40S ribosomal protein S18

Overview
Name40S ribosomal protein S18
Smed IDSMED30035710
Length (bp)615
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 40S ribosomal protein S18 (SMED30035710) t-SNE clustered cells

Violin plots show distribution of expression levels for 40S ribosomal protein S18 (SMED30035710) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 40S ribosomal protein S18 (SMED30035710) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 40S ribosomal protein S18 (SMED30035710) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035710

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30035710h1SMcG0008461 SmedASXL_014955SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30035710h1SMcG0008461 Contig50852newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035710h1SMcG0008461 Contig50852uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 40S ribosomal protein S18 vs. Ensembl Human
Match: RPS18 (ribosomal protein S18 [Source:HGNC Symbol;Acc:HGNC:10401])

HSP 1 Score: 217.624 bits (553), Expect = 2.205e-72
Identity = 95/135 (70.37%), Postives = 119/135 (88.15%), Query Frame = 3
Query:  114 MSLIMPQKFNHILRVMNTNIDGERTIVYALTAIRGIGRRFAHVVCKKAEVDVNKRAGEITDDELEKITTVMANPTVYKIPKWFLNRQRDIKDGANLQIMANGLDNKLREDLERLKKIKCHRGLRHHWGLRVRGQH 518
            MSL++P+KF HILRV+NTNIDG R I +A+TAI+G+GRR+AHVV +KA++D+ KRAGE+T+DE+E++ T+M NP  YKIP WFLNRQ+D+KDG   Q++ANGLDNKLREDLERLKKI+ HRGLRH WGLRVRGQH
Sbjct:    1 MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAGELTEDEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQH 135          
BLAST of 40S ribosomal protein S18 vs. Ensembl Human
Match: RPS18 (ribosomal protein S18 [Source:HGNC Symbol;Acc:HGNC:10401])

HSP 1 Score: 217.624 bits (553), Expect = 2.205e-72
Identity = 95/135 (70.37%), Postives = 119/135 (88.15%), Query Frame = 3
Query:  114 MSLIMPQKFNHILRVMNTNIDGERTIVYALTAIRGIGRRFAHVVCKKAEVDVNKRAGEITDDELEKITTVMANPTVYKIPKWFLNRQRDIKDGANLQIMANGLDNKLREDLERLKKIKCHRGLRHHWGLRVRGQH 518
            MSL++P+KF HILRV+NTNIDG R I +A+TAI+G+GRR+AHVV +KA++D+ KRAGE+T+DE+E++ T+M NP  YKIP WFLNRQ+D+KDG   Q++ANGLDNKLREDLERLKKI+ HRGLRH WGLRVRGQH
Sbjct:    1 MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAGELTEDEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQH 135          
BLAST of 40S ribosomal protein S18 vs. Ensembl Human
Match: RPS18 (ribosomal protein S18 [Source:HGNC Symbol;Acc:HGNC:10401])

HSP 1 Score: 217.624 bits (553), Expect = 2.205e-72
Identity = 95/135 (70.37%), Postives = 119/135 (88.15%), Query Frame = 3
Query:  114 MSLIMPQKFNHILRVMNTNIDGERTIVYALTAIRGIGRRFAHVVCKKAEVDVNKRAGEITDDELEKITTVMANPTVYKIPKWFLNRQRDIKDGANLQIMANGLDNKLREDLERLKKIKCHRGLRHHWGLRVRGQH 518
            MSL++P+KF HILRV+NTNIDG R I +A+TAI+G+GRR+AHVV +KA++D+ KRAGE+T+DE+E++ T+M NP  YKIP WFLNRQ+D+KDG   Q++ANGLDNKLREDLERLKKI+ HRGLRH WGLRVRGQH
Sbjct:    1 MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAGELTEDEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQH 135          
BLAST of 40S ribosomal protein S18 vs. Ensembl Human
Match: RPS18 (ribosomal protein S18 [Source:HGNC Symbol;Acc:HGNC:10401])

HSP 1 Score: 217.624 bits (553), Expect = 2.205e-72
Identity = 95/135 (70.37%), Postives = 119/135 (88.15%), Query Frame = 3
Query:  114 MSLIMPQKFNHILRVMNTNIDGERTIVYALTAIRGIGRRFAHVVCKKAEVDVNKRAGEITDDELEKITTVMANPTVYKIPKWFLNRQRDIKDGANLQIMANGLDNKLREDLERLKKIKCHRGLRHHWGLRVRGQH 518
            MSL++P+KF HILRV+NTNIDG R I +A+TAI+G+GRR+AHVV +KA++D+ KRAGE+T+DE+E++ T+M NP  YKIP WFLNRQ+D+KDG   Q++ANGLDNKLREDLERLKKI+ HRGLRH WGLRVRGQH
Sbjct:    1 MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAGELTEDEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQH 135          
BLAST of 40S ribosomal protein S18 vs. Ensembl Human
Match: RPS18 (ribosomal protein S18 [Source:HGNC Symbol;Acc:HGNC:10401])

HSP 1 Score: 217.624 bits (553), Expect = 2.205e-72
Identity = 95/135 (70.37%), Postives = 119/135 (88.15%), Query Frame = 3
Query:  114 MSLIMPQKFNHILRVMNTNIDGERTIVYALTAIRGIGRRFAHVVCKKAEVDVNKRAGEITDDELEKITTVMANPTVYKIPKWFLNRQRDIKDGANLQIMANGLDNKLREDLERLKKIKCHRGLRHHWGLRVRGQH 518
            MSL++P+KF HILRV+NTNIDG R I +A+TAI+G+GRR+AHVV +KA++D+ KRAGE+T+DE+E++ T+M NP  YKIP WFLNRQ+D+KDG   Q++ANGLDNKLREDLERLKKI+ HRGLRH WGLRVRGQH
Sbjct:    1 MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAGELTEDEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQH 135          
BLAST of 40S ribosomal protein S18 vs. Ensembl Celegans
Match: rps-18 (Ribosomal Protein, Small subunit [Source:UniProtKB/TrEMBL;Acc:O18240])

HSP 1 Score: 213.001 bits (541), Expect = 6.335e-71
Identity = 95/135 (70.37%), Postives = 117/135 (86.67%), Query Frame = 3
Query:  114 MSLIMPQKFNHILRVMNTNIDGERTIVYALTAIRGIGRRFAHVVCKKAEVDVNKRAGEITDDELEKITTVMANPTVYKIPKWFLNRQRDIKDGANLQIMANGLDNKLREDLERLKKIKCHRGLRHHWGLRVRGQH 518
            MSLI+P+KF HI RVMNTNIDG R + YALTAI+G+GRRFA V C+KA+VDVNKRAGE+T+++ +KI T+M NP+ YKIP WFLNRQ+DIKDG   Q+++  +DNKLREDLER+KKI+ HRGLRH+WGLRVRGQH
Sbjct:    1 MSLIIPEKFQHIHRVMNTNIDGNRKVPYALTAIKGVGRRFAFVCCRKADVDVNKRAGELTEEDFDKIVTIMQNPSQYKIPNWFLNRQKDIKDGKTGQLLSTAVDNKLREDLERMKKIRLHRGLRHYWGLRVRGQH 135          
BLAST of 40S ribosomal protein S18 vs. Ensembl Fly
Match: RpS18 (gene:FBgn0010411 transcript:FBtr0086274)

