY---------EDGSEGSVSKGFLCPQYSKCVSN--ANPYNGRISFDNIVNSMELVFVIMSANTFTDLMYYTMDSDEMAACLFFIVCIFVLTIWLLNLLIAVLVSSF 716          
BLAST of Sodium channel protein vs. Ensembl Nematostella
Match: EDO35661 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKR1])

HSP 1 Score: 427.172 bits (1097), Expect = 1.049e-123
Identity = 220/427 (51.52%), Postives = 303/427 (70.96%), Query Frame = 3
Query: 2991 PFQEKKPFHCCYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAF-RSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEG-NYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            P +   P   C C +  +++   + W   R +   + EH+ FEG IL  I ASSI L FED+YLD+ PTLKQ L+++N +F  +F +EM+LK I LGFK YFT+ W ILDF IV +S++  +  I  FG +  AF RSLRT+RA RPLRAISR++GMK+V+ +L++AIP I NVLLVC++FWLIFSI GVQ F GKF KC+D    E+  A+VVPNK+ CL   + W NSNINFD    GFLAL Q+ATFEGWMEIM+DA+D+T I+ QP +EN ++ Y +FV+FI++G+FF LNLFIGVIIDNFN+LK + E    +DVFLT++QRN+ N +K  + +KP+K +RRP+   QG  YD+  S +FE+ I++ I +NMVVMM++HY   A ++    ++N++F+++F LEAI++I  LR  YF   WN
Sbjct:  788 PVEPCFPTSWCVCRLACMDSGFCAVWKVMRYKVRRLVEHKVFEGIILFLIAASSISLAFEDVYLDSKPTLKQVLQILNILFAVIFTVEMLLKWIGLGFKTYFTNPWNILDFVIVIVSIMVSLATI--FGNDQIAFIRSLRTLRAFRPLRAISRFEGMKVVITSLLHAIPGIGNVLLVCLMFWLIFSIMGVQIFGGKFGKCVDEGG-EKCPASVVPNKTVCLSNGYRWENSNINFDTVDQGFLALLQVATFEGWMEIMEDAVDATKIDEQPIEENNVSAYLFFVVFIILGTFFTLNLFIGVIIDNFNQLKQQMEAVGSMDVFLTSTQRNWMNALKSAATKKPKKRIRRPQNKFQGELYDMVQSRKFEVFIMLFITINMVVMMVQHYDHLAVWSK--QILNLIFTSVFILEAILRIIALRKGYFLNPWN 1209          

HSP 2 Score: 278.87 bits (712), Expect = 1.035e-75
Identity = 162/312 (51.92%), Postives = 227/312 (72.76%), Query Frame = 1
Query: 4396 ETLKASF-ITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQPPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIE--DSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRA 5322
            E L+ S  I P+LLRVVR+FR+GR+LR  + A+GIR+LLF+LVIS PALFNIGALL LI+FIY+I+GMS+FG++KKT  L+D+VNFETF  S +LLFRL T+ GWNDIL+ + I  P C       D  Y+ + +G+CG  +   +Y+ +F+ I +LI+INMYIA+ILEN+NQ   QE++GIT +D E+FY +WE +DP+A+QYI YA+LSDFV +++  L IPKPN  A    ++P+V+GDK+HCLD+L ALVK ++   E  DSE F+ + ++ME +++  FP+R       TTM+ K+   AAK + RA
Sbjct: 1226 ENLQTSLVINPSLLRVVRVFRVGRLLRFFEAARGIRRLLFSLVISTPALFNIGALLFLIIFIYAIIGMSIFGHVKKTEALNDVVNFETFGSSFVLLFRLMTSAGWNDILDPLMISEPDC-------DPNYRGLPSGNCGNKYMAPIYLGSFVVIIFLILINMYIAVILENYNQVMEQEKIGITNEDIELFYQMWELFDPNATQYIPYADLSDFVHQMEGNLRIPKPNKAACALLNIPLVKGDKIHCLDLLQALVKRIVSGFEDVDSEGFKIVMQRMEERFQAAFPSRTGHKSTITTMEIKRHQEAAKVIVRA 1530          

HSP 3 Score: 257.684 bits (657), Expect = 3.319e-69
Identity = 143/339 (42.18%), Postives = 210/339 (61.95%), Query Frame = 3
Query:  408 KSFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQI------FDYFIMLTILVNCVFLALNNDYPISEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
            +SF+VI  +F    +YR++ +KS  L  P + IR+ +L + TNQ          F++LTILVNCVFLA+ N     EYVF AIYT+EM  ++ ++G  ++ Y YLRD +N +D +++IL  + I        +  N+S + T RV RAL+TI+ + GLK + + L+ S+KML++V++L+LF +  FAL  +Q++ G LRNKC   V            E ++  Y  +  N + W       + CGN + +  C     N  CLPH G NPNFGYT+FD+FGWALL+ FQLITLD+WEN YN VI   G W ++++ +V+FFG F+L+NL+LAVV+ SY
Sbjct:    1 QSFLVIAGKFGKTQVYRFNRSKSLYLFGPENPIRQFSLKLITNQYPLQLHNRHMFVLLTILVNCVFLAMTNPPEQPEYVFAAIYTIEMFCKIIAKGFALHRYAYLRDKWNWLDFIVVILGNVTI------SPDVANLSGIPTFRVFRALRTISAVKGLKAMVNTLLVSMKMLWDVMVLTLFFICIFALIGMQLFIGELRNKCALPVP-----------ENLSVPYRTYASNSSIWYLEDNEPILCGNTTGSRTCPT---NYTCLPHAGGNPNFGYTSFDHFGWALLTGFQLITLDFWENVYNNVIYTMGPWYVVYFAVVIFFGPFFLVNLVLAVVAASY 319          

HSP 4 Score: 189.504 bits (480), Expect = 3.682e-48
Identity = 92/213 (43.19%), Postives = 136/213 (63.85%), Query Frame = 3
Query: 1848 FVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIIDLGVEEV------DALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIRANSPLCLLIFIPT 2465
            F      ++FI  CI +NT++M+ EH   E     ++  SN +FT I+++E  LK++AL    Y  V WNIFD +VVI SI+D  V +         +S+ R FRL RV KLA+SW TM  LL  I  ++  +GNL++I+ +++Y+FAV+G Q   N+Y    FG +IPRWNF DF HS +++FR++CGEWIEP +DC+ A  P+ +L+F+P 
Sbjct:  499 FTNGKVMEIFIIVCILLNTLVMSIEHPRLEDPLLTVVNISNEVFTFIFLLEMILKLIALGFLGYIRVAWNIFDGIVVIISIVDFIVNKFVPDAGGTGISVLRTFRLLRVLKLAKSWSTMNSLLATIGKSLGALGNLTVILAIIVYIFAVMGMQLLGNSYTPDKFGGSIPRWNFKDFPHSFMMIFRVLCGEWIEPLWDCMLATGPVAMLLFVPA 711          

HSP 5 Score: 84.3445 bits (207), Expect = 4.147e-16
Identity = 68/217 (31.34%), Postives = 113/217 (52.07%), Query Frame = 3
Query: 1827 FQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRA-----------FRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIRANSPLC 2444
            FQ  LY  V    F++FI   I IN ++M  +HY     W    +  N+IFT ++I+E  L+I+AL K YF   WN+FDFV+VI+SII + VE +    +               RL R F+ A+  +  RLL +++ ST   + N+  ++ L+++++A+IG   + +   T+   D +   NF+ F  S +L+FR++         D +  + P C
Sbjct: 1136 FQGELYDMVQSRKFEVFIMLFITINMVVMMVQHYDHLAVWSK--QILNLIFTSVFILEAILRIIALRKGYFLNPWNVFDFVIVISSIIGIIVENLQTSLVINPSLLRVVRVFRVGRLLRFFEAARGIR--RLLFSLVIST-PALFNIGALLFLIIFIYAIIGMSIFGHVKKTEALNDVV---NFETFGSSFVLLFRLMTSAGWNDILDPLMISEPDC 1344          

HSP 6 Score: 79.337 bits (194), Expect = 1.481e-14
Identity = 50/183 (27.32%), Postives = 93/183 (50.82%), Query Frame = 3
Query: 1779 CQCCIKQNVLCSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASE--HYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIID-----LGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTY 2303
            C+     +  C+ W   + ++   V    F+  I F I  ++I +A E  +  S+ T   +L+  NI+F VI+ +E  LK + L  K YF   WNI DFV+VI SI+       G +++  +   R  R FR  +    ++ M++++T +   I  +GN+ ++ L+   +F+++G Q +   +
Sbjct:  800 CRLACMDSGFCAVWKVMRYKVRRLVEHKVFEGIILFLIAASSISLAFEDVYLDSKPTLKQVLQILNILFAVIFTVEMLLKWIGLGFKTYFTNPWNILDFVIVIVSIMVSLATIFGNDQIAFIRSLRTLRAFRPLRAISRFEGMKVVITSLLHAIPGIGNVLLVCLMFWLIFSIMGVQIFGGKF 982          

HSP 7 Score: 65.4698 bits (158), Expect = 2.363e-10
Identity = 68/261 (26.05%), Postives = 122/261 (46.74%), Query Frame = 3
Query: 3090 LLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILN 3872
            L  T  +  E  I+VCIL +++ +  E   L++   L   + + N +FT++F +EMILK+I+LGF  Y    W I D  +V IS++  I +        T    LRT R LR L+    W  M  ++  +  ++ ++ N+ ++  +   IF++ G+Q          +S T ++   ++             W     NF +  + F+ ++++   E W+E + D + +TG          +A   +   FIL G+F ILN
Sbjct:  497 LKFTNGKVMEIFIIVCILLNTLVMSIEHPRLED--PLLTVVNISNEVFTFIFLLEMILKLIALGFLGYIRVAWNIFDGIVVIISIVDFIVNKFVPDAGGTGISVLRTFRLLRVLKLAKSWSTMNSLLATIGKSLGALGNLTVILAIIVYIFAVMGMQLLG-------NSYTPDKFGGSI-----------PRW-----NFKDFPHSFMMIFRVLCGE-WIEPLWDCMLATG---------PVAMLLFVPAFIL-GNFIILN 721          

HSP 8 Score: 63.5438 bits (153), Expect = 9.494e-10
Identity = 62/261 (23.75%), Postives = 110/261 (42.15%), Query Frame = 3
Query: 3225 YIFTYLFCIEMILKIISLGFKV----YFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKF---------------FKCLDSNTR-------------ERLAATVVPNKSECLRQNHTWANSNI---NFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNF 3902
            Y+F  ++ IEM  KII+ GF +    Y    W  LDF +V +  ++          ++     + T R  R LR IS  +G+K +VN L+ ++  +++V+++ + F  IF++ G+Q F G+                ++   SN+                  +   P    CL   H   N N    +FD+     L  +Q+ T + W  +  + I + G            Y  YF + I  G FF++NL + V+  ++
Sbjct:   78 YVFAAIYTIEMFCKIIAKGFALHRYAYLRDKWNWLDFIVVILGNVT-------ISPDVANLSGIPTFRVFRALRTISAVKGLKAMVNTLLVSMKMLWDVMVLTLFFICIFALIGMQLFIGELRNKCALPVPENLSVPYRTYASNSSIWYLEDNEPILCGNTTGSRTCPTNYTCL--PHAGGNPNFGYTSFDHFGWALLTGFQLITLDFWENVYNNVIYTMG----------PWYVVYFAVVIFFGPFFLVNLVLAVVAASY 319          

HSP 9 Score: 62.7734 bits (151), Expect = 1.548e-9
Identity = 70/327 (21.41%), Postives = 137/327 (41.90%), Query Frame = 3
Query:  486 CAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDY-----------PISEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVN-VSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNC-SKTNPN-SICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYW----ENQYNLV------IRASGSWNILFYIIVVFFGSFYLINLMLAVV 1394
            CA W  +R     +  +++F+  I+  I  + + LA  + Y            I   +F  I+T+EM+++    G      TY  +P+N++D +I+I+S ++  +   +G + +  + SLRTLR  R L+ I+   G+K + ++L+ ++  +  V+++ L     F++  +QI+ G    KCV                                            D     C +   PN ++CL + G        NFD      L++ Q+ T + W    E+  +        I  +     LF+++ +  G+F+ +NL + V+
Sbjct:  810 CAVWKVMRYKVRRLVEHKVFEGIILFLIAASSISLAFEDVYLDSKPTLKQVLQILNILFAVIFTVEMLLKWIGLGF----KTYFTNPWNILDFVIVIVSIMVS-LATIFGNDQIAFIRSLRTLRAFRPLRAISRFEGMKVVITSLLHAIPGIGNVLLVCLMFWLIFSIMGVQIFGGKF-GKCV--------------------------------------------DEGGEKCPASVVPNKTVCLSN-GYRWENSNINFDTVDQGFLALLQVATFEGWMEIMEDAVDATKIDEQPIEENNVSAYLFFVVFIILGTFFTLNLFIGVI 1085          

HSP 10 Score: 56.225 bits (134), Expect = 1.394e-7
Identity = 36/97 (37.11%), Postives = 56/97 (57.73%), Query Frame = 1
Query: 4426 TLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNL---KKTGGLDDLVNFETFERSILLLFRLTTAGGW 4707
            T + V+R FR+ RVL+L K    +  LL  +  SL AL N+  +L +IV+I++++GM + GN     K GG     NF+ F  S +++FR+   G W
Sbjct:  594 TGISVLRTFRLLRVLKLAKSWSTMNSLLATIGKSLGALGNLTVILAIIVYIFAVMGMQLLGNSYTPDKFGGSIPRWNFKDFPHSFMMIFRV-LCGEW 689          
BLAST of Sodium channel protein vs. Ensembl Nematostella
Match: EDO46797 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP56])

HSP 1 Score: 386.341 bits (991), Expect = 2.276e-110
Identity = 240/720 (33.33%), Postives = 381/720 (52.92%), Query Frame = 3
Query:  387 IDQNLKDKSFVVINTRFKIK--YIYRYSATKSFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPISEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHDKDQ-------------MKDLKITNGMSDADSSLCKNTTS-IHENDDNFRFMDS---------EEEKEGKDCDNKAEYEDEVEIGNDTNNTDTAEMNPTIDRNCQCCIKQNVLCSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGD-NIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIRANSPLCLLIFIPT 2465
            I Q+    +F++++ RF       YR+S T S L   P   +R   +L+ T+  F+  + L ILVNC+ L LN+    +EY+F AIYTLEM+ ++ SRG + +SY YLRD +N +D L++ LSY+ +        +  ++S +RTLRVLRA +TI+ L GL+ + ++L++SLK+L +V++L LF +   AL  LQ++ G LRNKCV               E  NA   N   NP++W       L CG  S+AG C     N  C+ H+GPNP+ G+TNFD+ GW+L+  FQ++T+D+WEN Y+ V+R+ G W ++++++ +F  SFYL+NL+LAVV MSY  E      E  + +       + +   +  +      S  T     Q             M+ L   + ++++  S  + T S  H   D  + ++          EEE+E K     +   + + +G D          P + R C   ++                 F+  P FD  I+  I +NT+++   ++        +L   N IFT ++I+E  +KI A    +Y    WN+FD V++I S +   +     +SIFR  RL RV  LAQSW+TM  L+  I  ++  + N++ I+ +++Y+FAV+G + +   Y  + FG   IPRWNF DF HS ++VFRI+C EW+EP +DC+R  +   LL F+P 
Sbjct:    9 ISQHPSTATFLILSKRFNSSGYQAYRFSRTASLLCLGPVHPLRMFCILLITHPYFEIIVTLVILVNCIILGLNDPPEEAEYIFTAIYTLEMICKIISRGFVKDSYAYLRDTWNWLDSLVVFLSYLSL------APDIASLSGIRTLRVLRAFRTISALKGLRAMVNSLLRSLKLLTDVLVLFLFSLCVLALIGLQLFTGELRNKCVL--------------ETANATTIN---NPSSWYHREGEPLLCGFSSTAGRCPA---NYTCVAHVGPNPDHGFTNFDDIGWSLVMAFQILTMDFWENLYDRVLRSMGEWYMMYFVVGIFSCSFYLLNLVLAVVYMSYHHEMNLTDNEVTQSQVTHSPVTQSQVTHSPVTQSWVTHSPVTQSRVSQSRVTQSLVTQSWLMQSLVTQSPVTESRVSQSRVTQSRAHPKTDTIQVLEPLESHLYPPDEEEEETKPLTPPS--LNGIVLGEDQEKGVLCPKYPRLSRACSALVE-----------------FIQRPLFDGIIAGLILLNTVVLTMYYHGMPDDLTFVLDILNAIFTGLFILEMIVKIFAFGLVKYICNKWNLFDSVIIITSAVAYFLGTSTGVSIFRILRLLRVLYLAQSWETMAKLIRAIAHSVDPIFNITCILGVIIYVFAVVGMRVFGPHYTAEAFGSRGIPRWNFTDFTHSFMMVFRILCSEWVEPLWDCMRVTNTAALLFFLPA 683          

HSP 2 Score: 372.474 bits (955), Expect = 1.067e-105
Identity = 197/402 (49.00%), Postives = 265/402 (65.92%), Query Frame = 3
Query: 3066 WHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECL-RQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEG-NYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            W  FR R     EHR FE  IL  ++ SS  L FEDI+L   P L++AL  +N++F  +F +E ILK+I  GF  YFTS W  LD  IVS+ +             ++ FRS RT+R LRPLRAISR  GMK+V+NAL  AIP I +VL+V ++FWL+FSI+GVQ F GKF+KC+++   E+L+ +V+PNK+ CL   ++ W N+N+NFDN  NGFLAL Q+AT+EGWME+M DA+DST I+ QP  E  +  YAYFV+FI+VGSFF+LNLF+GVIIDNFN LK KYE  N + + LT SQR +   +   + RKP     RP    +G  +D+  SN+FE+ I+ +I  NM +MM++HY Q    T V+   N +   IF LEAI+KI  +R HYF+  W+
Sbjct:  779 WLKFRCRVRCFVEHRYFEWFILFTVMVSSFTLVFEDIHLHQKPDLERALNFLNFLFAAIFSLEFILKVIGFGFVSYFTSVWNCLDALIVSVCVSVACLFE---NPNLSVFRSFRTVRGLRPLRAISRLGGMKVVINALFAAIPGIGSVLVVSMLFWLMFSISGVQLFAGKFYKCVNAED-EKLSPSVIPNKTACLDHPDYRWVNANVNFDNVINGFLALLQVATYEGWMEVMADAVDSTKIDQQPSYEANLIAYAYFVVFIIVGSFFVLNLFVGVIIDNFNTLKKKYEEINSMGMLLTESQRKWVQILMAAAKRKPPSNRLRPTDCFRGKLFDLVSSNQFEVFILTVIMCNMGMMMVQHYDQ-PPLTTVIG--NYVLVGIFLLEAIIKIIAMRLHYFKKAWS 1173          