HSP 1 Score: 197.208 bits (500), Expect = 1.073e-64
Identity = 85/135 (62.96%), Postives = 117/135 (86.67%), Query Frame = 3
Query:  114 MSLIMPQKFNHILRVMNTNIDGERTIVYALTAIRGIGRRFAHVVCKKAEVDVNKRAGEITDDELEKITTVMANPTVYKIPKWFLNRQRDIKDGANLQIMANGLDNKLREDLERLKKIKCHRGLRHHWGLRVRGQH 518
            MSL++P+KF HILR+MNTNIDG+R +  A+TAI+G+GRR++++V KKA+VD+ KRAGE T++E++K+ T+++NP  YK+P WFLNRQ+DI DG   Q+ ++ LD+KLR+DLERLKKI+ HRGLRH+WGLRVRGQH
Sbjct:    1 MSLVIPEKFQHILRIMNTNIDGKRKVGIAMTAIKGVGRRYSNIVLKKADVDLTKRAGECTEEEVDKVVTIISNPLQYKVPNWFLNRQKDIIDGKYWQLTSSNLDSKLRDDLERLKKIRSHRGLRHYWGLRVRGQH 135          
BLAST of 40S ribosomal protein S18 vs. Ensembl Fly
Match: RpS18 (gene:FBgn0010411 transcript:FBtr0086273)

HSP 1 Score: 197.208 bits (500), Expect = 1.073e-64
Identity = 85/135 (62.96%), Postives = 117/135 (86.67%), Query Frame = 3
Query:  114 MSLIMPQKFNHILRVMNTNIDGERTIVYALTAIRGIGRRFAHVVCKKAEVDVNKRAGEITDDELEKITTVMANPTVYKIPKWFLNRQRDIKDGANLQIMANGLDNKLREDLERLKKIKCHRGLRHHWGLRVRGQH 518
            MSL++P+KF HILR+MNTNIDG+R +  A+TAI+G+GRR++++V KKA+VD+ KRAGE T++E++K+ T+++NP  YK+P WFLNRQ+DI DG   Q+ ++ LD+KLR+DLERLKKI+ HRGLRH+WGLRVRGQH
Sbjct:    1 MSLVIPEKFQHILRIMNTNIDGKRKVGIAMTAIKGVGRRYSNIVLKKADVDLTKRAGECTEEEVDKVVTIISNPLQYKVPNWFLNRQKDIIDGKYWQLTSSNLDSKLRDDLERLKKIRSHRGLRHYWGLRVRGQH 135          
BLAST of 40S ribosomal protein S18 vs. Ensembl Zebrafish
Match: rps18 (ribosomal protein S18 [Source:NCBI gene;Acc:192300])

HSP 1 Score: 220.32 bits (560), Expect = 1.196e-73
Identity = 97/135 (71.85%), Postives = 120/135 (88.89%), Query Frame = 3
Query:  114 MSLIMPQKFNHILRVMNTNIDGERTIVYALTAIRGIGRRFAHVVCKKAEVDVNKRAGEITDDELEKITTVMANPTVYKIPKWFLNRQRDIKDGANLQIMANGLDNKLREDLERLKKIKCHRGLRHHWGLRVRGQH 518
            MSL++P+KF HILRV+NTNIDG R I +A+TAI+G+GRR+AHVV +KA++D+NKRAGE+T+DE+E++ T+M NP  YKIP WFLNRQ+DIKDG   Q++ANGLDNKLREDLERLKKI+ HRGLRH WGLRVRGQH
Sbjct:    1 MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLNKRAGELTEDEVERVVTIMQNPRQYKIPDWFLNRQKDIKDGKYSQVLANGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQH 135          
BLAST of 40S ribosomal protein S18 vs. Ensembl Zebrafish
Match: rps18 (ribosomal protein S18 [Source:NCBI gene;Acc:192300])

HSP 1 Score: 150.599 bits (379), Expect = 7.255e-47
Identity = 65/98 (66.33%), Postives = 85/98 (86.73%), Query Frame = 3
Query:  114 MSLIMPQKFNHILRVMNTNIDGERTIVYALTAIRGIGRRFAHVVCKKAEVDVNKRAGEITDDELEKITTVMANPTVYKIPKWFLNRQRDIKDGANLQI 407
            MSL++P+KF HILRV+NTNIDG R I +A+TAI+G+GRR+AHVV +KA++D+NKRAGE+T+DE+E++ T+M NP  YKIP WFLNRQ+DIKDG   QI
Sbjct:    1 MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLNKRAGELTEDEVERVVTIMQNPRQYKIPDWFLNRQKDIKDGKYSQI 98          
BLAST of 40S ribosomal protein S18 vs. Ensembl Zebrafish
Match: rps18 (ribosomal protein S18 [Source:NCBI gene;Acc:192300])

HSP 1 Score: 114.39 bits (285), Expect = 5.760e-33
Identity = 52/65 (80.00%), Postives = 56/65 (86.15%), Query Frame = 3
Query:  324 MANPTVYKIPKWFLNRQRDIKDGANLQIMANGLDNKLREDLERLKKIKCHRGLRHHWGLRVRGQH 518
            M NP  YKIP WFLNRQ+DIKDG   Q++ANGLDNKLREDLERLKKI+ HRGLRH WGLRVRGQH
Sbjct:    1 MQNPRQYKIPDWFLNRQKDIKDGKYSQVLANGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQH 65          
BLAST of 40S ribosomal protein S18 vs. Ensembl Zebrafish
Match: rps18 (ribosomal protein S18 [Source:NCBI gene;Acc:192300])

HSP 1 Score: 114.39 bits (285), Expect = 5.760e-33
Identity = 52/65 (80.00%), Postives = 56/65 (86.15%), Query Frame = 3
Query:  324 MANPTVYKIPKWFLNRQRDIKDGANLQIMANGLDNKLREDLERLKKIKCHRGLRHHWGLRVRGQH 518
            M NP  YKIP WFLNRQ+DIKDG   Q++ANGLDNKLREDLERLKKI+ HRGLRH WGLRVRGQH
Sbjct:    1 MQNPRQYKIPDWFLNRQKDIKDGKYSQVLANGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQH 65          
BLAST of 40S ribosomal protein S18 vs. Ensembl Zebrafish
Match: rps18 (ribosomal protein S18 [Source:NCBI gene;Acc:192300])

HSP 1 Score: 75.0998 bits (183), Expect = 1.271e-17
Identity = 33/40 (82.50%), Postives = 38/40 (95.00%), Query Frame = 3
Query:  399 LQIMANGLDNKLREDLERLKKIKCHRGLRHHWGLRVRGQH 518
            ++++ANGLDNKLREDLERLKKI+ HRGLRH WGLRVRGQH
Sbjct:   33 IKVLANGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQH 72          

HSP 2 Score: 53.9138 bits (128), Expect = 1.402e-9
Identity = 22/33 (66.67%), Postives = 29/33 (87.88%), Query Frame = 3
Query:  117 SLIMPQKFNHILRVMNTNIDGERTIVYALTAIR 215
            SL++P+KF HILRV+NTNIDG R I +A+TAI+
Sbjct:    2 SLVIPEKFQHILRVLNTNIDGRRKIAFAITAIK 34          
BLAST of 40S ribosomal protein S18 vs. Ensembl Xenopus
Match: rps18 (ribosomal protein S18 [Source:NCBI gene;Acc:549112])

HSP 1 Score: 219.55 bits (558), Expect = 2.759e-73
Identity = 97/135 (71.85%), Postives = 119/135 (88.15%), Query Frame = 3
Query:  114 MSLIMPQKFNHILRVMNTNIDGERTIVYALTAIRGIGRRFAHVVCKKAEVDVNKRAGEITDDELEKITTVMANPTVYKIPKWFLNRQRDIKDGANLQIMANGLDNKLREDLERLKKIKCHRGLRHHWGLRVRGQH 518
            MSL++P+KF HILRV+NTNIDG R I +A+TAI+G+GRR+AHVV +KA++D+ KRAGE+T+DE+E++ T+M NP  YKIP WFLNRQ+DIKDG   Q++ANGLDNKLREDLERLKKIK HRGLRH WGLRVRGQH
Sbjct:    1 MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAGELTEDEVERVVTIMQNPRQYKIPDWFLNRQKDIKDGKYSQVLANGLDNKLREDLERLKKIKAHRGLRHFWGLRVRGQH 135          
BLAST of 40S ribosomal protein S18 vs. Ensembl Xenopus
Match: rps18 (ribosomal protein S18 [Source:NCBI gene;Acc:549112])

HSP 1 Score: 218.779 bits (556), Expect = 1.086e-72
Identity = 99/145 (68.28%), Postives = 122/145 (84.14%), Query Frame = 3
Query:   84 SNTKFVIFLTMSLIMPQKFNHILRVMNTNIDGERTIVYALTAIRGIGRRFAHVVCKKAEVDVNKRAGEITDDELEKITTVMANPTVYKIPKWFLNRQRDIKDGANLQIMANGLDNKLREDLERLKKIKCHRGLRHHWGLRVRGQH 518
            SN  +   L  SL++P+KF HILRV+NTNIDG R I +A+TAI+G+GRR+AHVV +KA++D+ KRAGE+T+DE+E++ T+M NP  YKIP WFLNRQ+DIKDG   Q++ANGLDNKLREDLERLKKIK HRGLRH WGLRVRGQH
Sbjct:    5 SNVSYPSSL-QSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAGELTEDEVERVVTIMQNPRQYKIPDWFLNRQKDIKDGKYSQVLANGLDNKLREDLERLKKIKAHRGLRHFWGLRVRGQH 148          
BLAST of 40S ribosomal protein S18 vs. Ensembl Mouse
Match: Rps18 (ribosomal protein S18 [Source:MGI Symbol;Acc:MGI:98146])

HSP 1 Score: 217.624 bits (553), Expect = 1.514e-72
Identity = 95/135 (70.37%), Postives = 119/135 (88.15%), Query Frame = 3
Query:  114 MSLIMPQKFNHILRVMNTNIDGERTIVYALTAIRGIGRRFAHVVCKKAEVDVNKRAGEITDDELEKITTVMANPTVYKIPKWFLNRQRDIKDGANLQIMANGLDNKLREDLERLKKIKCHRGLRHHWGLRVRGQH 518
            MSL++P+KF HILRV+NTNIDG R I +A+TAI+G+GRR+AHVV +KA++D+ KRAGE+T+DE+E++ T+M NP  YKIP WFLNRQ+D+KDG   Q++ANGLDNKLREDLERLKKI+ HRGLRH WGLRVRGQH
Sbjct:    1 MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAGELTEDEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQH 135          
BLAST of 40S ribosomal protein S18 vs. Ensembl Mouse
Match: Rps18-ps5 (ribosomal protein S18, pseudogene 5 [Source:MGI Symbol;Acc:MGI:3649931])

HSP 1 Score: 214.927 bits (546), Expect = 1.350e-71
Identity = 95/135 (70.37%), Postives = 118/135 (87.41%), Query Frame = 3
Query:  114 MSLIMPQKFNHILRVMNTNIDGERTIVYALTAIRGIGRRFAHVVCKKAEVDVNKRAGEITDDELEKITTVMANPTVYKIPKWFLNRQRDIKDGANLQIMANGLDNKLREDLERLKKIKCHRGLRHHWGLRVRGQH 518
            MSL +P+KF HILRV+NTNIDG R I +A+TAI+G+GRR+AHVV +KA++D+ KRAGE+T+DE+E++ T+M NP  YKIP WFLNRQ+D+KDG   Q++ANGLDNKLREDLERLKKI+ HRGLRH WGLRVRGQH
Sbjct:    1 MSLEIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAGELTEDEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQH 135          
BLAST of 40S ribosomal protein S18 vs. Ensembl Mouse
Match: Gm10260 (predicted gene 10260 [Source:MGI Symbol;Acc:MGI:3642298])

HSP 1 Score: 214.927 bits (546), Expect = 1.350e-71
Identity = 94/135 (69.63%), Postives = 118/135 (87.41%), Query Frame = 3
Query:  114 MSLIMPQKFNHILRVMNTNIDGERTIVYALTAIRGIGRRFAHVVCKKAEVDVNKRAGEITDDELEKITTVMANPTVYKIPKWFLNRQRDIKDGANLQIMANGLDNKLREDLERLKKIKCHRGLRHHWGLRVRGQH 518
            MSL++P+KF HILRV+NTNIDG R I +A+TAI+G+GRR+AHVV +KA++D+ KRAGE+T+DE+E++ T+M NP  YKIP WFLNRQ+D+KDG   Q++ANGLDNKLREDLERLKKI+ HRGL H WGLRVRGQH
Sbjct:    1 MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAGELTEDEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAHRGLHHFWGLRVRGQH 135          
BLAST of 40S ribosomal protein S18 vs. Ensembl Mouse
Match: Rps18 (ribosomal protein S18 [Source:MGI Symbol;Acc:MGI:98146])