HSP 3 Score: 238.039 bits (606), Expect = 4.119e-63
Identity = 127/292 (43.49%), Postives = 197/292 (67.47%), Query Frame = 1
Query: 4405 KASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQPPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEE-FRKIKRQMELKYEEVFPNRVHTNVITTTM 5277
            +++ ++P LLRV+R+FR+ R+LR+++ AK IR+LL A++IS+PALFNIG LL L++FIY+I+GMS FGN+KK G L+DLVNFETF  SI+L+FRL T  GWNDIL+A+ +QPP+C       D  +  + NG+CG     + Y+ T+I   +LII+NMYIA++L+N N+AH  +E G+++D F+ +Y  +  +     Q++    L +F+A LD+P  I  P+   +    +P+ EGD +HC D+L  LVK ++    +S E F +I  +ME ++ + F  +V   +I +TM
Sbjct: 1194 ESAVVSPGLLRVLRVFRVARLLRVVQFAKRIRQLLVAIIISMPALFNIGTLLFLVMFIYAIIGMSSFGNIKKQGALNDLVNFETFSSSIILIFRLGTGTGWNDILDALVVQPPHC-------DPNFGGLPNGNCGFPIGAVFYLVTYIVSVFLIIVNMYIAVLLDNVNRAHENDEFGLSKDKFKSYYHTFANFS-MGKQFLPLRVLPEFLAALDKPFKIAHPSEELIRKMKIPVREGDLVHCFDLLKVLVKKILEQHGESPEVFEQITIRMEAQFRKSFTKKVSAAIIGSTM 1477          

HSP 4 Score: 98.5969 bits (244), Expect = 1.814e-20
Identity = 64/214 (29.91%), Postives = 109/214 (50.93%), Query Frame = 3
Query: 1827 FQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIID--LGVEEVDA------LSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIRANSPLC 2444
            F+ +L+  V+   F++FI   I  N  +M  +HY        I    N +   I+++E  +KI+A+   YF   W+IFDFVVV++SI+   LG+    A      L + R FR+ R+ ++ Q  + +R LL  I  ++  + N+  ++ LV++++A+IG  S+ N        D +   NF+ F  S+IL+FR+  G       D +    P C
Sbjct: 1101 FRGKLFDLVSSNQFEVFILTVIMCNMGMMMVQHYDQPPLTTVI---GNYVLVGIFLLEAIIKIIAMRLHYFKKAWSIFDFVVVVSSIVGMYLGMSTESAVVSPGLLRVLRVFRVARLLRVVQFAKRIRQLLVAIIISMPALFNIGTLLFLVMFIYAIIGMSSFGNIKKQGALNDLV---NFETFSSSIILIFRLGTGTGWNDILDALVVQPPHC 1308          

HSP 5 Score: 87.8113 bits (216), Expect = 4.166e-17
Identity = 102/428 (23.83%), Postives = 186/428 (43.46%), Query Frame = 3
Query: 3114 FEGTILVCILASSICLCFEDIYLDNNPT-LKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSN----RKPR----------KTVRRPKALVQGFFYDVAMS--------------------------NRFELVIVILIFLNMVVMMIE--HYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRW-HYFRYMWN 4265
            F+G I   IL +++ L    +Y    P  L   L ++N IFT LF +EMI+KI + G   Y  + W + D  I+  S ++      G  T ++ FR LR +R L   ++   W+ M  ++ A+ +++  IFN+  +  V   +F++ G++ F   +       T E   +  +P           W     NF + T+ F+ +++I   E W+E + D +  T            A   +F+  ++VG+F +LNLF+ +++++F + +        D+   AS++ Y N    L++    RK R          K  +R    +   F +  M+                            FE  I+  + ++   ++ E  H  Q       L+ +N +F+ IF+LE I+K+ G  +  YF  +WN
Sbjct:  482 FDGIIAGLILLNTVVL---TMYYHGMPDDLTFVLDILNAIFTGLFILEMIVKIFAFGLVKYICNKWNLFDSVIIITSAVAYFL---GTSTGVSIFRILRLLRVLYLAQS---WETMAKLIRAIAHSVDPIFNITCILGVIIYVFAVVGMRVFGPHY-------TAEAFGSRGIPR----------W-----NFTDFTHSFMMVFRILCSE-WVEPLWDCMRVT----------NTAALLFFLPALIVGNFIVLNLFVALLLNSFAKKEE-------DLHREASEQPYVNPCSCLAHLTRTRKTRMYYTQAVNNNKNTKRYIVEIDDCFPECCMNACGCTSGQQHFCWLKFRCRVRCFVEHRYFEWFILFTVMVSSFTLVFEDIHLHQKPDLERALNFLNFLFAAIFSLEFILKVIGFGFVSYFTSVWN 860          

HSP 6 Score: 75.485 bits (184), Expect = 2.071e-13
Identity = 84/349 (24.07%), Postives = 141/349 (40.40%), Query Frame = 3
Query: 3054 CGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGF----KVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFF-KCLDSNTRERLAATVVPNKSECLRQN-----------------------HTWANSN---INFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKP 4007
            C    H  R   +L+  H  FE  + + IL + I L        N+P  +       YIFT ++ +EMI KIIS GF      Y    W         +  L +    L    ++ +   +RT+R LR  R IS  +G++ +VN+L+ ++  + +VL++ +    + ++ G+Q F G+   KC+     E   AT + N S    +                        H   N +    NFD+     +  +QI T + W  +    + S G            Y  YFV+ I   SF++LNL + V+  +++     +E N  D  +T SQ  +    +      P
Sbjct:   43 CLGPVHPLRMFCILLITHPYFEIIVTLVILVNCIILGL------NDPPEEA-----EYIFTAIYTLEMICKIISRGFVKDSYAYLRDTWN-------WLDSLVVFLSYLSLAPDIASLSGIRTLRVLRAFRTISALKGLRAMVNSLLRSLKLLTDVLVLFLFSLCVLALIGLQLFTGELRNKCV----LETANATTINNPSSWYHREGEPLLCGFSSTAGRCPANYTCVAHVGPNPDHGFTNFDDIGWSLVMAFQILTMDFWENLYDRVLRSMG----------EWYMMYFVVGIFSCSFYLLNLVLAVVYMSYH-----HEMNLTDNEVTQSQVTHSPVTQSQVTHSP 354          

HSP 7 Score: 68.9366 bits (167), Expect = 2.139e-11
Identity = 45/182 (24.73%), Postives = 89/182 (48.90%), Query Frame = 3
Query: 1779 CQCCIKQNVLCSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASE--HYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQ---TMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYH 2306
            C C   Q   C  W+ F+ R+  FV   +F+ FI F + +++  +  E  H   +   +  L + N +F  I+ +E  LK++      YF   WN  D ++V   +    + E   LS+FR+FR  R  +  ++      M++++  +F+ I  +G++ ++ +L   MF++ G Q +   ++
Sbjct:  768 CGCTSGQQHFC--WLKFRCRVRCFVEHRYFEWFILFTVMVSSFTLVFEDIHLHQKPDLERALNFLNFLFAAIFSLEFILKVIGFGFVSYFTSVWNCLDALIVSVCVSVACLFENPNLSVFRSFRTVRGLRPLRAISRLGGMKVVINALFAAIPGIGSVLVVSMLFWLMFSISGVQLFAGKFY 947          
BLAST of Sodium channel protein vs. Ensembl Nematostella
Match: EDO46991 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNU9])

HSP 1 Score: 218.009 bits (554), Expect = 7.832e-57
Identity = 165/644 (25.62%), Postives = 307/644 (47.67%), Query Frame = 3
Query:  543 FDYFIMLTILVNCVFLA------------LNNDYPISEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWEN-QYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHDKDQMKDLKITNGMSDADSSLCKNTTSIHENDDNFRFMDSEEEKEGKDCDNKAEYEDEVEIGNDTNNTDTAEMNPT-IDRNCQCCIKQNVLCSKWVAFQNRLY-----IFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIIDLGVEEVD-----ALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGD-NIPRWNFDDFWHSMILVFRIICGE 2396
            FD  I++TI  NC  LA            +N +  ++E+VFL I+T+E V+++ + G +++   YLR+ +N++D +I+++    IIV K Y  ++ +V +LR  RVLR L+ ++ +P L+ + +++IK+L  LF + +L +F +  +A+  ++++ G L + C   V  +    E H                            C  +S   +CS   P  +CL      PN+G TNFDN G A L++FQ ITL+ W +  Y++      SW  L+++ ++ +GSF+++NL+L V+S  +                                               + + L+    + DA        +   + + +    + EE K  +    +   E++    N  N  D+A  +   IDR      K+ +L      F +RL         T  F+   I F +F+N++ +A EHY   +     L  +N +F  ++ +E  +K+  L    YF   +N FD +VVI+S+++LG+ E        +S+ R  RL R+FK+ + W ++  L+  + +++  +  L +++ L + +F+++G Q +   ++    GD ++PR NFD FW +++ VF+I+ GE
Sbjct:   76 FDVMILITIFANCAALAAFQPLPEQDSSLINEELEVAEFVFLGIFTMESVLKIIAYGFVMHPGAYLRNGWNILDFVIVVVGLATIIV-KLYTPDSFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKALIPLFHIALLVVFVVIIYAIIGVELFMGKLHSTCYDNVTGQPTFDEPHP---------------------------CSTESEGYSCSNAGPGQVCLKK-WEGPNYGITNFDNIGLACLTVFQCITLEGWTDVMYSINDAIGNSWPWLYFVTLIIWGSFFVLNLVLGVLSGEF------------------------------------AKEKARAQKSGEFQKLREKQLVDDAYHGYLDWISQAEDIEGDSSAGEDEEGKADRKPSFRRRKENDDISKNKENQEDSAASDQGWIDR------KKKILKR----FHHRLRRSCRKAVKTQWFYWTVIVF-VFLNSLTLALEHYNQPEFLTQFLDKANKLFLALFTLEMVVKMYCLGFHGYFASLFNRFDCLVVISSLLELGLTEAMDQRPIGISMLRCVRLLRIFKVTRYWSSLSNLVASLLNSMRSIMGLLLLLSLFMVIFSLLGMQIFGGKFN---LGDEDVPRSNFDSFWRALVTVFQILTGE 640          

HSP 2 Score: 162.925 bits (411), Expect = 4.906e-40
Identity = 122/389 (31.36%), Postives = 209/389 (53.73%), Query Frame = 3
Query: 3126 ILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXX--XXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSN--TRERLAATVV----PNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLR-WHYFRYMWN 4265
            IL+ I+ SS  L  ED  L++N    Q L   +Y FT +F IE+ +KII+ G  ++  SF          + +++  +   +    ++++  R LR +R LRPLRAI+R +G+K VV  +  A+ +I N++LV ++F  +F++ GVQ FKG FF C D+   T+       +    P  +  + ++  W     NF++     L L+ + TFEGW  I++ ++DST ++  P   N+     Y+VI+I++ +FF++N+F+G +I  F   +N+ E  + D  L  +QR        L  R  R+ +  P   +Q   + V  S  FE +I   I  N +++M+++Y +   +T VLD  NI F+++F LE I+K+   +  +YF   WN
Sbjct:  839 ILLLIIVSSCMLAAEDP-LNSNSKRNQVLNYFDYFFTAVFTIEITIKIIAYGVILHKGSFCRSAFNLLDFLVVAVSIVSIALRDSSSQISVVRILRVLRVLRPLRAINRAKGLKHVVQCVFVAVKTIGNIMLVTVLFNFLFAVIGVQLFKGTFFSCTDAEKITKRECQGQYIEFKGPGLTNPVVKDREWQPQTFNFNDVPQAMLTLFTVMTFEGWPGILESSMDSTDVDEGPFLNNRPWVAIYYVIYIIIIAFFMINIFVGFVIVTF---QNEGEEEFKDCELDKNQRKCVEF--ALKARPTRRYI--PTNRLQFHVWRVVTSQPFEYLIFAFITGNTILLMMQYYNEPKLYTRVLDGFNIGFTSVFLLECILKLFAFKPKNYFLDRWN 1219          

HSP 3 Score: 129.028 bits (323), Expect = 1.016e-29
Identity = 128/463 (27.65%), Postives = 211/463 (45.57%), Query Frame = 3
Query: 3114 FEGTILVCILASSICLC-FEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGF----KVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFK-CLDSNTRERLAATVVPNKSE--------------CLRQNHTWANSN---INFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNK-------------------YEGNYIDVFLTA----SQRNYYNTMKKLSNRKP----RKT---------------------VRRPKALVQGFFYDVAMSNR-------FELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWH-YFRYMWN 4265
            F+  IL+ I A+   L  F+ +   ++  + + L V  ++F  +F +E +LKII+ GF      Y  + W ILDF IV + L ++I  +  +  +    ++LR  R LRPLR +S    +++V+N++I A+  +F++ L+ +   +I++I GV+ F GK    C D+ T +       P  +E              CL++   W   N    NFDN     L ++Q  T EGW ++M    D+ G N  P        + YFV  I+ GSFF+LNL +GV+   F + K +                   Y G Y+D    A       +     +  ++RKP    RK                      + R K +++ F + +  S R       F   +++ +FLN + + +EHY Q    T  LD  N +F  +FTLE +VK+  L +H YF  ++N
Sbjct:   76 FDVMILITIFANCAALAAFQPLPEQDSSLINEELEVAEFVFLGIFTMESVLKIIAYGFVMHPGAYLRNGWNILDFVIVVVGLATIIVKL--YTPDSFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKALIPLFHIALLVVFVVIIYAIIGVELFMGKLHSTCYDNVTGQPTFDEPHPCSTESEGYSCSNAGPGQVCLKK---WEGPNYGITNFDNIGLACLTVFQCITLEGWTDVMYSINDAIG-NSWP--------WLYFVTLIIWGSFFVLNLVLGVLSGEFAKEKARAQKSGEFQKLREKQLVDDAYHG-YLDWISQAEDIEGDSSAGEDEEGKADRKPSFRRRKENDDISKNKENQEDSAASDQGWIDRKKKILKRFHHRLRRSCRKAVKTQWFYWTVIVFVFLNSLTLALEHYNQPEFLTQFLDKANKLFLALFTLEMVVKMYCLGFHGYFASLFN 523          

HSP 4 Score: 94.3597 bits (233), Expect = 4.237e-19
Identity = 96/346 (27.75%), Postives = 164/346 (47.40%), Query Frame = 1
Query: 4444 RIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLK--KTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQPPYCNNTHVLR--DGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPK--PNMIA---LVSFDLPIVEGDKMHCLDILIALVKHVI--------GDIEDS-EEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFKQMTENATLSSRHDSYYLQLNRQTL 5427
            R+FR  R+++L+    GI+ LL+  + S  AL  +G L+++  FIY++VGM +FG +       ++   NF+TF +S+++LFR  T   W  I+ A       C +T   +     Y   ++G CGT  F   Y  +F  IC  +IIN+++A+I++NF+       + +     + F  VW  YDP AS  +K+ ++   +  +  PLG  K  P+  A   LVS ++P+     ++    L  LV+  +        G +E + EE R I  ++  K  + F + +             +  A   +Q  ++  KA    +Q  ENA     H +  LQ   +TL
Sbjct: 1250 RLFRALRLVKLLNQGSGIKTLLWTFIKSFQALPYVGLLIIMTFFIYAVVGMQMFGRIAIDPETQINRNNNFQTFPQSLMVLFRSATGENWQLIMLA-------CTDTPNAKCDPNAYPQDTDGLCGTD-FAYAYFCSFYAICSFLIINLFVAVIMDNFDYLTRDWSI-LGPHHLDEFVRVWSEYDPEASGCVKHVDIVTVLKRIAPPLGFGKFCPHREACKRLVSMNMPLNRDGTVNFNATLFGLVRTSLSIKRPEGKGSLEKANEEMRAIIMKVWPKTSQEFLDEIIQPPGGDDEVTVGKFYATYLIQEYFRRFKA----RQRAENAQYQDAHSTQALQAGLRTL 1582          

HSP 5 Score: 83.5741 bits (205), Expect = 7.709e-16
Identity = 61/193 (31.61%), Postives = 102/193 (52.85%), Query Frame = 3
Query: 1845 IFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIIDLGVEEVD-----ALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTY---HTQIFGDNIPRWNFDDFWHSMILVFRIICGE 2396
            +  + PF  L  +F I  NTI++  ++Y   K +  +L   NI FT ++++EC LK+ A   K YF   WN+FDFVVV+ S++D+ + EV      A   FR FR  R+ KL      ++ LL     +   +  + +++++  +++AV+G Q +        TQI  +N    NF  F  S++++FR   GE
Sbjct: 1150 VVTSQPFEYLIFAF-ITGNTILLMMQYYNEPKLYTRVLDGFNIGFTSVFLLECILKLFAFKPKNYFLDRWNLFDFVVVVGSVVDITMNEVSSEQMFAFGFFRLFRALRLVKLLNQGSGIKTLLWTFIKSFQALPYVGLLIIMTFFIYAVVGMQMFGRIAIDPETQINRNN----NFQTFPQSLMVLFRSATGE 1337          

HSP 6 Score: 78.5666 bits (192), Expect = 2.521e-14
Identity = 78/279 (27.96%), Postives = 123/279 (44.09%), Query Frame = 3
Query: 3069 HAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPT-LKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNF 3902
            H  R       + + F  T++V +  +S+ L  E     N P  L Q L   N +F  LF +EM++K+  LGF  YF S +   D  +V  SLL L                LR +R LR  +    W  +  +V +L+ ++ SI  +LL+  +F +IFS+ G+Q F GKF           L    VP                 NFD+     + ++QI T E W  +M   I S G   +      +    YF+  ++VG++ +LN+F+ + +DN 
Sbjct:  445 HRLRRSCRKAVKTQWFYWTVIVFVFLNSLTLALEHY---NQPEFLTQFLDKANKLFLALFTLEMVVKMYCLGFHGYFASLFNRFDCLVVISSLLELGLTE-AMDQRPIGISMLRCVRLLRIFKVTRYWSSLSNLVASLLNSMRSIMGLLLLLSLFMVIFSLLGMQIFGGKF----------NLGDEDVPRS---------------NFDSFWRALVTVFQILTGEDWNAVMYTGIQSWGGITESLSAIPI---LYFIFLVVVGNYILLNVFLAIAVDNL 691          

HSP 7 Score: 76.2554 bits (186), Expect = 1.382e-13
Identity = 78/295 (26.44%), Postives = 131/295 (44.41%), Query Frame = 3
Query: 3063 RWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMA--------YYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKY 3923
            ++H +R     +   + FE  I   I  ++I L  +  Y +      + L   N  FT +F +E ILK+ +   K YF   W + DF +V  S++ +  + +    +M AF   R  RALR ++ +++  G+K ++   I +  ++  V L+ I+ + I+++ G+Q F G+    +D  T+                      N N NF       + L++ AT E W  IM    D+      P    Q           YAYF  F  + SF I+NLF+ VI+DNF+ L   +
Sbjct: 1144 QFHVWR-----VVTSQPFEYLIFAFITGNTILLMMQ--YYNEPKLYTRVLDGFNIGFTSVFLLECILKLFAFKPKNYFLDRWNLFDFVVVVGSVVDITMNEVS-SEQMFAFGFFRLFRALRLVKLLNQGSGIKTLLWTFIKSFQALPYVGLLIIMTFFIYAVVGMQMF-GRI--AIDPETQ---------------------INRNNNFQTFPQSLMVLFRSATGENWQLIMLACTDTPNAKCDPNAYPQDTDGLCGTDFAYAYFCSFYAICSFLIINLFVAVIMDNFDYLTRDW 1406          