HSP 1 Score: 146.362 bits (368), Expect = 4.272e-45
Identity = 62/100 (62.00%), Postives = 84/100 (84.00%), Query Frame = 3
Query:  114 MSLIMPQKFNHILRVMNTNIDGERTIVYALTAIRGIGRRFAHVVCKKAEVDVNKRAGEITDDELEKITTVMANPTVYKIPKWFLNRQRDIKDGANLQIMA 413
            MSL++P+KF HILRV+NTNIDG R I +A+TAI+G+GRR+AHVV +KA++D+ KRAGE+T+DE+E++ T+M NP  YKIP WFLNRQ+D+KDG   Q  +
Sbjct:    1 MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAGELTEDEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQTTS 100          
BLAST of 40S ribosomal protein S18 vs. Ensembl Mouse
Match: Rps18 (ribosomal protein S18 [Source:MGI Symbol;Acc:MGI:98146])

HSP 1 Score: 57.7658 bits (138), Expect = 1.521e-11
Identity = 24/37 (64.86%), Postives = 31/37 (83.78%), Query Frame = 3
Query:  114 MSLIMPQKFNHILRVMNTNIDGERTIVYALTAIRGIG 224
            MSL++P+KF HILRV+NTNIDG R I +A+TAI+G  
Sbjct:    1 MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGFS 37          
BLAST of 40S ribosomal protein S18 vs. UniProt/SwissProt
Match: sp|Q8IT98|RS18_ARGIR (40S ribosomal protein S18 OS=Argopecten irradians OX=31199 GN=RPS18 PE=2 SV=1)

HSP 1 Score: 221.476 bits (563), Expect = 3.300e-73
Identity = 96/135 (71.11%), Postives = 123/135 (91.11%), Query Frame = 3
Query:  114 MSLIMPQKFNHILRVMNTNIDGERTIVYALTAIRGIGRRFAHVVCKKAEVDVNKRAGEITDDELEKITTVMANPTVYKIPKWFLNRQRDIKDGANLQIMANGLDNKLREDLERLKKIKCHRGLRHHWGLRVRGQH 518
            M+LI+P+KF HILRVMNTNIDG+R I++A+TAI+G+GRR+A+VVCKKA+VD+ KRAGE+++DE+E++ T+M+NP  YKIP WFLNRQ+D+KDG   Q+M+N LDNKLREDLERLKKI+ HRGLRH+WGLRVRGQH
Sbjct:    1 MALIIPEKFQHILRVMNTNIDGKRKIMFAMTAIKGMGRRYANVVCKKADVDITKRAGELSEDEIERVITIMSNPRQYKIPNWFLNRQKDVKDGKYSQVMSNALDNKLREDLERLKKIRAHRGLRHYWGLRVRGQH 135          
BLAST of 40S ribosomal protein S18 vs. UniProt/SwissProt
Match: sp|Q8JGS9|RS18_DANRE (40S ribosomal protein S18 OS=Danio rerio OX=7955 GN=rps18 PE=2 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 9.031e-73
Identity = 97/135 (71.85%), Postives = 120/135 (88.89%), Query Frame = 3
Query:  114 MSLIMPQKFNHILRVMNTNIDGERTIVYALTAIRGIGRRFAHVVCKKAEVDVNKRAGEITDDELEKITTVMANPTVYKIPKWFLNRQRDIKDGANLQIMANGLDNKLREDLERLKKIKCHRGLRHHWGLRVRGQH 518
            MSL++P+KF HILRV+NTNIDG R I +A+TAI+G+GRR+AHVV +KA++D+NKRAGE+T+DE+E++ T+M NP  YKIP WFLNRQ+DIKDG   Q++ANGLDNKLREDLERLKKI+ HRGLRH WGLRVRGQH
Sbjct:    1 MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLNKRAGELTEDEVERVVTIMQNPRQYKIPDWFLNRQKDIKDGKYSQVLANGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQH 135          
BLAST of 40S ribosomal protein S18 vs. UniProt/SwissProt
Match: sp|Q8ISP0|RS18_BRABE (40S ribosomal protein S18 OS=Branchiostoma belcheri OX=7741 GN=RPS18 PE=2 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 2.498e-72
Identity = 94/135 (69.63%), Postives = 122/135 (90.37%), Query Frame = 3
Query:  114 MSLIMPQKFNHILRVMNTNIDGERTIVYALTAIRGIGRRFAHVVCKKAEVDVNKRAGEITDDELEKITTVMANPTVYKIPKWFLNRQRDIKDGANLQIMANGLDNKLREDLERLKKIKCHRGLRHHWGLRVRGQH 518
            MSL++P+KF HILRVMNTNIDG R I++ALT+I+G+GRR++++VCKKA++D++KRAGE++D+E+E++ T+M NP  YKIP WFLNRQ+D+KDG   Q+MAN LDNKLREDLERLKKI+ HRGLRH+WGLRVRGQH
Sbjct:    1 MSLVIPEKFQHILRVMNTNIDGRRKIMFALTSIKGVGRRYSNIVCKKADIDLSKRAGELSDEEVERLITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVMANSLDNKLREDLERLKKIRAHRGLRHYWGLRVRGQH 135          
BLAST of 40S ribosomal protein S18 vs. UniProt/SwissProt
Match: sp|Q90YQ5|RS18_ICTPU (40S ribosomal protein S18 OS=Ictalurus punctatus OX=7998 GN=rps18 PE=2 SV=1)

HSP 1 Score: 218.394 bits (555), Expect = 4.133e-72
Identity = 95/135 (70.37%), Postives = 120/135 (88.89%), Query Frame = 3
Query:  114 MSLIMPQKFNHILRVMNTNIDGERTIVYALTAIRGIGRRFAHVVCKKAEVDVNKRAGEITDDELEKITTVMANPTVYKIPKWFLNRQRDIKDGANLQIMANGLDNKLREDLERLKKIKCHRGLRHHWGLRVRGQH 518
            MSL++P+KF HILRV+NTNIDG R I +A+TAI+G+GRR+AHVV +KA++D++KRAGE+T+DE+E++ T+M NP  YKIP WFLNRQ+D+KDG   Q++ANGLDNKLREDLERLKKI+ HRGLRH WGLRVRGQH
Sbjct:    1 MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLSKRAGELTEDEVERVVTIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQH 135          
BLAST of 40S ribosomal protein S18 vs. UniProt/SwissProt
Match: sp|P62271|RS18_RAT (40S ribosomal protein S18 OS=Rattus norvegicus OX=10116 GN=Rps18 PE=1 SV=3)