HSP 8 Score: 70.8626 bits (172), Expect = 4.952e-12
Identity = 49/164 (29.88%), Postives = 93/164 (56.71%), Query Frame = 3
Query:  525 ISTNQIFDYFIMLTILVNCVFLALNNDYPIS------------EYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGT 980
            I+TN  F  FI+L I+V+   LA  +  P++            +Y F A++T+E+ I++ + GVI++  ++ R  +NL+D L++ +S + I +     Q +V V  LR LRVLR L+ I    GLK +   +  ++K +  ++++++     FA+  +Q+++GT
Sbjct:  829 IATNSYFVNFILLLIIVSSCMLAAED--PLNSNSKRNQVLNYFDYFFTAVFTIEITIKIIAYGVILHKGSFCRSAFNLLDFLVVAVSIVSIALRDSSSQISV-VRILRVLRVLRPLRAINRAKGLKHVVQCVFVAVKTIGNIMLVTVLFNFLFAVIGVQLFKGT 989          

HSP 9 Score: 68.5514 bits (166), Expect = 3.130e-11
Identity = 52/216 (24.07%), Postives = 104/216 (48.15%), Query Frame = 3
Query: 1686 DNKAEYEDEVEIGNDTNNTDTAEMNPTIDRNCQCCIKQNVLCSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEH-YPSEKTWDDILKYSNIIFTVIYIIECSLKIMA----LSKEYF-NVGWNIFDFVVVIASIIDLGVE----EVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTY 2303
            D+KA    + E      +T+  +  P +       I  N  C + V  +       T+ +F  FI   I +++ ++A+E    S    + +L Y +  FT ++ IE ++KI+A    L K  F    +N+ DF+VV  SI+ + +     ++  + I R  R+ R  +     + ++ ++  +F  +  +GN+ ++ +L  ++FAVIG Q ++ T+
Sbjct:  781 DSKATLNRDHESVRSATSTEVMDHEP-MPPESSLFIFSNTNCFRVVCHR-----IATNSYFVNFILLLIIVSSCMLAAEDPLNSNSKRNQVLNYFDYFFTAVFTIEITIKIIAYGVILHKGSFCRSAFNLLDFLVVAVSIVSIALRDSSSQISVVRILRVLRVLRPLRAINRAKGLKHVVQCVFVAVKTIGNIMLVTVLFNFLFAVIGVQLFKGTF 990          

HSP 10 Score: 67.0106 bits (162), Expect = 7.205e-11
Identity = 46/184 (25.00%), Postives = 92/184 (50.00%), Query Frame = 3
Query: 1845 IFVTDPF---FDLFISFCIFINTIIMAS-EHYPSEKTW--DDILKYSNIIFTVIYIIECSLKIMALS-----KEYFNVGWNIFDFVVVIAS----IIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDD 2351
            +F  D F   FD+ I   IF N   +A+ +  P + +   ++ L+ +  +F  I+ +E  LKI+A         Y   GWNI DFV+V+      I+ L   +   +   RAFR+ R  +L     +++++L  I   +  + +++++V+ V+ ++A+IG + +    H+  + +   +  FD+
Sbjct:   66 VFFLDVFRTPFDVMILITIFANCAALAAFQPLPEQDSSLINEELEVAEFVFLGIFTMESVLKIIAYGFVMHPGAYLRNGWNILDFVIVVVGLATIIVKLYTPDSFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKALIPLFHIALLVVFVVIIYAIIGVELFMGKLHSTCYDNVTGQPTFDE 249          
BLAST of Sodium channel protein vs. Ensembl Nematostella
Match: EDO36844 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHI0])

HSP 1 Score: 204.912 bits (520), Expect = 7.972e-53
Identity = 134/409 (32.76%), Postives = 206/409 (50.37%), Query Frame = 3
Query: 3075 FRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGF----KVYFTSFWTXXXXXXXXXX--XXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKN-----KYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLR-WHYFRYMWN 4265
            FR  +  + +++ F+ T+L+ IL + + +  E   +      ++ + +  Y+F  +F IEM++K+I+LG       Y  S W ++D F+V IS   + +     G  + +   R  R +R LRPLR ISR  G+KIVV  LI ++  I N++L+   F++IF I GVQ FKGKF  C D       A   V  K+ECL    +W N   NFDN     L L+  +T +GW+ IM D ID+ GI+ QP + +      YFV F+L+  F +LN+ +GV+++NF + +      K              R      + LS   PR          + F + V     F+L I  +I LN++ M +EHY+Q    T  L   N +F+ +F LEAI+KI  L    Y +  WN
Sbjct:  920 FRMLNKELYQNKWFDRTVLLFILLNCVVMALEGPSVLPGSLERRVIDICMYVFLGIFTIEMMVKVIALGLWIGPDAYLRSGWNVMDGFLVVISWVDVIVTATTNGQNSILGVLRVFRALRTLRPLRVISRAPGLKIVVETLISSLKPIGNIVLIAATFFIIFGILGVQLFKGKFHYCTD-------ATVPVTTKTECLENGGSWVNREYNFDNLAKALLTLFVFSTKDGWVNIMYDGIDAVGIDKQPIRNHARYNVIYFVGFLLLAGFVVLNMLVGVVVENFQKCRTLIEMEKKIDEEKKNKKEEKMRREIAEDEALSEHYPRP---------RKFIHAVCTHGYFDLGIAAVIALNVLCMALEHYQQPDGLTAFLKCANYVFTAVFILEAILKIFALGIKRYIKDRWN 1312          

HSP 2 Score: 101.293 bits (251), Expect = 3.545e-21
Identity = 80/277 (28.88%), Postives = 138/277 (49.82%), Query Frame = 3
Query: 1656 SEEEKEGKDCDNKAEYEDEVEIGNDTNNTDTAEMNPTIDRNCQCCIKQNVLCSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMF--AVIGKQSYRNTYHTQIFGDN-----IPRWNFDDFWHSMILVFRIICGE-WIEPSFDCIRANSPLCLLIFI 2459
            SE    G   ++ AE E ++     +++ DT+E +P   R C               F++     V   +F   I   IF+NT+ M  E+Y   +   D+L+  N IFT I+ IE  +K++ L    Y    +NIFD  +VI S+++L  ++   +S+ R+FRL RVFKL +    +R  L ++  T+  +  ++ + LLV++MF  +++G   +   Y    F ++       R NFDD + +++ VF+++  E W    +D +RA S    L FI
Sbjct:  364 SEPPVSGVSGNSLAESETDL-----SDDEDTSESSP---RRC-------------AKFRDGCASSVDSKWFMYVIMGAIFVNTLTMGIEYYGQPQKMTDVLEIFNYIFTAIFGIEMIMKLIGLGFYGYIKDAFNIFDGTIVIISVVELFGDDDSGISVLRSFRLLRVFKLVRFLPALRRQLLVMIHTMDNV--MTFLALLVIFMFTASILGMNLFGGKYR---FPNDEGVMETSRANFDDLFWAIVTVFQVLTQEDWNIVMYDGMRATSKWAGLYFI 614          

HSP 3 Score: 98.5969 bits (244), Expect = 2.014e-20
Identity = 54/126 (42.86%), Postives = 81/126 (64.29%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNL--KKTG----GLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQPPYC 4749
            +EE      I PT++RV+R+ RI RVL+L+K A+GIRKLL  +  +LP + N+G L LL+ FI+S +G+ +FG +  +K G    G+D+  NF +F  ++L LFR++T   WN IL+   I P  C
Sbjct: 1328 LEEMTMELPINPTIIRVMRVLRIARVLKLLKTAEGIRKLLDTVAQALPQVGNLGMLFLLMFFIFSALGIELFGKIDCEKPGITCQGMDEHANFRSFGIAMLTLFRISTGDNWNGILKDT-ISPDVC 1452          

HSP 4 Score: 97.0561 bits (240), Expect = 5.820e-20
Identity = 60/201 (29.85%), Postives = 104/201 (51.74%), Query Frame = 3
Query: 1839 LYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIIDLGVEEVDA--------LSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSY------RNTYHTQIFGDNIPRWNFDDFWHSMILVFRIICGE 2396
            ++   T  +FDL I+  I +N + MA EHY         LK +N +FT ++I+E  LKI AL  K Y    WN  D ++VI SI+ + +EE+          + + R  R+ RV KL ++ + +R LL  +   + ++GNL ++ LL+ ++F+ +G + +      +     Q   ++    NF  F  +M+ +FRI  G+
Sbjct: 1240 IHAVCTHGYFDLGIAAVIALNVLCMALEHYQQPDGLTAFLKCANYVFTAVFILEAILKIFALGIKRYIKDRWNQLDMLIVILSIVGIALEEMTMELPINPTIIRVMRVLRIARVLKLLKTAEGIRKLLDTVAQALPQVGNLGMLFLLMFFIFSALGIELFGKIDCEKPGITCQGMDEHA---NFRSFGIAMLTLFRISTGD 1437          

HSP 5 Score: 92.4337 bits (228), Expect = 1.737e-18
Identity = 88/331 (26.59%), Postives = 152/331 (45.92%), Query Frame = 3
Query:  474 SFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDY-----------PISEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCY-GQNNV--NVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWEN-QYNLV---------IRASGSWNILFYIIVVFFGSFYLINLMLAVV 1394
            S  + AP +  R L   +  N+ FD  ++L IL+NCV +AL                I  YVFL I+T+EM++++ + G+ I    YLR  +N++D  ++++S++ +IV     GQN++   +   R LR LR L+ I+  PGLK +   LI SLK +  +++++      F +  +Q+++G                           F+Y                  C  D++    +KT     CL + G   N  Y NFDN   ALL++F   T D W N  Y+ +         IR    +N+++++  +    F ++N+++ VV
Sbjct:  910 SLYVFAPDNRFRMLNKELYQNKWFDRTVLLFILLNCVVMALEGPSVLPGSLERRVIDICMYVFLGIFTIEMMVKVIALGLWIGPDAYLRSGWNVMDGFLVVISWVDVIVTATTNGQNSILGVLRVFRALRTLRPLRVISRAPGLKIVVETLISSLKPIGNIVLIAATFFIIFGILGVQLFKG--------------------------KFHY------------------C-TDATVPVTTKTE----CLENGGSWVNREY-NFDNLAKALLTLFVFSTKDGWVNIMYDGIDAVGIDKQPIRNHARYNVIYFVGFLLLAGFVVLNMLVGVV 1190          

HSP 6 Score: 91.6633 bits (226), Expect = 2.626e-18
Identity = 60/227 (26.43%), Postives = 112/227 (49.34%), Query Frame = 3
Query:  798 VSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHN------PNNWIRN-----------------GINYLTCGNDSSAGN-CSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
            ++++R +RVLR L+ I  +P ++ + + L+ +L ML  V+ +     S F +  +Q++QG LR++CV  +     +S N  N  ++AFY     +      P N                     G+ Y    N S+  N C+  N        +G NP +   +FDN   A +++FQ+ITL+ W +    +  A G WN +++++++  GS+++ NL L V++  +
Sbjct:    1 MTAVRAIRVLRPLRAINRVPSIRILVTLLLDTLPMLGNVLAMCSLIFSIFGIVGVQMWQGVLRSRCVAQLPGN--LSANQLN--ISAFYQPGGSSDLVCSLPENSGDKHCTSAFIPASTAHGRECGLTYEQYSNRSNYTNVCANWNQYYTLCADMGINPLYDAVSFDNILIAWVAIFQVITLEGWTDIMYYIQDAHGFWNFIYFVVLIVIGSYFMTNLCLVVITTQF 223          

HSP 7 Score: 79.7221 bits (195), Expect = 1.055e-14
Identity = 73/295 (24.75%), Postives = 129/295 (43.73%), Query Frame = 3
Query: 3063 RWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYA--YFVIFILVGSFFILNLFIGVIIDNFNRLKNKY--EGNY 3935
            R   FR+      + + F   I+  I  +++ +  E  Y      +   L + NYIFT +F IEMI+K+I LGF  Y    + I D  IV IS++ L      FG + +    LR+ R LR  + +     ++  +  +I+ + ++   L + ++F    SI G+  F GK+    D    E                      S  NFD+     + ++Q+ T E W  +M D + +T            + +A  YF++ + +G++ + NL + ++++ F      Y  EGNY
Sbjct:  396 RCAKFRDGCASSVDSKWFMYVIMGAIFVNTLTMGIE--YYGQPQKMTDVLEIFNYIFTAIFGIEMIMKLIGLGFYGYIKDAFNIFDGTIVIISVVEL------FGDDDSGISVLRSFRLLRVFKLVRFLPALRRQLLVMIHTMDNVMTFLALLVIFMFTASILGMNLFGGKYRFPNDEGVME---------------------TSRANFDDLFWAIVTVFQVLTQEDWNIVMYDGMRAT------------SKWAGLYFILLMTIGNYILFNLLVAILVEGFASAPAGYDSEGNY 649          

HSP 8 Score: 73.9442 bits (180), Expect = 6.168e-13
Identity = 66/273 (24.18%), Postives = 123/273 (45.05%), Query Frame = 3
Query: 3069 HAFRNRSLL--ITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEM--TAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHT--WANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYA---YFVIFILVGSF 3860
            H  R R  +  +  H  F+  I   I  + +C+  E  +      L   L+  NY+FT +F +E ILKI +LG K Y    W  LD  IV +S++ +  + +     +  T  R +R +R  R L+ +   +G++ +++ +  A+P + N+ ++ ++ + IFS  G++ F                       K +C +   T    + + NF +     L L++I+T + W  I++D I      + P+ +  M  +    YF +F+L   F
Sbjct: 1232 HYPRPRKFIHAVCTHGYFDLGIAAVIALNVLCMALE--HYQQPDGLTAFLKCANYVFTAVFILEAILKIFALGIKRYIKDRWNQLDMLIVILSIVGIALEEMTMELPINPTIIRVMRVLRIARVLKLLKTAEGIRKLLDTVAQALPQVGNLGMLFLLMFFIFSALGIELF----------------------GKIDCEKPGITCQGMDEHANFRSFGIAMLTLFRISTGDNWNGILKDTISPDVCRVNPEIDCSMLEHVAPIYFAVFVLATQF 1480          

HSP 9 Score: 68.5514 bits (166), Expect = 2.661e-11
Identity = 55/217 (25.35%), Postives = 96/217 (44.24%), Query Frame = 3
Query: 1758 NPTIDRNC--QCCIKQNVLCSKWVAFQNRLYIFVTD-------------PFFDLFISFCIFINTIIMASEHYPS------EKTWDDILKYSNIIFTVIYIIECSLKIMALS-----KEYFNVGWNIFDFVVVIASIIDLGVEE--------VDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYH 2306
            NPT+D      CC K+    + W      LY+F  D              +FD  +   I +N ++MA E  PS      E+   DI  Y   +F  I+ IE  +K++AL        Y   GWN+ D  +V+ S +D+ V          +  L +FRA R  R  ++      +++++  + S++  +GN+ +I      +F ++G Q ++  +H
Sbjct:  891 NPTVDIKVPTSCCSKR----ADW-----SLYVFAPDNRFRMLNKELYQNKWFDRTVLLFILLNCVVMALEG-PSVLPGSLERRVIDICMY---VFLGIFTIEMMVKVIALGLWIGPDAYLRSGWNVMDGFLVVISWVDVIVTATTNGQNSILGVLRVFRALRTLRPLRVISRAPGLKIVVETLISSLKPIGNIVLIAATFFIIFGILGVQLFKGKFH 1094          

HSP 10 Score: 59.3066 bits (142), Expect = 1.830e-8
Identity = 58/238 (24.37%), Postives = 97/238 (40.76%), Query Frame = 3
Query: 3399 SLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKG----------------------KFFK---------CLDSNTRERLAATV-VPNKS----ECLRQNHTWANSNINFDN------------ATNGFLALYQIATFE----------------GWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNK 3920
            ++R +R LRPLRAI+R   ++I+V  L+  +P + NVL +C + + IF I GVQ ++G                       F++          L  N+ ++   +  +P  +    EC      ++N + N+ N            A  G   LY   +F+                GW +IM    D+ G             + YFV+ I++GS+F+ NL + VI   F   K +
Sbjct:    3 AVRAIRVLRPLRAINRVPSIRILVTLLLDTLPMLGNVLAMCSLIFSIFGIVGVQMWQGVLRSRCVAQLPGNLSANQLNISAFYQPGGSSDLVCSLPENSGDKHCTSAFIPASTAHGRECGLTYEQYSNRS-NYTNVCANWNQYYTLCADMGINPLYDAVSFDNILIAWVAIFQVITLEGWTDIMYYIQDAHG----------FWNFIYFVVLIVIGSYFMTNLCLVVITTQFQETKQR 229          

HSP 11 Score: 53.5286 bits (127), Expect = 9.978e-7
Identity = 38/157 (24.20%), Postives = 76/157 (48.41%), Query Frame = 3
Query:  543 FDYFIMLTILVNCVFLA---------LNNDYPISEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLR 986
            F Y IM  I VN + +          + +   I  Y+F AI+ +EM++++   G     Y Y++D +N+ D      + ++I V + +G ++  +S LR+ R+LR  K +  LP L+     +I ++  +   + L +  M   ++  + ++ G  R
Sbjct:  413 FMYVIMGAIFVNTLTMGIEYYGQPQKMTDVLEIFNYIFTAIFGIEMIMKLIGLGF----YGYIKDAFNIFD-----GTIVIISVVELFGDDDSGISVLRSFRLLRVFKLVRFLPALRRQLLVMIHTMDNVMTFLALLVIFMFTASILGMNLFGGKYR 560          
BLAST of Sodium channel protein vs. Ensembl Nematostella
Match: EDO27998 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7Q0])

HSP 1 Score: 142.51 bits (358), Expect = 2.205e-39
Identity = 57/115 (49.57%), Postives = 84/115 (73.04%), Query Frame = 3
Query: 2118 LSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIRANSPLCLLIFIP 2462
            +S+ R FRL RV KLA+SW TM  LL  I  ++  +GNL++I+ +++Y+FAV+G Q   N+Y    FG +IPRWNF DF HS +++FR++CGEWIEP +DC+ A  P+ +L+F+P
Sbjct:    1 ISVLRTFRLLRVLKLAKSWSTMNSLLATIGKSLGALGNLTVILAIIVYIFAVMGMQLLGNSYTPDKFGGSIPRWNFKDFPHSFMMIFRVLCGEWIEPLWDCMLATGPVAMLLFVP 115          

HSP 2 Score: 56.225 bits (134), Expect = 2.705e-9
Identity = 35/95 (36.84%), Postives = 55/95 (57.89%), Query Frame = 1
Query: 4432 LRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNL---KKTGGLDDLVNFETFERSILLLFRLTTAGGW 4707
            + V+R FR+ RVL+L K    +  LL  +  SL AL N+  +L +IV+I++++GM + GN     K GG     NF+ F  S +++FR+   G W
Sbjct:    1 ISVLRTFRLLRVLKLAKSWSTMNSLLATIGKSLGALGNLTVILAIIVYIFAVMGMQLLGNSYTPDKFGGSIPRWNFKDFPHSFMMIFRV-LCGEW 94          
BLAST of Sodium channel protein vs. Ensembl Medaka
Match: ENSORLT00000035153.1 (sodium channel protein type 2 subunit alpha [Source:NCBI gene;Acc:101155239])

HSP 1 Score: 496.893 bits (1278), Expect = 1.549e-145
Identity = 335/832 (40.26%), Postives = 500/832 (60.10%), Query Frame = 3
Query: 1809 CSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEY-FNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYH---TQIFGDNIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIR-ANSPLCLLIFIPTXXXXXXXXXXXXXXXXXXXXXXXXXKN-TADEDVSKLKIVIERLRNIYPMSRNNPLGINKGNQELDSTETLKDIVVNF-GCENAAEL-----QNNHEKMRIIKNCKDLSTSNELVNLLPSTGSLSKGNKLINNAIXXXXXXXXXXGKHLXXXXXXXXXXXXXXIDEESVNELKGCCCAICYNPFQEKKPFHCCYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNH-TWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            C  W   +  + + V DPF DL I+ CI +NT+ MA EH+P +  +  +L   N +FT I+  E  LKI+AL   Y F   WNIFD ++V  S+++L      ++++ R+ RL RVFKLA+SW T+  LL II +++  MGNL++++ +++++FAV+G Q +   Y    ++I  D  PRW+  DF+HS ++VFR++CGEWIE  +DC+  A    CL++++  +V+GN V+LNLFLALLL+SF++D+L     D D++ L+I I+R+   +   ++    I   N   +  E  KD  VN  G + + +      ++N   M  I N   L+ +  +  +      L+  +    ++ DE +     +G  +N+ E  ++        EES N+   C  A+C    +      CC     +++      W   R     I EH  FE  I+  IL SS  L FED+Y +   T+K  L   + +FTY+F +EM+LK ++ GF  YFT+ W  LDF IV +SL+SL+ + L   T++ A +SLRT+RALRPLRA+SR++GM++VVNAL+ AIPSIFNVLLVC++FWLIFSI GV  F GKF+KC++           +PNK+ C  +    W N  IN+DN   G+LAL Q+ATF+GWM+IM  A+DS   + QP  E  +  Y YFV+FI+ GSFF LNLFIGVIIDNFN+ K K      D+F+T  Q+ YYN MKKL ++KP+K + RP   +QGF +D+     F++VI++LI+LNMV MM+E   Q+   T +L +IN +F  IF+ E ++K+ GLR ++F   WN
Sbjct:  675 CPAWQKIKKFVKLIVMDPFADLTITICIVLNTLFMAMEHHPMQDEFTKMLSIGNKVFTGIFTAEMVLKIIALDPYYYFQERWNIFDGIIVTISLVELCF----SINLLRSLRLLRVFKLAKSWPTLNSLLKIIGNSVGAMGNLTLVLAIIVFIFAVVGMQLFEREYRYNVSKISADRKPRWHMMDFFHSFLIVFRVLCGEWIETMWDCMEVAGVTKCLIVYMMVMVVGNLVMLNLFLALLLSSFSADNLAAIEEDSDLNNLQIAIKRICRGFDFIKSFLKNICNSNCHKEKKEKTKDNNVNLTGVDKSGDKYIVNSKSNDSIMSFINN-PSLTVTVPIAAVESDFEVLNTEDFSSASSDDEDEELSSSEGSTINDYEAGEIADSVGGELEES-NDPSPCFPAVCLQNIK------CCQV---NVDVGFWKAWWKLRQTCFRIVEHSWFESFIIFMILLSSGALAFEDVYSEQRKTIKIILEFADKMFTYIFILEMLLKWLAYGFAKYFTNAWCWLDFLIVDVSLVSLVANALEL-TDLGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIFNVLLVCLIFWLIFSIMGVNLFAGKFYKCINKTDGVECDPENIPNKTFCTNETDLIWKNLKINYDNVGMGYLALLQVATFKGWMDIMYAAVDSGEPDEQPVFERNIKMYLYFVVFIIFGSFFTLNLFIGVIIDNFNQQKKKIS---TDLFMTEDQKKYYNAMKKLGSKKPQKPIPRPSNKIQGFIFDIISKQAFDIVIMVLIWLNMVTMMVETADQSEKQTYILRVINYVFIVIFSGECLLKMIGLRHYFFMNGWN 1487          

HSP 2 Score: 279.256 bits (713), Expect = 3.881e-75
Identity = 157/309 (50.81%), Postives = 213/309 (68.93%), Query Frame = 1
Query: 4414 FITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMF---IQPPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKH 5331
            F++PTL RV+R+ RIGRVLRLIK AKGIR LLFAL++SLPALFNIG LL L++FIY+I GMS F  +KK  G+DDL NFETF  S++ LF++TT+GGW+ +L+ +    I     N  H   +      + GDCG    GI +  ++I I +LI++NMYIA+ILENFN A  +    ++EDDFEMFY VWER+DP A+Q+I Y +LSDF   L+ PL +PKPN I L+  DLPIV GD++HCLDIL A  K V+G   +  E   ++ QME ++    P++V    ITTT++RK+E  +A  +QRA++ 
Sbjct: 1511 FVSPTLFRVIRLARIGRVLRLIKSAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSSFAYVKKDKGIDDLFNFETFGNSMICLFQITTSGGWDTLLDPILNSNIDDCDRNKEHPGSN------TKGDCGNPPVGIAFFVSYIIISFLIVVNMYIAVILENFNVATEESTDPLSEDDFEMFYEVWERFDPGATQFIHYYSLSDFADALNPPLQVPKPNRIDLIFMDLPIVSGDRIHCLDILFAFTKRVLG---EGGEMDILREQMEERFMASNPSKVSYEPITTTLRRKEELRSATVIQRAFRR 1810          

HSP 3 Score: 258.455 bits (659), Expect = 8.260e-69
Identity = 153/394 (38.83%), Postives = 239/394 (60.66%), Query Frame = 3
Query:  294 QPDPELVAGSILLEDKLGEFPEELLGKPLNEIDQNL-KDKSFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLI-------------STNQIFDYFIMLTILVNCVFLALNNDY--------PISEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGI-NYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
            +P+ +L+AG  L     G+ P  L+  PL E+D      K+F+V+N R   K I+R++A  +     P++ IR+L++ I             S  ++F+  IM TIL NC  +  ++          P+ EY F AIYT E ++++ +RG  +  +T+LRDP+N +D  +I+L+Y+    +  +G+    +S+LRT RVLRA K I+++PGLKTI  AL +S+K L +V+IL++FC+S FAL  LQ++ G L+NKCV+  +  +V  E +  E+      N   N N++  +G  + L CGN + AG C    P        G  P+FGYT+FD+FGWA L++F+L+T D+WEN Y   +RASG   ++F+++V+F GSFYLINL+LAVV+M+Y
Sbjct:   50 KPNRDLMAGKPL-PILYGDIPNGLVSTPLEELDPAYYNQKTFIVLNKR---KMIFRFNAAPALYFLGPFNPIRRLSIKILVHSYPLHKVDIDSPCRLFNVLIMCTILTNCALMTRSSSADSNSTWTKPV-EYTFTAIYTFESLVKILARGFCLGEFTFLRDPWNWLDFSVIVLAYLNEFAD--FGR----LSALRTFRVLRAFKAISVIPGLKTIVGALFQSVKKLTDVMILTVFCLSVFALVGLQLFMGHLKNKCVRQPE--HVTPEENLTEYWRILIEN--ANSNHYFLSGKRDPLLCGNSTYAGKC----PEGYTCVSFGSTPDFGYTSFDSFGWAFLALFRLMTQDFWENLYQQTLRASGKPYMIFFVLVIFLGSFYLINLILAVVAMAY 424          

HSP 4 Score: 87.8113 bits (216), Expect = 1.007e-16
Identity = 60/199 (30.15%), Postives = 106/199 (53.27%), Query Frame = 3
Query: 1830 QNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEV-----DALSIFRAFRLF---RVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRI-ICGEW 2399
            Q  ++  ++   FD+ I   I++N + M  E     +    IL+  N +F VI+  EC LK++ L   +F  GWNIFD VVVI SI  + + ++      + ++FR  RL    RV +L +S + +R LL  +  ++  + N+ +++ LV++++A+ G  S+      +   D    +NF+ F +SMI +F+I   G W
Sbjct: 1413 QGFIFDIISKQAFDIVIMVLIWLNMVTMMVETADQSEKQTYILRVINYVFIVIFSGECLLKMIGLRHYFFMNGWNIFDLVVVILSIAGVFLAKIIEDYFVSPTLFRVIRLARIGRVLRLIKSAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSSFAYVKKDKGIDD---LFNFETFGNSMICLFQITTSGGW 1608          

HSP 5 Score: 68.9366 bits (167), Expect = 5.853e-11
Identity = 76/321 (23.68%), Postives = 139/321 (43.30%), Query Frame = 3
Query: 3039 DIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKV-YFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFF-KCLD-----------------------------SNTRERLA------ATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVI 3890
            DI++PC                 R F   +++C + ++  L       D+N T  +    + Y FT ++  E ++KI++ GF +  FT      ++   S+ +L+ +N+   FG       +LRT R LR  +AIS   G+K +V AL  ++  + +V+++ +    +F++ G+Q F G    KC+                              S  R+ L       A   P    C+    T      +FD+    FLAL+++ T + W  + Q  + ++G   +P       Y  +FV+ I +GSF+++NL + V+
Sbjct:  135 DIDSPC-----------------RLF-NVLIMCTILTNCALMTRSSSADSNSTWTKP---VEYTFTAIYTFESLVKILARGFCLGEFTFLRDPWNWLDFSVIVLAYLNEFADFGR----LSALRTFRVLRAFKAISVIPGLKTIVGALFQSVKKLTDVMILTVFCLSVFALVGLQLFMGHLKNKCVRQPEHVTPEENLTEYWRILIENANSNHYFLSGKRDPLLCGNSTYAGKCPEGYTCVSFGSTPDFGYTSFDSFGWAFLALFRLMTQDFWENLYQQTLRASG---KP-------YMIFFVLVIFLGSFYLINLILAVV 420          

HSP 6 Score: 66.6254 bits (161), Expect = 3.100e-10
Identity = 59/248 (23.79%), Postives = 118/248 (47.58%), Query Frame = 3
Query: 1629 NDDNFRFMDSEEE------KEGKDCDNKAEYEDEVEIGNDTNNT-DTAEMNPTI-DRNCQCCIKQNVLCSKWVAF---QNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSE--KTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIID-----LGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQI 2315
            N ++F    S++E       EG   ++    E    +G +   + D +   P +  +N +CC + NV    W A+   +   +  V   +F+ FI F I +++  +A E   SE  KT   IL++++ +FT I+I+E  LK +A    +YF   W   DF++V  S++      L + ++ A+   R  R  R  +    ++ MR+++  +   I  + N+ ++ L+   +F+++G   +   ++  I
Sbjct: 1018 NTEDFSSASSDDEDEELSSSEGSTINDYEAGEIADSVGGELEESNDPSPCFPAVCLQNIKCC-QVNVDVGFWKAWWKLRQTCFRIVEHSWFESFIIFMILLSSGALAFEDVYSEQRKTIKIILEFADKMFTYIFILEMLLKWLAYGFAKYFTNAWCWLDFLIVDVSLVSLVANALELTDLGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIFNVLLVCLIFWLIFSIMGVNLFAGKFYKCI 1264          

HSP 7 Score: 57.7658 bits (138), Expect = 1.264e-7
Identity = 65/321 (20.25%), Postives = 131/321 (40.81%), Query Frame = 3
Query:  495 WSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYP-----------ISEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASG-------SWNI---LFYIIVVFFGSFYLINLMLAVV 1394
            W  +R+    I  +  F+ FI+  IL++   LA  + Y             ++ +F  I+ LEM+++  + G       Y  + +  +D LI+ +S + ++       +   + SLRTLR LR L+ ++   G++ + +AL+ ++  +F V+++ L     F++  + ++ G    KC+   D      EN  N+        +  N  + I   +                                    N+DN G   L++ Q+ T   W +     + +           NI   L++++ + FGSF+ +NL + V+
Sbjct: 1091 WWKLRQTCFRIVEHSWFESFIIFMILLSSGALAFEDVYSEQRKTIKIILEFADKMFTYIFILEMLLKWLAYGFA----KYFTNAWCWLDFLIVDVSLVSLVANALELTDLGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIFNVLLVCLIFWLIFSIMGVNLFAGKFY-KCINKTDGVECDPENIPNK-------TFCTNETDLIWKNLK----------------------------------INYDNVGMGYLALLQVATFKGWMDIMYAAVDSGEPDEQPVFERNIKMYLYFVVFIIFGSFFTLNLFIGVI 1365          
BLAST of Sodium channel protein vs. Ensembl Medaka
Match: ENSORLT00000035706.1 (sodium channel protein type 4 subunit alpha B [Source:NCBI gene;Acc:101167997])

HSP 1 Score: 434.106 bits (1115), Expect = 4.448e-125
Identity = 274/751 (36.48%), Postives = 431/751 (57.39%), Query Frame = 3
Query:  294 QPDPELVAGSILLEDKLGEFPEELLGKPLNEIDQ-NLKDK-SFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQIFDY---------FIMLTILVNCVFLALNNDYPIS---EYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHDKDQMKDLKITNGMSDADSSLCKNTTSIHENDDNFRFMDSEEEKEGKDCDNKAEYEDEVEIGNDTNNTDTAEMNPTIDRNCQCCIKQNVLCSKWVAFQN-----RLYIFVTDPFFDLFISFCIFI----NTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSK-EYFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYH---TQIFGD-NIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIR-ANSPLCLLIFI 2459
            +P P+L AG   L     + P  LLG PL +ID    KDK +F+V+N   K K I+R+SAT +  + +P+  IR+LA+ I  +  + Y         FIM TIL NC F+A++   P +   EY F  IYT E +I++ +RG  +  +T+LRDP+N +D  +I+++Y+   V+        NVS+LRT RVLRALKTI+++PGLKTI  ALI+++K L +V+IL++FC+S FAL  LQ++ G LR KCV+          N +     +FYYN+       +    + L CGN S AG C    P+       G NPN+GYT+FD FGWA LS+F+L+T DYWEN Y+  +R++G   ++F+++V+F GSFYLINL+LAVV+M+YEE+ +A   E  +++     A +                      K + + + + N       ++  + T++H         DS   K       K   E +V   +    ++   +N  I+ + +C     V   +++ ++      RL   V     D F+   I +    NT+ MA EHYP  + ++ +L   N++F+ I+  E  LK++AL    YF  GWNIFD ++V  S+++LG+ +V+ LS+ R+FRL RVFKLA+SW T+  L+ II ++I  +GNL++++ +++++FAV+G Q +   Y     +I  D ++PRW+  DF+HS ++VFR++CGEWIE  +DC+  A  PLC+L+F+
Sbjct:   76 RPRPDLEAGK-QLPRIFADIPPHLLGVPLEDIDPFYFKDKRTFIVLN---KGKAIFRFSATSALYIFSPFHPIRRLAIKILVHS-YPYAQSFAQVVLFIMCTILTNCCFMAMSEPTPWAKYLEYTFTGIYTFESLIKILARGFCVGPFTFLRDPWNWLDFSVIVMAYVTEFVDLG------NVSALRTFRVLRALKTISVIPGLKTIVGALIQAVKKLADVMILTVFCLSVFALIGLQLFMGNLRQKCVR----TTAHCINGTLPTNTSFYYNYYK-----VEGAKDALICGNSSDAGKC----PDGFECLKAGRNPNYGYTSFDTFGWAFLSLFRLMTQDYWENLYHQTLRSAGKTYMVFFVVVIFLGSFYLINLILAVVAMAYEEQNQATIAEACQKEKEFQLAMEIL--------------------KKEQQAIYVINTHRCTFLAVFVSVTALHH--------DSTGPK-------KPSVEPDVYYRHPKLVSEIQSLNNLIESHKKCHPCWYVFAHQYLVWECSPCWLRLKQLVKIMVTDPFLDLAITVCIVLNTLFMAMEHYPMTEEFNGMLTIGNLVFSGIFTAEMVLKVIALDPYYYFQTGWNIFDSIIVCLSLMELGLSDVEGLSVLRSFRLLRVFKLARSWPTLNTLIKIIGNSIGALGNLTLVLAIIVFIFAVVGMQLFGKNYQDCVCKISKDCSLPRWHMKDFFHSFLIVFRVLCGEWIETMWDCMEVAGQPLCILVFM 767          

HSP 2 Score: 350.132 bits (897), Expect = 1.787e-97
Identity = 204/446 (45.74%), Postives = 269/446 (60.31%), Query Frame = 3
Query: 2973 CAICYN----PFQEKKPFHCCYCIVCDIETPCG--SRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNT-----RERLAATVVPNKSECLRQNHT----WANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            C + YN    P      F CC     DI+T  G    W   R     I EH  FE  I+  IL SS  L FEDIY++    +K  L   + IFTY+F +EMILK ++ GFK YFT++W  LDFFIV +S    I     +   ++      T RALRPLRA SR+ G+++VVNALI AIPSI NVLLVC++FWLIFSI GV  F GKF +C+  +      RE      + NKSEC  +N T    W    +NFDN   G+LAL Q+ATF+GWM+IM  A+DS  +  QP KE  +  Y YFVIFI+ GSFF LNLFIGVIIDNFN+ K K  G   D+F+T  Q+ YYN MKKL ++KP+K + RP   +QGFF+D+     F+++I++LI  NM+ MM+E   Q+     +L  +N+ F  +FT+E ++KI  LR ++F   WN
Sbjct:  842 CQVLYNFIVSPSVCVSRFQCC-----DIDTTAGLGKIWWRLRKTCFQIVEHSWFESFIIFMILLSSGALAFEDIYIEQRRMVKVVLEFADKIFTYIFILEMILKWLAYGFKKYFTNYWCWLDFFIVDVSSGVSICCNTLWLLSVSL-----TFRALRPLRAASRFAGIRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFGRCVSRSGYIHDFRE------INNKSECEAKNDTSQYYWTKVKVNFDNVGAGYLALLQVATFKGWMDIMYAAVDSRAVEEQPVKEINLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKRKIRGQ--DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPLNTLQGFFFDLVGKQAFDIIIMVLILFNMITMMVETDEQSPQMEKILYHVNLAFIVVFTIECLIKIVALRCYFFTIGWN 1269          

HSP 3 Score: 286.96 bits (733), Expect = 9.866e-78
Identity = 153/314 (48.73%), Postives = 219/314 (69.75%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQPPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKH 5331
            + + ++  F++PTL RV+R+ RIGR+LRLI+ AKGIR LLFAL++SLPALFNIG LL L++FIY+I GM+ F  +K+  G+DD+ NFETF  S++ LF++TT+ GW+ +L  +    P   + ++   G       G+CG    GI +  T+I I +LI++NMYIAIILENF+ A  +    ++EDDFEMFY VWE++DP A+Q+I+YA LSDF   L EPL I KPN I L+S DLP+V GDK+HCLDIL A  K V+G   +S E   +K+QME K+    P+++    ITTT++RK+E+++A  +QR ++ 
Sbjct: 1285 LADIIEKYFVSPTLFRVIRLARIGRILRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMANFAYVKRQAGIDDMFNFETFGNSMICLFQITTSAGWDSLLSPILNNSPEECDANIPHTG---TTVRGNCGNPSVGITFFVTYIIISFLIVVNMYIAIILENFSVATEESTEPLSEDDFEMFYEVWEKFDPEATQFIEYAKLSDFADALSEPLRIAKPNRIKLISMDLPMVSGDKIHCLDILFAFTKRVLG---ESGEMDALKQQMEEKFMMANPSKISYEPITTTLRRKQEEVSATIIQRCYRR 1592          