HSP 1 Score: 217.624 bits (553), Expect = 1.059e-71
Identity = 95/135 (70.37%), Postives = 119/135 (88.15%), Query Frame = 3
Query:  114 MSLIMPQKFNHILRVMNTNIDGERTIVYALTAIRGIGRRFAHVVCKKAEVDVNKRAGEITDDELEKITTVMANPTVYKIPKWFLNRQRDIKDGANLQIMANGLDNKLREDLERLKKIKCHRGLRHHWGLRVRGQH 518
            MSL++P+KF HILRV+NTNIDG R I +A+TAI+G+GRR+AHVV +KA++D+ KRAGE+T+DE+E++ T+M NP  YKIP WFLNRQ+D+KDG   Q++ANGLDNKLREDLERLKKI+ HRGLRH WGLRVRGQH
Sbjct:    1 MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAGELTEDEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQH 135          
BLAST of 40S ribosomal protein S18 vs. TrEMBL
Match: A3F4S5 (Ribosomal protein S18 OS=Taenia asiatica OX=60517 GN=TASK_LOCUS1049 PE=2 SV=1)

HSP 1 Score: 226.868 bits (577), Expect = 6.583e-73
Identity = 102/135 (75.56%), Postives = 122/135 (90.37%), Query Frame = 3
Query:  114 MSLIMPQKFNHILRVMNTNIDGERTIVYALTAIRGIGRRFAHVVCKKAEVDVNKRAGEITDDELEKITTVMANPTVYKIPKWFLNRQRDIKDGANLQIMANGLDNKLREDLERLKKIKCHRGLRHHWGLRVRGQH 518
            M+L++P+KF HILRVMNTNIDG+R I YALTAI+G+GRR+A VVCKKA+VD+ KRAGE+TDDE+EKI TVMANP  YKIP WFLNRQ+DI+DG + Q++A GLD+KLREDLERLKKI+ HRGLRH+WGLRVRGQH
Sbjct:    1 MALMLPEKFQHILRVMNTNIDGQRKITYALTAIKGVGRRYATVVCKKADVDIRKRAGELTDDEIEKIVTVMANPRQYKIPNWFLNRQKDIEDGKHTQLLAQGLDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH 135          
BLAST of 40S ribosomal protein S18 vs. TrEMBL
Match: A8UA21 (Putative ribosomal protein S18 OS=Sipunculus nudus OX=6446 PE=2 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 7.393e-72
Identity = 100/135 (74.07%), Postives = 121/135 (89.63%), Query Frame = 3
Query:  114 MSLIMPQKFNHILRVMNTNIDGERTIVYALTAIRGIGRRFAHVVCKKAEVDVNKRAGEITDDELEKITTVMANPTVYKIPKWFLNRQRDIKDGANLQIMANGLDNKLREDLERLKKIKCHRGLRHHWGLRVRGQH 518
            MSLI+P+KF HILRVMNTNIDG+R I +A+TAI+G+GRR+A +VCKKA+VDV KRAGE++DDE+EK+ TVM+NP  YKIP WFLNRQ+D+KDG   Q+M+N LDNKLREDLERLKKI+ HRGLRH+WGLRVRGQH
Sbjct:    1 MSLIIPEKFQHILRVMNTNIDGKRKIAFAMTAIKGVGRRYATIVCKKADVDVTKRAGELSDDEVEKLITVMSNPRQYKIPNWFLNRQKDVKDGKFSQVMSNQLDNKLREDLERLKKIRAHRGLRHYWGLRVRGQH 135          
BLAST of 40S ribosomal protein S18 vs. TrEMBL
Match: A0A0A0R245 (40S ribosomal protein OS=Phragmatopoma lapidosa OX=341668 PE=2 SV=1)

HSP 1 Score: 223.787 bits (569), Expect = 9.509e-72
Identity = 100/135 (74.07%), Postives = 120/135 (88.89%), Query Frame = 3
Query:  114 MSLIMPQKFNHILRVMNTNIDGERTIVYALTAIRGIGRRFAHVVCKKAEVDVNKRAGEITDDELEKITTVMANPTVYKIPKWFLNRQRDIKDGANLQIMANGLDNKLREDLERLKKIKCHRGLRHHWGLRVRGQH 518
            MSL++P+KF HILRVMNTNIDG R I +A+TAI+GIGRR++HVVCKKA+VD +KRAGE++D+E+EKI T+M NP  YKIP WFLNRQ+DIKDG   Q+M+N LDNKLREDLERLKKI+ HRGLRH+WGLRVRGQH
Sbjct:    1 MSLVVPEKFQHILRVMNTNIDGRRKIAFAMTAIKGIGRRYSHVVCKKADVDTSKRAGELSDEEVEKIITIMTNPRQYKIPDWFLNRQKDIKDGKFSQVMSNTLDNKLREDLERLKKIRAHRGLRHYWGLRVRGQH 135          
BLAST of 40S ribosomal protein S18 vs. TrEMBL
Match: A0A0R3X670 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS8978 PE=3 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 3.067e-71
Identity = 99/135 (73.33%), Postives = 121/135 (89.63%), Query Frame = 3
Query:  114 MSLIMPQKFNHILRVMNTNIDGERTIVYALTAIRGIGRRFAHVVCKKAEVDVNKRAGEITDDELEKITTVMANPTVYKIPKWFLNRQRDIKDGANLQIMANGLDNKLREDLERLKKIKCHRGLRHHWGLRVRGQH 518
            M+L++P+KF HILRVMNTNIDG+R I YALTAI+G+GRR+A VVCKKA++DV KRAGE+++DE+EKI TVM NP  YKIP WFLNRQ+DI+DG + Q++A GLD+KLREDLERLKKI+ HRGLRH+WGLRVRGQH
Sbjct:    1 MALMLPEKFQHILRVMNTNIDGQRKITYALTAIKGVGRRYATVVCKKADIDVRKRAGELSEDEIEKIVTVMGNPRQYKIPDWFLNRQKDIEDGKHTQLLAQGLDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH 135          
BLAST of 40S ribosomal protein S18 vs. TrEMBL
Match: B2YI16 (Putative 40S ribosomal protein RPS18 OS=Phoronis muelleri OX=478209 PE=2 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 3.384e-71
Identity = 97/135 (71.85%), Postives = 123/135 (91.11%), Query Frame = 3
Query:  114 MSLIMPQKFNHILRVMNTNIDGERTIVYALTAIRGIGRRFAHVVCKKAEVDVNKRAGEITDDELEKITTVMANPTVYKIPKWFLNRQRDIKDGANLQIMANGLDNKLREDLERLKKIKCHRGLRHHWGLRVRGQH 518
            MSL++P+KF HILRVMNTNIDG+R I++A+TAI+GIGRR+AHVV KKA+VD+ KRAGE++++E+E++ T+M+NP  YKIP WFLNRQ+D+KDG   Q+M+NGLDNKLREDLERLKKI+ HRGLRH+WGLRVRGQH
Sbjct:    1 MSLVVPEKFQHILRVMNTNIDGKRKIMFAMTAIKGIGRRYAHVVLKKADVDLAKRAGELSEEEVERVITIMSNPRQYKIPDWFLNRQKDVKDGKTSQVMSNGLDNKLREDLERLKKIRAHRGLRHYWGLRVRGQH 135          
BLAST of 40S ribosomal protein S18 vs. Ensembl Cavefish
Match: rps18 (ribosomal protein S18 [Source:NCBI gene;Acc:192300])