HSP 4 Score: 95.1301 bits (235), Expect = 6.155e-19
Identity = 63/211 (29.86%), Postives = 108/211 (51.18%), Query Frame = 3
Query: 1830 QNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEV-----DALSIFRAFRLF---RVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIRANSP 2438
            Q   +  V    FD+ I   I  N I M  E        + IL + N+ F V++ IEC +KI+AL   +F +GWNIFDFVVVI SI+ + + ++      + ++FR  RL    R+ +L +  + +R LL  +  ++  + N+ +++ LV++++A+ G  ++          D    +NF+ F +SMI +F+I      +     I  NSP
Sbjct: 1195 QGFFFDLVGKQAFDIIIMVLILFNMITMMVETDEQSPQMEKILYHVNLAFIVVFTIECLIKIVALRCYFFTIGWNIFDFVVVILSIVGIVLADIIEKYFVSPTLFRVIRLARIGRILRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMANFAYVKRQAGIDD---MFNFETFGNSMICLFQITTSAGWDSLLSPILNNSP 1402          

HSP 5 Score: 92.4337 bits (228), Expect = 3.772e-18
Identity = 113/511 (22.11%), Postives = 208/511 (40.70%), Query Frame = 3
Query: 3060 SRWHAFRNRSLLITEH-----RAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSF----WTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFF-KC-----------LDSNT------------RERLA------ATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNR-------------------------------LKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKAL--VQGF-----------------------------------FYDVAMSNRF-ELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGL-RWHYFRYMWN 4265
            S +H  R  ++ I  H     ++F   +L  +       CF  +   + PT     + + Y FT ++  E ++KI++ GF V   +F    W  LDF ++ ++ ++          ++    +LRT R LR L+ IS   G+K +V ALI A+  + +V+++ +    +F++ G+Q F G    KC           L +NT            ++ L       A   P+  ECL+          +FD     FL+L+++ T + W  +    + S G            Y  +FV+ I +GSF+++NL + V+   +                                 + N +   ++ VF++ +  ++ +T  K  + +P    R PK +  +Q                                        + +++ F +L I + I LN + M +EHY  T  F  +L + N++FS IFT E ++K+  L  ++YF+  WN
Sbjct:  139 SPFHPIRRLAIKILVHSYPYAQSFAQVVLFIMCTILTNCCFMAM---SEPT--PWAKYLEYTFTGIYTFESLIKILARGFCVGPFTFLRDPWNWLDFSVIVMAYVTEF-------VDLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQAVKKLADVMILTVFCLSVFALIGLQLFMGNLRQKCVRTTAHCINGTLPTNTSFYYNYYKVEGAKDALICGNSSDAGKCPDGFECLKAGRNPNYGYTSFDTFGWAFLSLFRLMTQDYWENLYHQTLRSAG----------KTYMVFFVVVIFLGSFYLINLILAVVAMAYEEQNQATIAEACQKEKEFQLAMEILKKEQQAIYVINTHRCTFLAVFVSVTALHHDSTGPKKPSVEPDVYYRHPKLVSEIQSLNNLIESHKKCHPCWYVFAHQYLVWECSPCWLRLKQLVKIMVTDPFLDLAITVCIVLNTLFMAMEHYPMTEEFNGMLTIGNLVFSGIFTAEMVLKVIALDPYYYFQTGWN 627          
BLAST of Sodium channel protein vs. Ensembl Medaka
Match: scn12aa (sodium channel protein type 4 subunit alpha [Source:NCBI gene;Acc:101159774])

HSP 1 Score: 383.259 bits (983), Expect = 4.764e-108
Identity = 208/418 (49.76%), Postives = 282/418 (67.46%), Query Frame = 3
Query: 3021 CYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHT---WANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            C C   DI T  G  W   R     I EH  FE  I+  IL SS  L FEDIY++    +K  L   + +F+Y+F +EM LK I+ GFK YFT++W  LDF IV +SL+SL+ + LG+ ++  A +SLRT+RALRPLRA+SR++GM++VVNALI AIPSI NVLLVC++FWLIFSI GV  F GKF KC++  T    + T+V NKS+CL  N T   W    +NFDN   G+L+L Q+ATF+GWMEIM  A+DS G+  QP +E  +  Y YFV+FI+ GSFF LNLFIGVIIDNFN+ K K  G+  D+F+T  Q+ YYN MKKL ++KP+K + RP  ++Q FF+D+     F+++I++LI +NMV MM+E   Q+    ++L+ IN++F  IFT E ++KI  LR ++F   WN
Sbjct:  875 CQCCNIDISTGLGLAWWRLRKTCYQIVEHSWFETFIIFMILLSSGALAFEDIYIERRKVIKVILEYADKVFSYIFVLEMFLKWIAYGFKKYFTNYWCWLDFLIVDVSLISLVANSLGY-SDFAAIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFGKCVN-RTGFIHSITIVNNKSDCLAMNDTQFYWTTVKVNFDNVGLGYLSLLQVATFKGWMEIMNAAVDSRGVEEQPSREINLYMYIYFVVFIIFGSFFTLNLFIGVIIDNFNQQKRKISGH--DLFMTEEQKKYYNAMKKLGSKKPQKPIPRPANILQAFFFDLVSKQAFDIMIMMLIIVNMVTMMVETDEQSEQMESILNTINLVFIVIFTTECLIKIFALRCYFFTVAWN 1288          

HSP 2 Score: 283.493 bits (724), Expect = 1.218e-76
Identity = 156/347 (44.96%), Postives = 231/347 (66.57%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQPPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFKQMTENATLSSRHDSYYLQLNRQTLP 5430
            + + ++  F++PTL RV+R+ RIGRVLRLI+ AKGIR LLFAL++S+PALFNIG LL L++FIY+I GM+ F  +KK  G+DD+ NFETF  SI+ LF+++T+ GW+++L  +    P   + H +  G     + G+CG    GI +  ++I I +LI++NMYIAIILENF+ A  +    ++EDDFEMFY VWE++D  A+Q+I+++ LS F   L EPL I KPN I L+S DLP+V GD++HCLDIL A  K V+G   +S E   +K+QME K+    P+++    IT+T++RK E+++A  +QR ++    +R  KQ    A+   R  +Y   +N +  P
Sbjct: 1304 LADIIEKYFVSPTLFRVIRLARIGRVLRLIRAAKGIRTLLFALMMSMPALFNIGLLLFLVMFIYAIFGMANFAYVKKQDGIDDMFNFETFGNSIICLFQISTSAGWDNLLSPIMSNSPEECDIHFINTGTN---TRGNCGNPSMGIAFFVSYIIISFLIVVNMYIAIILENFSVATEESTEPLSEDDFEMFYEVWEKFDSEATQFIEFSMLSSFADALSEPLRIAKPNKIHLISMDLPMVSGDRIHCLDILFAFTKRVLG---ESGEMDTLKQQMEEKFMMTNPSKISHEPITSTLRRKLEEVSAIIIQRGYRRHLVRRQLKQ----ASYLYRQINYETTVNVENAP 1640          

HSP 3 Score: 265.003 bits (676), Expect = 6.399e-71
Identity = 162/396 (40.91%), Postives = 240/396 (60.61%), Query Frame = 3
Query:  267 EVEDFSDNCQPDPELVAGSILLEDKLGEFPEELLGKPLNEIDQ--NLKDKSFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLIS----------TNQIFDYFIMLTILVNCVFLALNNDYPI----SEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
            E +   +  +P  +L AG   L    G+ P EL+G PL +ID       K+FVV+N   K K I+R+S+T +  + +P+  IR +A+ I           T+ IF YFIM TIL NC F+A++ D P      EY F  IYT E  I++ +RG     +T+LRDP+N +D ++I+++Y+   ++        NVS+LRT RVLRALKTI+++PGLKTI  ALI+S+K L +V+IL++FC+S FAL  LQ++ G LR KCV+ +      S   +  FV  FY           ++G   L CG  S AG C    P+      +G NPN+ YT+FD FGWA L++F+L+T DYWE  ++  +R++G   ++F+++V+F GSFYL+NL+LAVV+M+Y
Sbjct:   38 EAQRGGEPLKPRADLEAGK-QLPRIFGDIPPELVGVPLEDIDPFYYRNQKTFVVLN---KGKAIFRFSSTSALYIFSPFHFIRSIAIKILVHSYPFSATITDSIF-YFIMFTILTNCFFMAMS-DPPTWTKYLEYTFTGIYTFESAIKIFARGFCTMPFTFLRDPWNWLDFIVIVMAYVTEFIDLG------NVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLADVMILTVFCLSVFALIGLQLFMGLLRQKCVRSLGHCINSSYIPNTTFVYNFY------KTEGAKDG---LICGYGSDAGKC----PDGFECLKVGRNPNYDYTSFDTFGWAFLALFRLMTQDYWEELFHQTLRSAGKTYMVFFVLVIFLGSFYLVNLILAVVAMAY 408          

HSP 4 Score: 202.986 bits (515), Expect = 7.968e-52
Identity = 95/223 (42.60%), Postives = 147/223 (65.92%), Query Frame = 3
Query: 1809 CSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEY-FNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQI----FGDNIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIR-ANSPLCLLIFI 2459
            C  W+  +  +   V DPF DL I+ CI +NT+ MA EHYP    ++ +L   N++FT I+  E  LK+ AL   Y F  GWNIFD V+V  S+++LG+  V+ LS+ R+FRL RVFKLA+SW T+  L+ II +++  +GNL++++ +++++FAV+G Q +   Y   +    F   +PRW+  DF+HS ++VFR++CGEWIE  +DC+  A  PLC+L+F+
Sbjct:  504 CPWWLKLKEWVKFMVMDPFLDLGITICIVLNTLFMALEHYPMTDEFNTMLSVGNLVFTGIFTAEMVLKLTALDPYYYFQQGWNIFDGVIVCLSLMELGLSNVEGLSVLRSFRLLRVFKLAKSWPTLNTLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKNYQDYVCKIAFDCQLPRWHMKDFFHSFLIVFRVLCGEWIETMWDCMEVAGQPLCILVFM 726          

HSP 5 Score: 92.4337 bits (228), Expect = 4.073e-18
Identity = 61/211 (28.91%), Postives = 110/211 (52.13%), Query Frame = 3
Query: 1830 QNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEV-----DALSIFRAFRLF---RVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIRANSP 2438
            Q   +  V+   FD+ I   I +N + M  E     +  + IL   N++F VI+  EC +KI AL   +F V WNIFDFVV+I SI+ + + ++      + ++FR  RL    RV +L ++ + +R LL  +  ++  + N+ +++ LV++++A+ G  ++          D    +NF+ F +S+I +F+I      +     I +NSP
Sbjct: 1214 QAFFFDLVSKQAFDIMIMMLIIVNMVTMMVETDEQSEQMESILNTINLVFIVIFTTECLIKIFALRCYFFTVAWNIFDFVVIILSIVGIVLADIIEKYFVSPTLFRVIRLARIGRVLRLIRAAKGIRTLLFALMMSMPALFNIGLLLFLVMFIYAIFGMANFAYVKKQDGIDD---MFNFETFGNSIICLFQISTSAGWDNLLSPIMSNSP 1421          

HSP 6 Score: 68.1662 bits (165), Expect = 1.057e-10
Identity = 55/211 (26.07%), Postives = 99/211 (46.92%), Query Frame = 3
Query: 1773 RNCQCC--IKQNVLCSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASE--HYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASII-----DLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILV 2375
            R+CQCC       L   W   +   Y  V   +F+ FI F I +++  +A E  +    K    IL+Y++ +F+ I+++E  LK +A   K+YF   W   DF++V  S+I      LG  +  A+   R  R  R  +    ++ MR+++  +   I  + N+ ++ L+   +F+++G   +        FG  + R     F HS+ +V
Sbjct:  873 RHCQCCNIDISTGLGLAWWRLRKTCYQIVEHSWFETFIIFMILLSSGALAFEDIYIERRKVIKVILEYADKVFSYIFVLEMFLKWIAYGFKKYFTNYWCWLDFLIVDVSLISLVANSLGYSDFAAIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGK-----FGKCVNR---TGFIHSITIV 1075          

HSP 7 Score: 64.3142 bits (155), Expect = 1.488e-9
Identity = 76/326 (23.31%), Postives = 134/326 (41.10%), Query Frame = 3
Query:  483 LCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDY--------PISEY---VFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNG-INYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGS----------WNILFYIIVVFFGSFYLINLMLAVV 1394
            L   W  +RK    I  +  F+ FI+  IL++   LA  + Y         I EY   VF  I+ LEM ++  + G       Y  + +  +D LI+ +S I ++       +   + SLRTLR LR L+ ++   G++ + +ALI ++  +  V+++ L     F++  + ++ G    KCV                                 R G I+ +T  N+ S  +C   N        +         NFDN G   LS+ Q+ T   W    N  + + G           +  +++++ + FGSF+ +NL + V+
Sbjct:  886 LGLAWWRLRKTCYQIVEHSWFETFIIFMILLSSGALAFEDIYIERRKVIKVILEYADKVFSYIFVLEMFLKWIAYGF----KKYFTNYWCWLDFLIVDVSLISLVANSLGYSDFAAIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKF-GKCVN--------------------------------RTGFIHSITIVNNKS--DCLAMNDTQFYWTTVK-------VNFDNVGLGYLSLLQVATFKGWMEIMNAAVDSRGVEEQPSREINLYMYIYFVVFIIFGSFFTLNLFIGVI 1165          

HSP 8 Score: 54.6842 bits (130), Expect = 1.286e-6
Identity = 51/214 (23.83%), Postives = 104/214 (48.60%), Query Frame = 3
Query:  459 YSATKSFLL--CAPW-SGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPISE----------YVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAF 1061
            YS  K +L+  C PW   +++    +  +   D  I + I++N +F+AL + YP+++           VF  I+T EMV+++T+    ++ Y Y +  +N+ D +I+ LS + + +    G     +S LR+ R+LR  K     P L T+   +  S+  L  + ++    +  FA+  +Q++    ++   K + +   +   H  +F ++F
Sbjct:  492 YSFAKRYLIWSCCPWWLKLKEWVKFMVMDPFLDLGITICIVLNTLFMALEH-YPMTDEFNTMLSVGNLVFTGIFTAEMVLKLTA----LDPYYYFQQGWNIFDGVIVCLSLMELGLSNVEG-----LSVLRSFRLLRVFKLAKSWPTLNTLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKNYQDYVCK-IAFDCQLPRWHMKDFFHSF 694          

HSP 9 Score: 53.1434 bits (126), Expect = 3.192e-6
Identity = 46/155 (29.68%), Postives = 73/155 (47.10%), Query Frame = 3
Query: 1851 VTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMA-----LSKEYFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTII---FSTITEMGNLSIIVLLVLYMFAVIGKQSY 2291
            +TD  F  FI F I  N   MA    P   TW   L+Y+   FT IY  E ++KI A     +   +    WN  DF+V++ +     V E   L    A R FRV +  ++   +  L TI+     ++ ++ ++ I+ +  L +FA+IG Q +
Sbjct:  133 ITDSIF-YFIMFTILTNCFFMAMSDPP---TWTKYLEYT---FTGIYTFESAIKIFARGFCTMPFTFLRDPWNWLDFIVIVMAY----VTEFIDLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLADVMILTVFCLSVFALIGLQLF 276          
BLAST of Sodium channel protein vs. Ensembl Medaka
Match: scn12aa (sodium channel protein type 4 subunit alpha [Source:NCBI gene;Acc:101159774])

HSP 1 Score: 384.03 bits (985), Expect = 6.528e-108
Identity = 208/418 (49.76%), Postives = 282/418 (67.46%), Query Frame = 3
Query: 3021 CYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHT---WANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            C C   DI T  G  W   R     I EH  FE  I+  IL SS  L FEDIY++    +K  L   + +F+Y+F +EM LK I+ GFK YFT++W  LDF IV +SL+SL+ + LG+ ++  A +SLRT+RALRPLRA+SR++GM++VVNALI AIPSI NVLLVC++FWLIFSI GV  F GKF KC++  T    + T+V NKS+CL  N T   W    +NFDN   G+L+L Q+ATF+GWMEIM  A+DS G+  QP +E  +  Y YFV+FI+ GSFF LNLFIGVIIDNFN+ K K  G+  D+F+T  Q+ YYN MKKL ++KP+K + RP  ++Q FF+D+     F+++I++LI +NMV MM+E   Q+    ++L+ IN++F  IFT E ++KI  LR ++F   WN
Sbjct: 1019 CQCCNIDISTGLGLAWWRLRKTCYQIVEHSWFETFIIFMILLSSGALAFEDIYIERRKVIKVILEYADKVFSYIFVLEMFLKWIAYGFKKYFTNYWCWLDFLIVDVSLISLVANSLGY-SDFAAIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFGKCVN-RTGFIHSITIVNNKSDCLAMNDTQFYWTTVKVNFDNVGLGYLSLLQVATFKGWMEIMNAAVDSRGVEEQPSREINLYMYIYFVVFIIFGSFFTLNLFIGVIIDNFNQQKRKLGGH--DLFMTEEQKKYYNAMKKLGSKKPQKPIPRPANILQAFFFDLVSKQAFDIMIMMLIIVNMVTMMVETDEQSEQMESILNTINLVFIVIFTTECLIKIFALRCYFFTVAWN 1432          

HSP 2 Score: 283.878 bits (725), Expect = 1.337e-76
Identity = 156/347 (44.96%), Postives = 231/347 (66.57%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQPPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFKQMTENATLSSRHDSYYLQLNRQTLP 5430
            + + ++  F++PTL RV+R+ RIGRVLRLI+ AKGIR LLFAL++S+PALFNIG LL L++FIY+I GM+ F  +KK  G+DD+ NFETF  SI+ LF+++T+ GW+++L  +    P   + H +  G     + G+CG    GI +  ++I I +LI++NMYIAIILENF+ A  +    ++EDDFEMFY VWE++D  A+Q+I+++ LS F   L EPL I KPN I L+S DLP+V GD++HCLDIL A  K V+G   +S E   +K+QME K+    P+++    IT+T++RK E+++A  +QR ++    +R  KQ    A+   R  +Y   +N +  P
Sbjct: 1448 LADIIEKYFVSPTLFRVIRLARIGRVLRLIRAAKGIRTLLFALMMSMPALFNIGLLLFLVMFIYAIFGMANFAYVKKQDGIDDMFNFETFGNSIICLFQISTSAGWDNLLSPIMSNSPEECDIHFINTGTN---TRGNCGNPSMGIAFFVSYIIISFLIVVNMYIAIILENFSVATEESTEPLSEDDFEMFYEVWEKFDSEATQFIEFSMLSSFADALSEPLRIAKPNKIHLISMDLPMVSGDRIHCLDILFAFTKRVLG---ESGEMDTLKQQMEEKFMMTNPSKISHEPITSTLRRKLEEVSAIIIQRGYRRHLVRRQLKQ----ASYLYRQINYETTVNVENAP 1784          

HSP 3 Score: 209.534 bits (532), Expect = 8.813e-54
Identity = 114/272 (41.91%), Postives = 174/272 (63.97%), Query Frame = 3
Query:  618 EYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINY---------LTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
             Y F  IYT E  I++ +RG     +T+LRDP+N +D ++I+++Y+   ++        NVS+LRT RVLRALKTI+++PGLKTI  ALI+S+K L +V+IL++FC+S FAL  LQ++ G LR KCV+ +    + S    N         W+ +P +++ N  N+         L CG  S AG C    P+      +G NPN+ YT+FD FGWA L++F+L+T DYWE  ++  +R++G   ++F+++V+F GSFYL+NL+LAVV+M+Y
Sbjct:   59 RYTFTGIYTFESAIKIFARGFCTMPFTFLRDPWNWLDFIVIVMAYVTEFIDLG------NVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLADVMILTVFCLSVFALIGLQLFMGLLRQKCVRSLG-HCINSSYIPNTTFVCNNRTWS-SPTDFLTNEDNFYKTEGAKDGLICGYGSDAGKC----PDGFECLKVGRNPNYDYTSFDTFGWAFLALFRLMTQDYWEELFHQTLRSAGKTYMVFFVLVIFLGSFYLVNLILAVVAMAY 318          