HSP 1 Score: 218.009 bits (554), Expect = 7.842e-73
Identity = 96/134 (71.64%), Postives = 119/134 (88.81%), Query Frame = 3
Query:  117 SLIMPQKFNHILRVMNTNIDGERTIVYALTAIRGIGRRFAHVVCKKAEVDVNKRAGEITDDELEKITTVMANPTVYKIPKWFLNRQRDIKDGANLQIMANGLDNKLREDLERLKKIKCHRGLRHHWGLRVRGQH 518
            SL++P+KF HILRV+NTNIDG R I +A+TAI+G+GRR+AHVV +KA++D+NKRAGE+T+DE+E++ T+M NP  YKIP WFLNRQ+DIKDG   Q++ANGLDNKLREDLERLKKI+ HRGLRH WGLRVRGQH
Sbjct:    1 SLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLNKRAGELTEDEVERVVTIMQNPRQYKIPDWFLNRQKDIKDGKYSQVLANGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQH 134          
BLAST of 40S ribosomal protein S18 vs. Ensembl Cavefish
Match: rps18 (ribosomal protein S18 [Source:NCBI gene;Acc:192300])

HSP 1 Score: 149.058 bits (375), Expect = 2.306e-45
Identity = 64/97 (65.98%), Postives = 84/97 (86.60%), Query Frame = 3
Query:  114 MSLIMPQKFNHILRVMNTNIDGERTIVYALTAIRGIGRRFAHVVCKKAEVDVNKRAGEITDDELEKITTVMANPTVYKIPKWFLNRQRDIKDGANLQ 404
            MSL++P+KF HILRV+NTNIDG R I +A+TAI+G+GRR+AHVV +KA++D+NKRAGE+T+DE+E++ T+M NP  YKIP WFLNRQ+DIKDG   Q
Sbjct:    1 MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLNKRAGELTEDEVERVVTIMQNPRQYKIPDWFLNRQKDIKDGKYSQ 97          
BLAST of 40S ribosomal protein S18 vs. Ensembl Yeast
Match: RPS18B (Protein component of the small (40S) ribosomal subunit; homologous to mammalian ribosomal protein S18 and bacterial S13; RPS18B has a paralog, RPS18A, that arose from the whole genome duplication; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004488])

HSP 1 Score: 190.66 bits (483), Expect = 4.974e-63
Identity = 86/137 (62.77%), Postives = 114/137 (83.21%), Query Frame = 3
Query:  114 MSLIMPQK--FNHILRVMNTNIDGERTIVYALTAIRGIGRRFAHVVCKKAEVDVNKRAGEITDDELEKITTVMANPTVYKIPKWFLNRQRDIKDGANLQIMANGLDNKLREDLERLKKIKCHRGLRHHWGLRVRGQH 518
            MSL++ ++  F HILR++NTN+DG   IVYALT I+G+GRR++++VCKKA+VD++KRAGE+T +ELE+I  +M NPT YKIP WFLNRQ DI DG +   +AN +++KLR+DLERLKKI+ HRG+RH WGLRVRGQH
Sbjct:    1 MSLVVQEQGSFQHILRLLNTNVDGNIKIVYALTTIKGVGRRYSNLVCKKADVDLHKRAGELTQEELERIVQIMQNPTHYKIPAWFLNRQNDITDGKDYHTLANNVESKLRDDLERLKKIRAHRGIRHFWGLRVRGQH 137          
BLAST of 40S ribosomal protein S18 vs. Ensembl Yeast
Match: RPS18A (Protein component of the small (40S) ribosomal subunit; homologous to mammalian ribosomal protein S18 and bacterial S13; RPS18A has a paralog, RPS18B, that arose from the whole genome duplication; protein increases in abundance and relocalizes from cytoplasm to nuclear foci upon DNA replication stress [Source:SGD;Acc:S000002858])

HSP 1 Score: 190.66 bits (483), Expect = 4.974e-63
Identity = 86/137 (62.77%), Postives = 114/137 (83.21%), Query Frame = 3
Query:  114 MSLIMPQK--FNHILRVMNTNIDGERTIVYALTAIRGIGRRFAHVVCKKAEVDVNKRAGEITDDELEKITTVMANPTVYKIPKWFLNRQRDIKDGANLQIMANGLDNKLREDLERLKKIKCHRGLRHHWGLRVRGQH 518
            MSL++ ++  F HILR++NTN+DG   IVYALT I+G+GRR++++VCKKA+VD++KRAGE+T +ELE+I  +M NPT YKIP WFLNRQ DI DG +   +AN +++KLR+DLERLKKI+ HRG+RH WGLRVRGQH
Sbjct:    1 MSLVVQEQGSFQHILRLLNTNVDGNIKIVYALTTIKGVGRRYSNLVCKKADVDLHKRAGELTQEELERIVQIMQNPTHYKIPAWFLNRQNDITDGKDYHTLANNVESKLRDDLERLKKIRAHRGIRHFWGLRVRGQH 137          
BLAST of 40S ribosomal protein S18 vs. Ensembl Nematostella
Match: EDO36934 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SH82])

HSP 1 Score: 218.009 bits (554), Expect = 3.266e-73
Identity = 94/135 (69.63%), Postives = 123/135 (91.11%), Query Frame = 3
Query:  114 MSLIMPQKFNHILRVMNTNIDGERTIVYALTAIRGIGRRFAHVVCKKAEVDVNKRAGEITDDELEKITTVMANPTVYKIPKWFLNRQRDIKDGANLQIMANGLDNKLREDLERLKKIKCHRGLRHHWGLRVRGQH 518
            MSL++P+KF HILRV+NTNIDG++ I++A+T+I+G+GRR+A++VCKKA++D+NKRAGE+T+DE+E++ T+M NP  YKIP WFLNRQ+D KDG   QI+ANGLDNK+REDLERLKKI+ HRGLRH+WGLRVRGQH
Sbjct:    1 MSLVIPEKFQHILRVLNTNIDGKQKIMFAMTSIKGVGRRYANIVCKKADIDMNKRAGELTEDEVERVVTIMQNPRQYKIPDWFLNRQKDHKDGKYSQILANGLDNKMREDLERLKKIRAHRGLRHYWGLRVRGQH 135          
BLAST of 40S ribosomal protein S18 vs. Ensembl Medaka
Match: rps18 (ribosomal protein S18 [Source:NCBI gene;Acc:101166313])