HSP 4 Score: 203.756 bits (517), Expect = 4.893e-52
Identity = 95/223 (42.60%), Postives = 147/223 (65.92%), Query Frame = 3
Query: 1809 CSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEY-FNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQI----FGDNIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIR-ANSPLCLLIFI 2459
            C  W+  +  +   V DPF DL I+ CI +NT+ MA EHYP    ++ +L   N++FT I+  E  LK+ AL   Y F  GWNIFD V+V  S+++LG+  V+ LS+ R+FRL RVFKLA+SW T+  L+ II +++  +GNL++++ +++++FAV+G Q +   Y   +    F   +PRW+  DF+HS ++VFR++CGEWIE  +DC+  A  PLC+L+F+
Sbjct:  610 CPWWLKLKEWVKFMVMDPFLDLGITICIVLNTLFMALEHYPMTDEFNTMLSVGNLVFTGIFTAEMVLKLTALDPYYYFQQGWNIFDGVIVCLSLMELGLSNVEGLSVLRSFRLLRVFKLAKSWPTLNTLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKNYQDYVCKIAFDCQLPRWHMKDFFHSFLIVFRVLCGEWIETMWDCMEVAGQPLCILVFM 832          

HSP 5 Score: 93.2041 bits (230), Expect = 2.623e-18
Identity = 61/211 (28.91%), Postives = 110/211 (52.13%), Query Frame = 3
Query: 1830 QNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEV-----DALSIFRAFRLF---RVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIRANSP 2438
            Q   +  V+   FD+ I   I +N + M  E     +  + IL   N++F VI+  EC +KI AL   +F V WNIFDFVV+I SI+ + + ++      + ++FR  RL    RV +L ++ + +R LL  +  ++  + N+ +++ LV++++A+ G  ++          D    +NF+ F +S+I +F+I      +     I +NSP
Sbjct: 1358 QAFFFDLVSKQAFDIMIMMLIIVNMVTMMVETDEQSEQMESILNTINLVFIVIFTTECLIKIFALRCYFFTVAWNIFDFVVIILSIVGIVLADIIEKYFVSPTLFRVIRLARIGRVLRLIRAAKGIRTLLFALMMSMPALFNIGLLLFLVMFIYAIFGMANFAYVKKQDGIDD---MFNFETFGNSIICLFQISTSAGWDNLLSPIMSNSP 1565          

HSP 6 Score: 68.5514 bits (166), Expect = 7.793e-11
Identity = 62/251 (24.70%), Postives = 110/251 (43.82%), Query Frame = 3
Query: 1671 EGKDCDNKAEYEDEVEIGNDTNNTDTAEMNPT------IDRNCQCC--IKQNVLCSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASE--HYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASII-----DLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILV 2375
            EG   D +   E+     +D +      M P         R+CQCC       L   W   +   Y  V   +F+ FI F I +++  +A E  +    K    IL+Y++ +F+ I+++E  LK +A   K+YF   W   DF++V  S+I      LG  +  A+   R  R  R  +    ++ MR+++  +   I  + N+ ++ L+   +F+++G   +        FG  + R     F HS+ +V
Sbjct:  981 EGSTVDLRKPGEE----ADDLSELSEDSMEPEDCFPQFCLRHCQCCNIDISTGLGLAWWRLRKTCYQIVEHSWFETFIIFMILLSSGALAFEDIYIERRKVIKVILEYADKVFSYIFVLEMFLKWIAYGFKKYFTNYWCWLDFLIVDVSLISLVANSLGYSDFAAIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGK-----FGKCVNR---TGFIHSITIV 1219          

HSP 7 Score: 68.1662 bits (165), Expect = 9.458e-11
Identity = 74/306 (24.18%), Postives = 126/306 (41.18%), Query Frame = 3
Query: 3135 CILASSICLCFEDIYLDNNPTLKQAL-------RVINYIFTYLFCIEMILKIISLGF-KVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFF-KCLDS-----------------NTRERLAAT----------------------------VVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVI 3890
            CIL   I LCF  ++L     L+ AL           Y FT ++  E  +KI + GF  + FT      ++    + +++ + + +  G       +LRT R LR L+ IS   G+K +V ALI ++  + +V+++ +    +F++ G+Q F G    KC+ S                 N R   + T                              P+  ECL+          +FD     FLAL+++ T + W E+    + S G            Y  +FV+ I +GSF+++NL + V+
Sbjct:   24 CILEFVISLCF-CLFLKTEICLRAALMGCILSRHAYRYTFTGIYTFESAIKIFARGFCTMPFTFLRDPWNWLDFIVIVMAYVTEFIDLGN----VSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLADVMILTVFCLSVFALIGLQLFMGLLRQKCVRSLGHCINSSYIPNTTFVCNNRTWSSPTDFLTNEDNFYKTEGAKDGLICGYGSDAGKCPDGFECLKVGRNPNYDYTSFDTFGWAFLALFRLMTQDYWEELFHQTLRSAG----------KTYMVFFVLVIFLGSFYLVNLILAVV 314          

HSP 8 Score: 64.3142 bits (155), Expect = 1.522e-9
Identity = 76/326 (23.31%), Postives = 134/326 (41.10%), Query Frame = 3
Query:  483 LCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDY--------PISEY---VFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNG-INYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGS----------WNILFYIIVVFFGSFYLINLMLAVV 1394
            L   W  +RK    I  +  F+ FI+  IL++   LA  + Y         I EY   VF  I+ LEM ++  + G       Y  + +  +D LI+ +S I ++       +   + SLRTLR LR L+ ++   G++ + +ALI ++  +  V+++ L     F++  + ++ G    KCV                                 R G I+ +T  N+ S  +C   N        +         NFDN G   LS+ Q+ T   W    N  + + G           +  +++++ + FGSF+ +NL + V+
Sbjct: 1030 LGLAWWRLRKTCYQIVEHSWFETFIIFMILLSSGALAFEDIYIERRKVIKVILEYADKVFSYIFVLEMFLKWIAYGF----KKYFTNYWCWLDFLIVDVSLISLVANSLGYSDFAAIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKF-GKCVN--------------------------------RTGFIHSITIVNNKS--DCLAMNDTQFYWTTVK-------VNFDNVGLGYLSLLQVATFKGWMEIMNAAVDSRGVEEQPSREINLYMYIYFVVFIIFGSFFTLNLFIGVI 1309          

HSP 9 Score: 54.6842 bits (130), Expect = 1.156e-6
Identity = 53/228 (23.25%), Postives = 107/228 (46.93%), Query Frame = 3
Query:  459 YSATKSFLL--CAPW-SGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPISE----------YVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRN 1103
            YS  K +L+  C PW   +++    +  +   D  I + I++N +F+AL + YP+++           VF  I+T EMV+++T+    ++ Y Y +  +N+ D +I+ LS + + +    G     +S LR+ R+LR  K     P L T+   +  S+  L  + ++    +  FA+  +Q++    ++   K + +   +   H  +F ++F   +      WI  
Sbjct:  598 YSFAKRYLIWSCCPWWLKLKEWVKFMVMDPFLDLGITICIVLNTLFMALEH-YPMTDEFNTMLSVGNLVFTGIFTAEMVLKLTA----LDPYYYFQQGWNIFDGVIVCLSLMELGLSNVEG-----LSVLRSFRLLRVFKLAKSWPTLNTLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKNYQDYVCK-IAFDCQLPRWHMKDFFHSFLIVFRVLCGEWIET 814          
BLAST of Sodium channel protein vs. Ensembl Medaka
Match: scn8aa (sodium channel protein type 8 subunit alpha [Source:NCBI gene;Acc:101168288])

HSP 1 Score: 373.629 bits (958), Expect = 1.099e-104
Identity = 205/419 (48.93%), Postives = 278/419 (66.35%), Query Frame = 3
Query: 3027 CIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSEC---LRQNHT---WANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            C   DI    G  W   R    LI EH  FE  I+  IL SS  L FED+Y++   T+K  L   + +FTY+F +EM+LK ++ GF  YFT+ W  LDFFIV +S++SL+ + LG+ +++   +SLRT+RALRPLRA+SR++GM++VVNAL+ AIPSI NVLLVC++FWLIFSI GV  F GK+  C +  + E L   +V NKS+C   + +N+T   W N  INFDN   G+LAL Q+ATF+GWM+IM  A+DS G+  QPK E  +  Y YFV+FI+ GSFF LNLFIGVIIDNFN+ K K+ G   D+F+T  Q+ YYN MKKL ++KP+K + RP+  +QG  +D      F++ I+ILI LNMV MM+E   Q+    NVL  +N +F  +FT E ++K+  LR +YF   WN
Sbjct: 1007 CCDVDITIGWGKTWWFLRKTCYLIVEHNWFETMIIFMILLSSGALAFEDVYVEQRKTIKIILEYADRVFTYIFILEMLLKWVAYGFVKYFTNAWCWLDFFIVDVSIVSLVANALGY-SDLGPIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNMFAGKYGYCFNDTSEEYLDIEIVNNKSQCIGVMEENNTDIRWRNVKINFDNVGAGYLALLQVATFKGWMDIMYAAVDSRGVEQQPKYEINIYMYIYFVVFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQ--DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPQNKIQGMVFDFVTQQVFDISIMILICLNMVTMMVETDDQSDETENVLYWVNFIFIVVFTTEFLLKLFALRHYYFTNGWN 1422          

HSP 2 Score: 287.345 bits (734), Expect = 1.036e-77
Identity = 154/313 (49.20%), Postives = 220/313 (70.29%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQPPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWK 5328
            + + ++  F++PTL RV+R+ RIGR+LRLIK AKGIR LLFAL++SLPALFNIG LL L++FI+SI GMS FG +K + G+DD+ NFETF  S+++LF +TT+ GW+ +L  +   PP C + ++   G       GDCG    GI +   +I I +LI++NMYIAIILENF+ A  +    ++EDDFE FY +WE++DP ASQ+I +A LSDF   L+ PL +PKPN I L++ D+P+V GD++HCLDIL A  K V+G   DS E   ++ QME ++    P++V    ITTT++RK+ED++AK +Q A++
Sbjct: 1438 LADLIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIFSIFGMSNFGYVKHSAGIDDMYNFETFGNSMIILFMITTSAGWDGLLLPILNYPPDC-DPNLENPG---TTVKGDCGNPSVGIFFFVMYIIISFLIVVNMYIAIILENFSVATEESADPLSEDDFETFYEIWEKFDPTASQFITFAKLSDFADALEHPLRVPKPNTIELIAMDMPMVSGDRIHCLDILFAFTKRVLG---DSGELDMLRGQMEERFVAANPSKVSYEPITTTLRRKQEDVSAKIIQNAYR 1743          

HSP 3 Score: 243.047 bits (619), Expect = 4.838e-64
Identity = 131/290 (45.17%), Postives = 195/290 (67.24%), Query Frame = 3
Query:  555 IMLTILVNCVFLALNNDYPIS---EYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYN-WTHNPNNW--IRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSY 1406
            IM TIL NC+F+  ++    S   EY F  IYT E ++++T+RG  I+ +T+LRDP+N +D ++I ++YI   V+        NVS+LRT RVLRALKTI+++PGLKTI  ALI+S+K L +V+IL++FC+S FAL  LQ++ G LR KCV    W   ++E + N     F ++ + +N  N+  +   ++ L CGN S +G C    P        G NPN+GYT+FD+FGWA L++F+L+T D+WEN Y L +RA+G   ++F+++V+F GSFYL+NL+LAVV+M+Y
Sbjct:    3 IMCTILTNCIFMTFSDPPEWSKQVEYTFTGIYTFESLVKITARGFCIDDFTFLRDPWNWLDFMVISMAYITEFVDLG------NVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRQKCVF---WPINLNETYLNNGSKGFDWDEYINNDTNFYKLHGQLDPLLCGNSSDSGRC----PEGYTCMKAGRNPNYGYTSFDSFGWAFLALFRLMTQDFWENLYMLTLRAAGKTYMIFFVLVIFVGSFYLVNLILAVVAMAY 279          

HSP 4 Score: 193.741 bits (491), Expect = 6.550e-49
Identity = 88/223 (39.46%), Postives = 149/223 (66.82%), Query Frame = 3
Query: 1809 CSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEY-FNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDN----IPRWNFDDFWHSMILVFRIICGEWIEPSFDCIR-ANSPLCLLIFI 2459
            C  W+  +  + + V DPF DL I+ CI +NT+ MA EHYP    ++++L   N++FT I+  E  LK++A+   Y F   WN FD  +V  S+++L + +V+ LS+ R+FRL RVFKLA+SW T+ +L+ II +++  +GNL++++ +++++FAV+G Q +  +Y   +   N    +PRW+ +DF+HS ++VFR++CGEWIE  +DC+  A   +CL++F+
Sbjct:  571 CPLWIKIKEIVNLIVMDPFVDLAITICIVLNTLFMAMEHYPMTTDFENMLSVGNLVFTGIFAGEMFLKLVAMDPYYYFQEAWNCFDGFIVTLSLVELALADVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKDCVCKINENCVLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMCLIVFM 793          

HSP 5 Score: 93.9745 bits (232), Expect = 1.548e-18
Identity = 61/193 (31.61%), Postives = 104/193 (53.89%), Query Frame = 3
Query: 1830 QNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASII-----DLGVEEVDALSIFRAFRLF---RVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRI 2384
            Q  ++ FVT   FD+ I   I +N + M  E        +++L + N IF V++  E  LK+ AL   YF  GWNIFD VVVI SI+     DL  +   + ++FR  RL    R+ +L +  + +R LL  +  ++  + N+ +++ LV+++F++ G  ++    H+    D    +NF+ F +SMI++F I
Sbjct: 1348 QGMVFDFVTQQVFDISIMILICLNMVTMMVETDDQSDETENVLYWVNFIFIVVFTTEFLLKLFALRHYYFTNGWNIFDVVVVILSIVGMFLADLIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIFSIFGMSNFGYVKHSAGIDD---MYNFETFGNSMIILFMI 1537          

HSP 6 Score: 63.1586 bits (152), Expect = 3.183e-9
Identity = 43/170 (25.29%), Postives = 82/170 (48.24%), Query Frame = 3
Query: 1818 WVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASE--HYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIID-----LGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTY 2303
            W   +   Y+ V   +F+  I F I +++  +A E  +    KT   IL+Y++ +FT I+I+E  LK +A    +YF   W   DF +V  SI+      LG  ++  +   R  R  R  +    ++ MR+++  +   I  + N+ ++ L+   +F+++G   +   Y
Sbjct: 1020 WWFLRKTCYLIVEHNWFETMIIFMILLSSGALAFEDVYVEQRKTIKIILEYADRVFTYIFILEMLLKWVAYGFVKYFTNAWCWLDFFIVDVSIVSLVANALGYSDLGPIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNMFAGKY 1189          

HSP 7 Score: 63.1586 bits (152), Expect = 3.735e-9
Identity = 64/279 (22.94%), Postives = 127/279 (45.52%), Query Frame = 3
Query: 3105 HRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTX--XXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIM----------QDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFN 3905
             + F+ +I++ I  + + +  E    D +   +  L  +N+IF  +F  E +LK+ +L    YFT+ W I  +   I+SI  + L + I  +    T FR +R  R  R LR I   +G++ ++ AL+ ++P++FN+ L+  +   IFSI G+  F                             ++    +   NF+   N  + L+ I T  GW  ++             +++ G  ++    N      +FV++I++    ++N++I +I++NF+
Sbjct: 1357 QQVFDISIMILICLNMVTMMVETD--DQSDETENVLYWVNFIFIVVFTTEFLLKLFALR-HYYFTNGWNIFDVVVVILSIVGMFLADLIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIFSIFGMSNFG--------------------------YVKHSAGIDDMYNFETFGNSMIILFMITTSAGWDGLLLPILNYPPDCDPNLENPGTTVKGDCGNPSVGIFFFVMYIIISFLIVVNMYIAIILENFS 1606          

HSP 8 Score: 59.3066 bits (142), Expect = 4.364e-8
Identity = 72/325 (22.15%), Postives = 138/325 (42.46%), Query Frame = 3
Query:  495 WSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYP--------ISEY---VFLAIYTLEMVIRMTSRGVI---INSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVN-VSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGS----------WNILFYIIVVFFGSFYLINLMLAVV 1394
            W  +RK   LI  +  F+  I+  IL++   LA  + Y         I EY   VF  I+ LEM+++  + G +    N++ +L   + +VD+ I+ L      V    G +++  + SLRTLR LR L+ ++   G++ + +AL+ ++  +  V+   L C+ F+ +F++                             VN F   + +  N+     ++     N S      + N   I   ++         NFDN G   L++ Q+ T   W +     + + G           +  +++++ + FGSF+ +NL + V+
Sbjct: 1020 WWFLRKTCYLIVEHNWFETMIIFMILLSSGALAFEDVYVEQRKTIKIILEYADRVFTYIFILEMLLKWVAYGFVKYFTNAWCWLD--FFIVDVSIVSL------VANALGYSDLGPIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIMNVL---LVCLIFWLIFSIM---------------------------GVNMFAGKYGYCFNDTSEEYLDIEIVNNKSQCIGVMEENNTDIRWRNVK-------INFDNVGAGYLALLQVATFKGWMDIMYAAVDSRGVEQQPKYEINIYMYIYFVVFIIFGSFFTLNLFIGVI 1299          
BLAST of Sodium channel protein vs. Planmine SMEST
Match: SMESG000075430.1 (SMESG000075430.1)