HSP 1 Score: 218.394 bits (555), Expect = 4.285e-72
Identity = 95/135 (70.37%), Postives = 120/135 (88.89%), Query Frame = 3
Query:  114 MSLIMPQKFNHILRVMNTNIDGERTIVYALTAIRGIGRRFAHVVCKKAEVDVNKRAGEITDDELEKITTVMANPTVYKIPKWFLNRQRDIKDGANLQIMANGLDNKLREDLERLKKIKCHRGLRHHWGLRVRGQH 518
            MSL++P+KF HILRV+NTNIDG R I +A+TAI+G+GRR+AHVV +KA++D+NKRAGE+T++E+E++ T+M NP  YKIP WFLNRQ+D+KDG   Q++ANGLDNKLREDLERLKKI+ HRGLRH WGLRVRGQH
Sbjct:   63 MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLNKRAGELTEEEVERVVTIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQH 197          
BLAST of 40S ribosomal protein S18 vs. Planmine SMEST
Match: SMESG000004171.1 (SMESG000004171.1)

HSP 1 Score: 280.796 bits (717), Expect = 9.042e-98
Identity = 135/135 (100.00%), Postives = 135/135 (100.00%), Query Frame = 3
Query:  114 MSLIMPQKFNHILRVMNTNIDGERTIVYALTAIRGIGRRFAHVVCKKAEVDVNKRAGEITDDELEKITTVMANPTVYKIPKWFLNRQRDIKDGANLQIMANGLDNKLREDLERLKKIKCHRGLRHHWGLRVRGQH 518
            MSLIMPQKFNHILRVMNTNIDGERTIVYALTAIRGIGRRFAHVVCKKAEVDVNKRAGEITDDELEKITTVMANPTVYKIPKWFLNRQRDIKDGANLQIMANGLDNKLREDLERLKKIKCHRGLRHHWGLRVRGQH
Sbjct:    1 MSLIMPQKFNHILRVMNTNIDGERTIVYALTAIRGIGRRFAHVVCKKAEVDVNKRAGEITDDELEKITTVMANPTVYKIPKWFLNRQRDIKDGANLQIMANGLDNKLREDLERLKKIKCHRGLRHHWGLRVRGQH 135          
BLAST of 40S ribosomal protein S18 vs. Planmine SMEST
Match: SMESG000039926.1 (SMESG000039926.1)

HSP 1 Score: 280.411 bits (716), Expect = 1.417e-97
Identity = 134/135 (99.26%), Postives = 135/135 (100.00%), Query Frame = 3
Query:  114 MSLIMPQKFNHILRVMNTNIDGERTIVYALTAIRGIGRRFAHVVCKKAEVDVNKRAGEITDDELEKITTVMANPTVYKIPKWFLNRQRDIKDGANLQIMANGLDNKLREDLERLKKIKCHRGLRHHWGLRVRGQH 518
            MSLIMPQKFNHILRVMNTNIDGERTIVYALTAIRG+GRRFAHVVCKKAEVDVNKRAGEITDDELEKITTVMANPTVYKIPKWFLNRQRDIKDGANLQIMANGLDNKLREDLERLKKIKCHRGLRHHWGLRVRGQH
Sbjct:    1 MSLIMPQKFNHILRVMNTNIDGERTIVYALTAIRGVGRRFAHVVCKKAEVDVNKRAGEITDDELEKITTVMANPTVYKIPKWFLNRQRDIKDGANLQIMANGLDNKLREDLERLKKIKCHRGLRHHWGLRVRGQH 135          
BLAST of 40S ribosomal protein S18 vs. Planmine SMEST
Match: SMESG000039926.1 (SMESG000039926.1)