HSP 1 Score: 2000.71 bits (5182), Expect = 0.000e+0
Identity = 1130/1134 (99.65%), Postives = 1133/1134 (99.91%), Query Frame = 3
Query:   72 MSEPGISVIANTMLMKSNNKQENYRLFTESGYXXXXXXXXXXXXXXXXXHRHIDEGKLVDGELKFEVEDFSDNCQPDPELVAGSILLEDKLGEFPEELLGKPLNEIDQNLKDKSFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPISEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDXXXXXXXXXXXXVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHDKDQMKDLKITNGMSDADSSLCKNTTSIHENDDNFRFMDSEEEKEGKDCDNKAEYEDEVEIGNDTNNTDTAEMNPTIDRNCQCCIKQNVLCSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIRANSPLCLLIFIPTXXXXXXXXXXXXXXXXXXXXXXXXXKNTADEDVSKLKIVIERLRNIYPMSRNNPLGINKGNQELDSTETLKDIVVNFGCENAAELQNNHEKMRIIKNCKDLSTSNELVNLLPSTGSLSKGNKLINNAIXXXXXXXXXXGKHLXXXXXXXXXXXXXXIDEESVNELKGCCCAICYNPFQEKKPFHCCYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVN 3473
            MSEPGISVIANTMLMKSNNKQENYRLFTESGYEKILEEKRIKRLKEIERHRHIDEGKLVDGELKFEVEDFSDNCQPDPELVAGSILLEDKLGEFPEELLGKPLNEIDQNLKDKSFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPISEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDILIIILSYIMIIVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSYEEEAEAQSRENEEQKNRKIKANKRKKKLNKKSSISTKISIKTTHDKDQMKDLKITNGMSDADSSLCKNTTSIHENDDNFRFMDSEEEKEGKDCDNKAEYEDEVEIGNDTNNTDTAEMNPTIDRNCQCCIKQNVLCSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIRANSPLCLLIFIPTLVLGNFVVLNLFLALLLNSFASDSLKNTADEDVSKLKIVIERLRNIYPMSRNNPLGINKGNQELDSTETLKDIVVNFGCENAAELQNNHEKMRIIKNCKDLSTSNELVNLLPSTGSLSKGNKLINNAIDETDTDEKDKGKHLNNEEKTKVEKENENIDEESVNELKGCCCAICYNPFQEKKPFHCCYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTILDFFIVSISLLSLINDILGFGTEMTAFRSLRTMRALRPLRAISRWQGMK+ ++
Sbjct:    1 MSEPGISVIANTMLMKSNNKQENYRLFTESGYEKILEEKRIKRLKEIERHRHIDEGKLVDGELKFEVEDFSDNCQPDPELVAGSILLEDKLGEFPEELLGKPLNEIDQNLKDKSFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLALLISTNQIFDYFIMLTILVNCVFLALNNDYPISEYVFLAIYTLEMVIRMTSRGVIINSYTYLRDPYNLVDILIIILSYIMIIVEKCYGQNNVNVSSLRTLRVLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIYQGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLTCGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITLDYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSYEEEAEAQSRENEEQKNRKIKANKRKKKLNKKSSISTKISIKTTHDKDQMKDLKITNGMSDADSSLCKNTTSIHENDDNFRFMDSEEEKEGKDCDNKAEYEDEVEIGNDTNNTDTAEMNPTIDRNCQCCIKQNVLCSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIRANSPLCLLIFIPTLVLGNFVVLNLFLALLLNSFASDSLKNTADEDVSKLKIVIERLRNIYPMSRNNPLGINKGNQELDSTETLKDIVVNFGCENAAELQNNHEKMRIIKNCKDLSTSNELVNLLPSTGSLSKGNKLINNAIDETDTDEKDKGKHLNNEEKTKVEKENENIDEESVNELKGCCCAICYNPFQEKKPFHCCYCIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTILDFFIVSISLLSLINDILGFGTEMTAFRSLRTMRALRPLRAISRWQGMKVCIH 1134          

HSP 2 Score: 51.6026 bits (122), Expect = 6.914e-6
Identity = 64/280 (22.86%), Postives = 118/280 (42.14%), Query Frame = 3
Query: 3027 CIVCDIETPCGSRWHAFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVINYIFTYLFCIEMILKIISLGFKVYFTSFWTXXXXXXXXXXXXXXXXXXXGFGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFI 3866
            C  C  +    S+W AF+NR  +      F+  I  CI  ++I +  E  +  +  T    L+  N IFT ++ IE  LKI++L  K YF   W I DF +V  S++ L         E+ A    R  R  R  +    WQ M++++  +   I  + N+ ++ ++   +F++ G Q ++  +          ++    +P           W     NFD+  +  + +++I   E W+E   D I          + N       F+  +++G+F +
Sbjct:  570 CQCCIKQNVLCSKWVAFQNRLYIFVTDPFFDLFISFCIFINTIIMASE--HYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALS-KEYFNVGWNIFDFVVVIASIIDLGV------EEVDALSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTY--------HTQIFGDNIPR----------W-----NFDDFWHSMILVFRIICGE-WIEPSFDCI----------RANSPLCLLIFIPTLVLGNFVV 806          
BLAST of Sodium channel protein vs. Planmine SMEST
Match: SMESG000075431.1 (SMESG000075431.1)

HSP 1 Score: 704.131 bits (1816), Expect = 0.000e+0
Identity = 372/372 (100.00%), Postives = 372/372 (100.00%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQPPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFKQMTENATLSSRHDSYYLQLNRQTLPCPVXXXXXXXXXXXPFLKIPHLFEQ 5505
            MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQPPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTFIFICYLIIINMYIAIILENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFKQMTENATLSSRHDSYYLQLNRQTLPCPVGQSSGSNSSSQPFLKIPHLFEQ
Sbjct:  377 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQPPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTFIFICYLIIINMYIAIILENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFKQMTENATLSSRHDSYYLQLNRQTLPCPVGQSSGSNSSSQPFLKIPHLFEQ 748          

HSP 2 Score: 563.533 bits (1451), Expect = 0.000e+0
Identity = 295/313 (94.25%), Postives = 302/313 (96.49%), Query Frame = 3
Query: 3405 RTMRALRPLRAISRWQGMKIV-VNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWNXXXXXXXXXXXXXXXXNMFRSFSDS 4340
            R++R L  L    + +G ++  +NALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWNIFDFIIVLLSIIDLVINMFRSFSDS
Sbjct:   61 RSIRTLDKLTEQLKNEGFQLSRINALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWNIFDFIIVLLSIIDLVINMFRSFSDS 373          

HSP 3 Score: 98.2117 bits (243), Expect = 2.960e-20
Identity = 61/200 (30.50%), Postives = 106/200 (53.00%), Query Frame = 3
Query: 1866 FDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASIIDLGV--------------EEVDA-------LSIFRAFRLFRVFKLAQSWQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFGDNIPRWNFDDFWHSMILVFRI-ICGEW 2399
            F+L I   IF+N ++M  EHY     + ++L   NI+F+ I+ +E  +KI  L   YF   WNIFDF++V+ SIIDL +              E + A       L + R FR+ RV +L +  + +R LL  +  ++  + N+  ++LL++++++++G   + N   T    D +   NF+ F  S++L+FR+   G W
Sbjct:  286 FELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWNIFDFIIVLLSIIDLVINMFRSFSDSVLFMEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLV---NFETFERSILLLFRLTTAGGW 482          
BLAST of Sodium channel protein vs. Planmine SMEST
Match: SMESG000075431.1 (SMESG000075431.1)

HSP 1 Score: 702.975 bits (1813), Expect = 0.000e+0
Identity = 372/372 (100.00%), Postives = 372/372 (100.00%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQPPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFKQMTENATLSSRHDSYYLQLNRQTLPCPVXXXXXXXXXXXPFLKIPHLFEQ 5505
            MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQPPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTFIFICYLIIINMYIAIILENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFKQMTENATLSSRHDSYYLQLNRQTLPCPVGQSSGSNSSSQPFLKIPHLFEQ
Sbjct:  504 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQPPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTFIFICYLIIINMYIAIILENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFKQMTENATLSSRHDSYYLQLNRQTLPCPVGQSSGSNSSSQPFLKIPHLFEQ 875          

HSP 2 Score: 550.051 bits (1416), Expect = 1.321e-173
Identity = 270/288 (93.75%), Postives = 277/288 (96.18%), Query Frame = 3
Query: 3405 RTMRALRPLRAISRWQGMKIV-VNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            R++R L  L    + +G ++  +NALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN
Sbjct:   61 RSIRTLDKLTEQLKNEGFQLSRINALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 348          

HSP 3 Score: 64.6994 bits (156), Expect = 6.812e-10
Identity = 31/75 (41.33%), Postives = 46/75 (61.33%), Query Frame = 3
Query: 1866 FDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASII 2090
            F+L I   IF+N ++M  EHY     + ++L   NI+F+ I+ +E  +KI  L   YF   WNIFDF++V+ SII
Sbjct:  286 FELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWNIFDFIIVLLSII 360          
BLAST of Sodium channel protein vs. Planmine SMEST
Match: SMESG000075431.1 (SMESG000075431.1)

HSP 1 Score: 702.975 bits (1813), Expect = 0.000e+0
Identity = 372/372 (100.00%), Postives = 372/372 (100.00%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQPPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFKQMTENATLSSRHDSYYLQLNRQTLPCPVXXXXXXXXXXXPFLKIPHLFEQ 5505
            MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQPPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTFIFICYLIIINMYIAIILENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFKQMTENATLSSRHDSYYLQLNRQTLPCPVGQSSGSNSSSQPFLKIPHLFEQ
Sbjct:  486 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQPPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTFIFICYLIIINMYIAIILENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFKQMTENATLSSRHDSYYLQLNRQTLPCPVGQSSGSNSSSQPFLKIPHLFEQ 857          

HSP 2 Score: 550.821 bits (1418), Expect = 4.359e-174
Identity = 272/291 (93.47%), Postives = 277/291 (95.19%), Query Frame = 3
Query: 3393 FRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            +RS+RT+  L         + +K  VNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN
Sbjct:   60 YRSIRTLDKLT--------EQLKNEVNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 342          

HSP 3 Score: 64.6994 bits (156), Expect = 7.042e-10
Identity = 31/75 (41.33%), Postives = 46/75 (61.33%), Query Frame = 3
Query: 1866 FDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASII 2090
            F+L I   IF+N ++M  EHY     + ++L   NI+F+ I+ +E  +KI  L   YF   WNIFDF++V+ SII
Sbjct:  280 FELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWNIFDFIIVLLSII 354          
BLAST of Sodium channel protein vs. Planmine SMEST
Match: SMESG000075431.1 (SMESG000075431.1)

HSP 1 Score: 702.975 bits (1813), Expect = 0.000e+0
Identity = 372/372 (100.00%), Postives = 372/372 (100.00%), Query Frame = 1
Query: 4390 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQPPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTXXXXXXXXXXXXXXXXXXENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFKQMTENATLSSRHDSYYLQLNRQTLPCPVXXXXXXXXXXXPFLKIPHLFEQ 5505
            MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQPPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTFIFICYLIIINMYIAIILENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFKQMTENATLSSRHDSYYLQLNRQTLPCPVGQSSGSNSSSQPFLKIPHLFEQ
Sbjct:  515 MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPALFNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRLTTAGGWNDILEAMFIQPPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMTTFIFICYLIIINMYIAIILENFNQAHAQEEVGITEDDFEMFYLVWERYDPHASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDILIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKKEDIAAKTLQRAWKHVKAQRAFKQMTENATLSSRHDSYYLQLNRQTLPCPVGQSSGSNSSSQPFLKIPHLFEQ 886          

HSP 2 Score: 546.969 bits (1408), Expect = 2.984e-172
Identity = 265/266 (99.62%), Postives = 266/266 (100.00%), Query Frame = 3
Query: 3468 VNALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 4265
            +NALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN
Sbjct:   94 INALIYAIPSIFNVLLVCIVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWANSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAYYAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNYYNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWN 359          

HSP 3 Score: 64.6994 bits (156), Expect = 6.565e-10
Identity = 31/75 (41.33%), Postives = 46/75 (61.33%), Query Frame = 3
Query: 1866 FDLFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMALSKEYFNVGWNIFDFVVVIASII 2090
            F+L I   IF+N ++M  EHY     + ++L   NI+F+ I+ +E  +KI  L   YF   WNIFDF++V+ SII
Sbjct:  297 FELVIVILIFLNMVVMMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWNIFDFIIVLLSII 371          
The following BLAST results are available for this feature:
BLAST of Sodium channel protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SCN2A5.801e-10948.11sodium voltage-gated channel alpha subunit 2 [Sour... [more]
SCN2A5.801e-10948.11sodium voltage-gated channel alpha subunit 2 [Sour... [more]
SCN2A5.801e-10948.11sodium voltage-gated channel alpha subunit 2 [Sour... [more]
SCN2A5.977e-10948.11sodium voltage-gated channel alpha subunit 2 [Sour... [more]
SCN2A6.010e-10948.11sodium voltage-gated channel alpha subunit 2 [Sour... [more]
back to top
BLAST of Sodium channel protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egl-191.843e-4930.90Voltage-dependent L-type calcium channel subunit a... [more]
egl-192.106e-4930.90Voltage-dependent L-type calcium channel subunit a... [more]
cca-11.276e-3930.75Voltage-dependent T-type calcium channel subunit a... [more]
cca-11.276e-3930.75Voltage-dependent T-type calcium channel subunit a... [more]
cca-11.276e-3930.75Voltage-dependent T-type calcium channel subunit a... [more]
back to top
BLAST of Sodium channel protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
para7.083e-16838.86gene:FBgn0285944 transcript:FBtr0303681[more]
para5.083e-16638.51gene:FBgn0285944 transcript:FBtr0303661[more]
para5.971e-16638.51gene:FBgn0285944 transcript:FBtr0303660[more]
para5.972e-16638.51gene:FBgn0285944 transcript:FBtr0303656[more]
para6.217e-16638.51gene:FBgn0285944 transcript:FBtr0303662[more]
back to top
BLAST of Sodium channel protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scn1laa1.394e-15838.15sodium channel, voltage-gated, type I-like, alpha ... [more]
scn1laa1.394e-15838.15sodium channel, voltage-gated, type I-like, alpha ... [more]
scn4aa9.204e-13436.22sodium channel, voltage-gated, type IV, alpha, a [... [more]
scn4ab7.823e-13337.18sodium channel, voltage-gated, type IV, alpha, b [... [more]
scn4ab8.089e-13337.05sodium channel, voltage-gated, type IV, alpha, b [... [more]
back to top
BLAST of Sodium channel protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SCN4A1.444e-13437.33sodium channel, voltage gated, type IV alpha subun... [more]
ENSXETT00000052002.15.094e-10848.88sodium channel, voltage gated, type I alpha subuni... [more]
ENSXETT00000051997.16.533e-10848.88sodium channel, voltage gated, type I alpha subuni... [more]
ENSXETT00000051931.17.530e-10848.88sodium channel, voltage gated, type I alpha subuni... [more]
ENSXETT00000052025.17.987e-10848.88sodium channel, voltage gated, type I alpha subuni... [more]
back to top
BLAST of Sodium channel protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Scn4a5.657e-8136.66sodium channel, voltage-gated, type IV, alpha [Sou... [more]
Scn2a4.350e-10848.55sodium channel, voltage-gated, type II, alpha [Sou... [more]
Scn2a4.389e-10848.55sodium channel, voltage-gated, type II, alpha [Sou... [more]
Scn2a4.389e-10848.55sodium channel, voltage-gated, type II, alpha [Sou... [more]
Scn1a2.546e-10747.22sodium channel, voltage-gated, type I, alpha [Sour... [more]
back to top
BLAST of Sodium channel protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P15390|SCN4A_RAT2.686e-8036.83Sodium channel protein type 4 subunit alpha OS=Rat... [more]
sp|Q9ER60|SCN4A_MOUSE3.890e-8036.66Sodium channel protein type 4 subunit alpha OS=Mus... [more]
sp|Q2XVR6|SC4AB_TAKRU2.119e-15841.53Sodium channel protein type 4 subunit alpha B OS=T... [more]
sp|Q2XVR3|SC4AA_DANRE6.506e-13336.22Sodium channel protein type 4 subunit alpha A OS=D... [more]
sp|Q20JQ7|SC4AB_DANRE5.062e-13237.05Sodium channel protein type 4 subunit alpha B OS=D... [more]
back to top
BLAST of Sodium channel protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2Y9DGL01.632e-7737.11Sodium channel protein OS=Trichechus manatus latir... [more]
V4BZG27.135e-10646.04Sodium channel protein OS=Lottia gigantea OX=22516... [more]
K1PYF78.145e-11245.88Sodium channel protein OS=Crassostrea gigas OX=291... [more]
A0A177B2L21.628e-10247.07Sodium channel protein OS=Intoshia linei OX=181974... [more]
B4QCM12.446e-9947.74Sodium channel protein (Fragment) OS=Drosophila si... [more]
back to top
BLAST of Sodium channel protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000044886.13.958e-12035.56sodium channel protein type 4 subunit alpha B-like... [more]
ENSAMXT00000006401.22.425e-11835.30sodium channel protein type 4 subunit alpha B-like... [more]
ENSAMXT00000051500.13.833e-11433.99sodium channel protein type 4 subunit alpha B-like... [more]
ENSAMXT00000006399.24.573e-10848.96sodium channel protein type 4 subunit alpha B-like... [more]
scn1lab2.399e-10749.76sodium channel, voltage-gated, type I like, alpha ... [more]
back to top
BLAST of Sodium channel protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008004.17.930e-9744.31pep scaffold:Pmarinus_7.0:GL477228:88466:118438:1 ... [more]
ENSPMAT00000002303.11.604e-7743.42pep scaffold:Pmarinus_7.0:GL476946:177796:226078:1... [more]
ENSPMAT00000007955.12.235e-7646.32pep scaffold:Pmarinus_7.0:GL476358:329878:417380:1... [more]
ENSPMAT00000002291.13.963e-7547.74pep scaffold:Pmarinus_7.0:GL476946:177790:226078:1... [more]
ENSPMAT00000000617.11.535e-7341.76pep scaffold:Pmarinus_7.0:GL477322:572:57208:-1 ge... [more]
back to top
BLAST of Sodium channel protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
CCH11.138e-1421.74Voltage-gated high-affinity calcium channel; invol... [more]
back to top
BLAST of Sodium channel protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO356611.049e-12351.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO467972.276e-11033.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO469917.832e-5725.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO368447.972e-5332.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO279982.205e-3949.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Sodium channel protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000035153.11.549e-14540.26sodium channel protein type 2 subunit alpha [Sourc... [more]
ENSORLT00000035706.14.448e-12536.48sodium channel protein type 4 subunit alpha B [Sou... [more]
scn12aa4.764e-10849.76sodium channel protein type 4 subunit alpha [Sourc... [more]
scn12aa6.528e-10849.76sodium channel protein type 4 subunit alpha [Sourc... [more]
scn8aa1.099e-10448.93sodium channel protein type 8 subunit alpha [Sourc... [more]
back to top
BLAST of Sodium channel protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000075430.16.914e-699.65SMESG000075430.1[more]
SMESG000075431.12.960e-20100.00SMESG000075431.1[more]
SMESG000075431.11.321e-173100.00SMESG000075431.1[more]
SMESG000075431.14.359e-174100.00SMESG000075431.1[more]
SMESG000075431.12.984e-172100.00SMESG000075431.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035715 ID=SMED30035715|Name=Sodium channel protein|organism=Schmidtea mediterranea sexual|type=transcript|length=5514bp
CTTTATGAGAATTTCTCATACTATTTTATGAAAGTTCTTTTTCTTTGAGA
ATTCAGTTCAATATTTTTACAATGTCCGAGCCAGGAATCTCTGTAATTGC
CAATACAATGCTGATGAAGTCGAATAACAAACAAGAAAATTATAGGCTAT
TTACTGAATCTGGATATGAGAAAATTTTAGAAGAAAAGAGAATCAAACGG
TTGAAAGAAATCGAAAGACATAGGCACATTGATGAAGGAAAATTAGTTGA
CGGGGAATTGAAATTCGAAGTGGAAGATTTCAGTGATAACTGCCAACCGG
ATCCAGAACTGGTAGCCGGCTCGATTTTGTTAGAGGATAAATTAGGGGAA
TTTCCTGAAGAACTGTTGGGAAAGCCTCTCAATGAGATAGATCAAAATCT
AAAAGACAAATCATTTGTGGTCATCAACACCAGATTCAAAATCAAATACA
TTTACCGGTACTCAGCCACCAAATCATTCCTCCTATGCGCTCCATGGAGT
GGCATCAGAAAACTTGCATTACTGATCTCTACTAATCAGATTTTTGATTA
CTTTATTATGCTCACCATTTTAGTAAATTGCGTTTTCCTCGCACTCAATA
ATGACTACCCAATCTCCGAGTATGTATTCTTAGCAATATATACTTTGGAA
ATGGTGATTCGAATGACATCAAGAGGAGTAATTATCAACTCGTATACGTA
TCTCAGAGACCCGTACAACTTAGTTGACATACTTATTATCATTCTTTCAT
ATATTATGATAATAGTAGAGAAATGCTACGGTCAAAATAATGTAAACGTA
AGCTCTCTCAGAACGTTGCGCGTGTTGCGTGCTTTGAAGACAATTACTAT
ATTACCAGGTCTCAAAACCATAACAAGTGCCTTGATAAAATCACTGAAAA
TGTTGTTTGAAGTGATAATTTTGAGCCTTTTTTGCATGAGTTTCTTTGCG
CTATTCGCACTTCAAATTTACCAAGGCACATTACGAAATAAATGTGTCAA
AATGGTAGACTGGAAAAATGTGATGTCCGAGAATCATAGCAATGAATTCG
TTAATGCATTTTATTACAATTGGACTCATAATCCCAACAATTGGATCCGG
AATGGTATCAACTATTTGACATGCGGCAACGACAGCAGTGCCGGTAATTG
TTCAAAAACGAACCCGAATTCGATTTGCCTTCCTCACATTGGGCCCAATC
CAAATTTTGGTTACACAAATTTTGACAATTTCGGATGGGCTCTTCTTTCA
ATGTTCCAATTGATAACCTTGGACTACTGGGAAAATCAGTACAATCTTGT
TATTAGGGCGAGTGGATCATGGAATATTTTATTTTACATAATTGTGGTGT
TTTTCGGATCGTTTTACTTAATAAATCTTATGTTAGCCGTTGTGAGTATG
AGCTACGAGGAGGAGGCTGAAGCTCAATCGAGAGAAAATGAAGAACAGAA
AAATCGTAAAATAAAAGCAAATAAAAGAAAAAAGAAATTGAACAAGAAAT
CAAGCATTAGCACAAAAATATCAATCAAAACGACTCACGATAAAGACCAA
ATGAAAGATTTAAAAATTACAAATGGAATGAGTGATGCTGATTCATCTCT
CTGCAAGAATACTACAAGTATTCACGAAAATGATGACAATTTCAGATTTA
TGGACAGTGAAGAAGAAAAAGAAGGGAAAGACTGTGATAATAAAGCCGAA
TATGAAGACGAAGTCGAAATTGGCAACGATACAAATAATACTGACACAGC
TGAAATGAATCCAACAATAGATCGGAATTGTCAGTGTTGCATTAAGCAAA
ACGTTCTTTGCTCCAAGTGGGTCGCTTTCCAGAATAGGCTCTACATATTT
GTCACAGATCCGTTTTTTGATTTGTTCATTTCATTTTGCATTTTCATCAA
CACAATTATCATGGCTAGTGAGCATTACCCGTCCGAGAAAACCTGGGATG
ATATTCTCAAATATTCCAATATTATTTTTACAGTGATTTACATAATTGAA
TGCTCGTTAAAAATAATGGCTTTGTCAAAAGAATATTTCAATGTCGGATG
GAATATTTTTGACTTTGTCGTAGTGATAGCTAGCATAATAGATCTAGGGG
TTGAGGAGGTTGATGCCTTGTCCATATTCAGGGCTTTTAGACTATTTAGG
GTATTCAAATTGGCCCAATCTTGGCAGACTATGAGGTTGCTGTTGACAAT
CATTTTCAGTACAATTACAGAAATGGGAAACCTTTCAATAATAGTCCTGT
TAGTTCTCTACATGTTCGCTGTAATTGGGAAGCAATCCTATCGCAATACA
TATCACACGCAAATATTCGGAGACAATATTCCCCGATGGAACTTTGATGA
TTTCTGGCATTCAATGATTCTTGTATTTCGGATCATTTGCGGTGAATGGA
TTGAACCATCTTTTGACTGTATCAGAGCAAATAGCCCACTATGTCTTCTT
ATTTTTATTCCAACACTTGTTTTGGGAAATTTCGTGGTACTCAATTTATT
TTTGGCTTTACTGCTGAATTCCTTTGCATCCGACTCTTTAAAAAATACGG
CAGATGAAGACGTTTCAAAACTAAAAATAGTCATTGAACGATTAAGGAAC
ATTTATCCAATGTCCAGGAATAATCCATTGGGCATTAATAAAGGAAATCA
AGAATTAGATTCAACAGAGACATTGAAAGACATTGTGGTAAATTTTGGGT
GCGAAAATGCGGCGGAATTACAGAACAATCATGAAAAAATGAGAATTATT
AAAAATTGCAAAGATTTATCCACTTCAAACGAATTAGTCAATTTGCTTCC
ATCCACAGGAAGTCTGAGTAAGGGTAACAAGTTGATCAACAATGCAATAG
ACGAAACTGATACTGACGAAAAAGATAAAGGAAAACATTTGAATAATGAA
GAAAAGACGAAAGTCGAAAAAGAAAATGAAAATATTGACGAAGAATCAGT
AAACGAATTGAAAGGCTGTTGCTGTGCCATTTGTTACAATCCATTTCAGG
AAAAAAAACCATTTCACTGTTGTTACTGCATTGTTTGTGACATCGAGACT
CCTTGTGGTAGCCGGTGGCACGCATTCCGGAACAGGTCTTTGTTAATTAC
GGAACACCGGGCATTCGAAGGAACAATCCTGGTATGCATTTTGGCTAGCA
GCATTTGTTTGTGCTTTGAAGACATTTATCTCGATAACAACCCGACTCTG
AAACAAGCCTTAAGAGTGATCAACTACATCTTCACCTACCTATTCTGTAT
CGAAATGATACTCAAAATCATTTCGCTTGGTTTCAAAGTTTATTTCACAA
GTTTTTGGACAATTTTGGATTTCTTTATTGTTTCGATTTCCCTTCTATCA
CTTATCAATGATATTTTGGGATTCGGGACCGAAATGACTGCCTTCCGTTC
CTTGAGGACAATGAGAGCACTGCGTCCATTGAGAGCGATTTCCCGCTGGC
AAGGAATGAAAATTGTAGTCAACGCATTGATATATGCGATTCCGTCAATT
TTCAATGTCCTTCTGGTTTGCATAGTGTTTTGGCTCATATTCAGCATTAC
TGGTGTGCAATTTTTCAAGGGGAAATTCTTCAAATGTCTTGATTCCAATA
CGAGAGAAAGATTAGCGGCAACTGTTGTTCCTAACAAATCAGAATGTCTC
AGACAGAATCACACGTGGGCAAATTCCAATATAAACTTCGACAATGCGAC
AAATGGATTTTTAGCGTTGTATCAAATTGCTACCTTCGAAGGATGGATGG
AAATCATGCAAGACGCCATAGACTCGACAGGCATTAATTTGCAACCTAAG
AAAGAAAATCAGATGGCCTATTATGCGTATTTTGTGATCTTCATTCTTGT
CGGCAGTTTCTTCATTCTAAACCTTTTCATTGGGGTGATAATTGACAATT
TTAACCGACTAAAAAATAAGTATGAAGGAAATTACATTGATGTATTTCTA
ACGGCCAGTCAAAGAAACTATTATAATACGATGAAGAAATTAAGCAACAG
AAAGCCAAGAAAAACTGTTCGTCGACCGAAAGCATTGGTTCAAGGATTTT
TCTATGATGTAGCCATGAGTAATCGGTTTGAGCTAGTGATAGTCATTCTG
ATCTTCCTCAACATGGTGGTCATGATGATCGAGCATTATAGGCAAACCGC
TGCATTCACAAATGTACTTGACATGATAAATATTATGTTTTCTACTATTT
TTACATTGGAGGCCATTGTCAAGATTTCCGGTTTGAGATGGCATTACTTT
AGATACATGTGGAATATTTTTGATTTCATTATTGTTCTCTTGAGTATTAT
TGATTTGGTTATAAACATGTTTCGATCTTTCAGTGATTCTGGTGAGTTTT
CTTTGAAAAAGTTTATAATTATTTTTCTTAGTATTATTCATGGAAGAAAC
TTTGAAAGCTTCATTTATAACTCCAACACTGTTACGAGTAGTTCGCATTT
TCCGAATCGGAAGAGTTCTTAGATTGATCAAAGTTGCAAAGGGTATTCGA
AAATTGCTTTTTGCTTTAGTGATTTCATTGCCAGCTCTTTTTAATATCGG
GGCACTGCTGCTGCTCATAGTATTTATTTATTCTATAGTAGGAATGTCTG
TGTTTGGGAATCTCAAAAAGACAGGCGGTTTGGATGATCTGGTTAACTTC
GAAACATTTGAACGTAGTATTCTTCTTTTGTTCCGTCTTACTACAGCTGG
AGGATGGAATGATATTCTAGAAGCCATGTTTATTCAGCCGCCTTATTGCA
ATAATACTCATGTTCTCAGAGATGGCGTATACAAGGCAATATCAAACGGT
GATTGTGGTACTGCCTGGTTCGGAATATTATACATGACGACCTTTATATT
CATTTGTTATTTAATTATAATCAACATGTATATCGCAATTATCTTGGAAA
ATTTTAATCAAGCTCATGCTCAAGAAGAAGTCGGAATAACTGAGGATGAT
TTCGAAATGTTTTATCTAGTCTGGGAACGATACGATCCGCATGCGTCACA
ATACATCAAATACGCTAATCTCTCTGATTTTGTTGCGGAATTAGATGAAC
CCCTAGGAATTCCTAAACCAAATATGATTGCATTGGTTTCCTTTGACTTG
CCAATAGTGGAAGGAGACAAAATGCATTGTTTGGATATTCTCATTGCATT
GGTTAAACATGTCATTGGAGACATAGAAGACTCTGAAGAGTTTCGTAAAA
TTAAACGACAAATGGAATTAAAATATGAAGAGGTCTTTCCAAATAGGGTT
CATACAAATGTGATCACGACAACGATGAAAAGAAAAAAAGAAGATATTGC
TGCTAAAACCTTACAAAGAGCATGGAAACATGTTAAAGCACAAAGGGCAT
TCAAACAAATGACGGAAAATGCAACATTATCATCAAGACATGATTCGTAT
TACTTACAATTGAACAGACAAACGTTACCATGCCCAGTGGGTCAAAGTTC
TGGTAGTAACAGCTCTTCACAACCATTTCTCAAGATTCCTCATCTTTTCG
AGCAACAGATCGGA
back to top

protein sequence of SMED30035715-orf-1

>SMED30035715-orf-1 ID=SMED30035715-orf-1|Name=SMED30035715-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1467bp
MSEPGISVIANTMLMKSNNKQENYRLFTESGYEKILEEKRIKRLKEIERH
RHIDEGKLVDGELKFEVEDFSDNCQPDPELVAGSILLEDKLGEFPEELLG
KPLNEIDQNLKDKSFVVINTRFKIKYIYRYSATKSFLLCAPWSGIRKLAL
LISTNQIFDYFIMLTILVNCVFLALNNDYPISEYVFLAIYTLEMVIRMTS
RGVIINSYTYLRDPYNLVDILIIILSYIMIIVEKCYGQNNVNVSSLRTLR
VLRALKTITILPGLKTITSALIKSLKMLFEVIILSLFCMSFFALFALQIY
QGTLRNKCVKMVDWKNVMSENHSNEFVNAFYYNWTHNPNNWIRNGINYLT
CGNDSSAGNCSKTNPNSICLPHIGPNPNFGYTNFDNFGWALLSMFQLITL
DYWENQYNLVIRASGSWNILFYIIVVFFGSFYLINLMLAVVSMSYEEEAE
AQSRENEEQKNRKIKANKRKKKLNKKSSISTKISIKTTHDKDQMKDLKIT
NGMSDADSSLCKNTTSIHENDDNFRFMDSEEEKEGKDCDNKAEYEDEVEI
GNDTNNTDTAEMNPTIDRNCQCCIKQNVLCSKWVAFQNRLYIFVTDPFFD
LFISFCIFINTIIMASEHYPSEKTWDDILKYSNIIFTVIYIIECSLKIMA
LSKEYFNVGWNIFDFVVVIASIIDLGVEEVDALSIFRAFRLFRVFKLAQS
WQTMRLLLTIIFSTITEMGNLSIIVLLVLYMFAVIGKQSYRNTYHTQIFG
DNIPRWNFDDFWHSMILVFRIICGEWIEPSFDCIRANSPLCLLIFIPTLV
LGNFVVLNLFLALLLNSFASDSLKNTADEDVSKLKIVIERLRNIYPMSRN
NPLGINKGNQELDSTETLKDIVVNFGCENAAELQNNHEKMRIIKNCKDLS
TSNELVNLLPSTGSLSKGNKLINNAIDETDTDEKDKGKHLNNEEKTKVEK
ENENIDEESVNELKGCCCAICYNPFQEKKPFHCCYCIVCDIETPCGSRWH
AFRNRSLLITEHRAFEGTILVCILASSICLCFEDIYLDNNPTLKQALRVI
NYIFTYLFCIEMILKIISLGFKVYFTSFWTILDFFIVSISLLSLINDILG
FGTEMTAFRSLRTMRALRPLRAISRWQGMKIVVNALIYAIPSIFNVLLVC
IVFWLIFSITGVQFFKGKFFKCLDSNTRERLAATVVPNKSECLRQNHTWA
NSNINFDNATNGFLALYQIATFEGWMEIMQDAIDSTGINLQPKKENQMAY
YAYFVIFILVGSFFILNLFIGVIIDNFNRLKNKYEGNYIDVFLTASQRNY
YNTMKKLSNRKPRKTVRRPKALVQGFFYDVAMSNRFELVIVILIFLNMVV
MMIEHYRQTAAFTNVLDMINIMFSTIFTLEAIVKISGLRWHYFRYMWNIF
DFIIVLLSIIDLVINMFRSFSDSGEFSLKKFIIIFLSIIHGRNFESFIYN
SNTVTSSSHFPNRKSS*
back to top

protein sequence of SMED30035715-orf-2

>SMED30035715-orf-2 ID=SMED30035715-orf-2|Name=SMED30035715-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=162bp
MSSSSAPILKRAGNEITKAKSNFRIPFATLINLRTLPIRKMRTTRNSVGV
INEAFKVSSMNNTKKNNYKLFQRKLTRITERSKHVYNQINNTQENNNEIK
NIPHVSKVMPSQTGNLDNGLQCKNSRKHNIYHVKYICECSGLPIMLDHHD
HHVEEDQNDYH*
back to top

protein sequence of SMED30035715-orf-3

>SMED30035715-orf-3 ID=SMED30035715-orf-3|Name=SMED30035715-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=375bp
MEETLKASFITPTLLRVVRIFRIGRVLRLIKVAKGIRKLLFALVISLPAL
FNIGALLLLIVFIYSIVGMSVFGNLKKTGGLDDLVNFETFERSILLLFRL
TTAGGWNDILEAMFIQPPYCNNTHVLRDGVYKAISNGDCGTAWFGILYMT
TFIFICYLIIINMYIAIILENFNQAHAQEEVGITEDDFEMFYLVWERYDP
HASQYIKYANLSDFVAELDEPLGIPKPNMIALVSFDLPIVEGDKMHCLDI
LIALVKHVIGDIEDSEEFRKIKRQMELKYEEVFPNRVHTNVITTTMKRKK
EDIAAKTLQRAWKHVKAQRAFKQMTENATLSSRHDSYYLQLNRQTLPCPV
GQSSGSNSSSQPFLKIPHLFEQQIG
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005261cation channel activity
GO:0005216ion channel activity
GO:0005248voltage-gated sodium channel activity
GO:0005244voltage-gated ion channel activity
GO:0005272sodium channel activity
Vocabulary: biological process
TermDefinition
GO:0098655cation transmembrane transport
GO:0055085transmembrane transport
GO:0006811ion transport
GO:0006814sodium ion transport
GO:0006810transport
GO:0034220ion transmembrane transport
GO:0034765regulation of ion transmembrane transport
GO:0035725sodium ion transmembrane transport
GO:0060078regulation of postsynaptic membrane potential
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000025nervous system
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR043203VGCC_Ca_Na
IPR027359Volt_channel_dom_sf
IPR005821Ion_trans_dom
IPR001696Na_channel_asu
IPR031649GPHH_dom
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0001518voltage-gated sodium channel complex
GO:0005886plasma membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 442..476
NoneNo IPR availableCOILSCoilCoilcoord: 941..961
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 1128..1282
e-value: 1.6E-21
score: 78.2
coord: 369..450
e-value: 1.1E-12
score: 49.8
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 707..817
e-value: 4.0E-16
score: 61.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 451..478
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 928..953
NoneNo IPR availablePANTHERPTHR10037:SF62SODIUM CHANNEL PROTEIN 60Ecoord: 92..947
coord: 995..1420
NoneNo IPR availableCDDcd13433Na_channel_gatecoord: 1275..1329
e-value: 1.86497E-21
score: 86.8499
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 156..447
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 597..818
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 1335..1426
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 1012..1279
NoneNo IPR availableTMHMMTMhelixcoord: 183..205
NoneNo IPR availableTMHMMTMhelixcoord: 1336..1353
NoneNo IPR availableTMHMMTMhelixcoord: 1081..1103
NoneNo IPR availableTMHMMTMhelixcoord: 1049..1071
NoneNo IPR availableTMHMMTMhelixcoord: 658..677
NoneNo IPR availableTMHMMTMhelixcoord: 419..441
NoneNo IPR availableTMHMMTMhelixcoord: 592..614
NoneNo IPR availableTMHMMTMhelixcoord: 1135..1157
NoneNo IPR availableTMHMMTMhelixcoord: 157..176
NoneNo IPR availableTMHMMTMhelixcoord: 1252..1274
NoneNo IPR availableTMHMMTMhelixcoord: 1368..1388
NoneNo IPR availableTMHMMTMhelixcoord: 1015..1037
NoneNo IPR availableTMHMMTMhelixcoord: 792..814
NoneNo IPR availableTMHMMTMhelixcoord: 278..300
NoneNo IPR availableTMHMMTMhelixcoord: 215..232
NoneNo IPR availableTMHMMTMhelixcoord: 1395..1417
NoneNo IPR availableTMHMMTMhelixcoord: 714..736
NoneNo IPR availableTMHMMTMhelixcoord: 634..651
IPR005821Ion transport domainPFAMPF00520Ion_transcoord: 155..451
e-value: 8.6E-64
score: 215.1
coord: 597..820
e-value: 2.4E-47
score: 161.3
coord: 1012..1283
e-value: 3.8E-65
score: 219.5
coord: 1335..1416
e-value: 8.3E-16
score: 58.0
IPR027359Voltage-dependent channel domain superfamilyGENE3DG3DSA:1.20.120.350coord: 149..263
e-value: 4.3E-20
score: 73.8
coord: 1326..1436
e-value: 1.0E-25
score: 92.0
coord: 587..706
e-value: 1.1E-33
score: 117.7
coord: 1004..1126
e-value: 3.0E-28
score: 100.2
IPR043203Voltage-gated cation channel calcium and sodiumPANTHERPTHR10037VOLTAGE-GATED CATION CHANNEL CALCIUM AND SODIUMcoord: 92..947
coord: 995..1420