HSP 1 Score: 271.937 bits (694), Expect = 2.328e-94
Identity = 130/131 (99.24%), Postives = 131/131 (100.00%), Query Frame = 3
Query:  126 MPQKFNHILRVMNTNIDGERTIVYALTAIRGIGRRFAHVVCKKAEVDVNKRAGEITDDELEKITTVMANPTVYKIPKWFLNRQRDIKDGANLQIMANGLDNKLREDLERLKKIKCHRGLRHHWGLRVRGQH 518
            MPQKFNHILRVMNTNIDGERTIVYALTAIRG+GRRFAHVVCKKAEVDVNKRAGEITDDELEKITTVMANPTVYKIPKWFLNRQRDIKDGANLQIMANGLDNKLREDLERLKKIKCHRGLRHHWGLRVRGQH
Sbjct:    1 MPQKFNHILRVMNTNIDGERTIVYALTAIRGVGRRFAHVVCKKAEVDVNKRAGEITDDELEKITTVMANPTVYKIPKWFLNRQRDIKDGANLQIMANGLDNKLREDLERLKKIKCHRGLRHHWGLRVRGQH 131          
The following BLAST results are available for this feature:
BLAST of 40S ribosomal protein S18 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RPS182.205e-7270.37ribosomal protein S18 [Source:HGNC Symbol;Acc:HGNC... [more]
RPS182.205e-7270.37ribosomal protein S18 [Source:HGNC Symbol;Acc:HGNC... [more]
RPS182.205e-7270.37ribosomal protein S18 [Source:HGNC Symbol;Acc:HGNC... [more]
RPS182.205e-7270.37ribosomal protein S18 [Source:HGNC Symbol;Acc:HGNC... [more]
RPS182.205e-7270.37ribosomal protein S18 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of 40S ribosomal protein S18 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rps-186.335e-7170.37Ribosomal Protein, Small subunit [Source:UniProtK... [more]
back to top
BLAST of 40S ribosomal protein S18 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
RpS181.073e-6462.96gene:FBgn0010411 transcript:FBtr0086274[more]
RpS181.073e-6462.96gene:FBgn0010411 transcript:FBtr0086273[more]
back to top
BLAST of 40S ribosomal protein S18 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rps181.196e-7371.85ribosomal protein S18 [Source:NCBI gene;Acc:192300... [more]
rps187.255e-4766.33ribosomal protein S18 [Source:NCBI gene;Acc:192300... [more]
rps185.760e-3380.00ribosomal protein S18 [Source:NCBI gene;Acc:192300... [more]
rps185.760e-3380.00ribosomal protein S18 [Source:NCBI gene;Acc:192300... [more]
rps181.271e-1782.50ribosomal protein S18 [Source:NCBI gene;Acc:192300... [more]
back to top
BLAST of 40S ribosomal protein S18 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rps182.759e-7371.85ribosomal protein S18 [Source:NCBI gene;Acc:549112... [more]
rps181.086e-7268.28ribosomal protein S18 [Source:NCBI gene;Acc:549112... [more]
back to top
BLAST of 40S ribosomal protein S18 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rps181.514e-7270.37ribosomal protein S18 [Source:MGI Symbol;Acc:MGI:9... [more]
Rps18-ps51.350e-7170.37ribosomal protein S18, pseudogene 5 [Source:MGI Sy... [more]
Gm102601.350e-7169.63predicted gene 10260 [Source:MGI Symbol;Acc:MGI:36... [more]
Rps184.272e-4562.00ribosomal protein S18 [Source:MGI Symbol;Acc:MGI:9... [more]
Rps181.521e-1164.86ribosomal protein S18 [Source:MGI Symbol;Acc:MGI:9... [more]
back to top
BLAST of 40S ribosomal protein S18 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8IT98|RS18_ARGIR3.300e-7371.1140S ribosomal protein S18 OS=Argopecten irradians ... [more]
sp|Q8JGS9|RS18_DANRE9.031e-7371.8540S ribosomal protein S18 OS=Danio rerio OX=7955 G... [more]
sp|Q8ISP0|RS18_BRABE2.498e-7269.6340S ribosomal protein S18 OS=Branchiostoma belcher... [more]
sp|Q90YQ5|RS18_ICTPU4.133e-7270.3740S ribosomal protein S18 OS=Ictalurus punctatus O... [more]
sp|P62271|RS18_RAT1.059e-7170.3740S ribosomal protein S18 OS=Rattus norvegicus OX=... [more]
back to top
BLAST of 40S ribosomal protein S18 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A3F4S56.583e-7375.56Ribosomal protein S18 OS=Taenia asiatica OX=60517 ... [more]
A8UA217.393e-7274.07Putative ribosomal protein S18 OS=Sipunculus nudus... [more]
A0A0A0R2459.509e-7274.0740S ribosomal protein OS=Phragmatopoma lapidosa OX... [more]
A0A0R3X6703.067e-7173.33Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
B2YI163.384e-7171.85Putative 40S ribosomal protein RPS18 OS=Phoronis m... [more]
back to top
BLAST of 40S ribosomal protein S18 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rps187.842e-7371.64ribosomal protein S18 [Source:NCBI gene;Acc:192300... [more]
rps182.306e-4565.98ribosomal protein S18 [Source:NCBI gene;Acc:192300... [more]
back to top
BLAST of 40S ribosomal protein S18 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 40S ribosomal protein S18 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
RPS18B4.974e-6362.77Protein component of the small (40S) ribosomal sub... [more]
RPS18A4.974e-6362.77Protein component of the small (40S) ribosomal sub... [more]
back to top
BLAST of 40S ribosomal protein S18 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO369343.266e-7369.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 40S ribosomal protein S18 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rps184.285e-7270.37ribosomal protein S18 [Source:NCBI gene;Acc:101166... [more]
back to top
BLAST of 40S ribosomal protein S18 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000004171.19.042e-98100.00SMESG000004171.1[more]
SMESG000039926.11.417e-9799.26SMESG000039926.1[more]
SMESG000039926.12.328e-9499.24SMESG000039926.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035710 ID=SMED30035710|Name=40S ribosomal protein S18|organism=Schmidtea mediterranea sexual|type=transcript|length=615bp
CTAAATTGATCGAAAATATTTTGTAATTTATAATTATCGTTAAATTGTTT
AAATATTCATTCTTGAAAAATTATTTTTGATTTTCAAATACTAAATTTGT
TATTTTCTTAACAATGTCTTTAATTATGCCTCAAAAATTCAACCACATTC
TTCGTGTGATGAATACAAATATAGATGGAGAAAGGACTATTGTTTATGCT
CTTACTGCTATTAGGGGTATTGGAAGACGTTTTGCACATGTCGTCTGTAA
AAAAGCAGAAGTCGATGTAAATAAACGAGCTGGAGAGATAACTGACGATG
AATTGGAGAAAATTACAACTGTTATGGCTAATCCAACTGTATACAAAATC
CCTAAGTGGTTCCTTAATAGACAAAGAGATATTAAAGATGGTGCAAACTT
ACAAATTATGGCTAATGGTTTGGATAATAAGCTTCGTGAAGATTTGGAAC
GATTAAAGAAAATCAAATGTCACAGAGGTCTTAGACACCATTGGGGATTG
AGAGTTCGTGGTCAACATACAAAGACTACCGGAAGACGTGGAAGAACTGT
TGGAGTTTCAAAGAAGAAGGGAGCATAAGATGTAATTAAATAAATTTTGG
ATACTAGAAAAAAAA
back to top

protein sequence of SMED30035710-orf-1

>SMED30035710-orf-1 ID=SMED30035710-orf-1|Name=SMED30035710-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=155bp
MSLIMPQKFNHILRVMNTNIDGERTIVYALTAIRGIGRRFAHVVCKKAEV
DVNKRAGEITDDELEKITTVMANPTVYKIPKWFLNRQRDIKDGANLQIMA
NGLDNKLREDLERLKKIKCHRGLRHHWGLRVRGQHTKTTGRRGRTVGVSK
KKGA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR02743730s_Rbsml_prot_S13_C
IPR001892Ribosomal_S13
IPR018269Ribosomal_S13_CS
IPR010979Ribosomal_S13-like_H2TH
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005840ribosome
GO:0005737cytoplasm
GO:0005829cytosol
GO:0015935small ribosomal subunit
GO:0030529intracellular ribonucleoprotein complex
Vocabulary: biological process
TermDefinition
GO:0006412translation
GO:0007275multicellular organism development
GO:0042254ribosome biogenesis
GO:0051726regulation of cell cycle
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003735structural constituent of ribosome
GO:0003676nucleic acid binding
GO:0019843rRNA binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001892Ribosomal protein S13PFAMPF00416Ribosomal_S13coord: 14..142
e-value: 5.5E-53
score: 178.8
IPR001892Ribosomal protein S13PIRSFPIRSF002134RPS13p_RPS13a_RPS18e_RPS13ocoord: 5..154
e-value: 3.2E-39
score: 131.5
IPR001892Ribosomal protein S13PROSITEPS50159RIBOSOMAL_S13_2coord: 15..145
score: 34.617
NoneNo IPR availableGENE3DG3DSA:1.10.8.50coord: 1..80
e-value: 4.6E-35
score: 121.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 132..154
NoneNo IPR availablePANTHERPTHR1087130S RIBOSOMAL PROTEIN S13/40S RIBOSOMAL PROTEIN S18coord: 1..152
NoneNo IPR availablePANTHERPTHR10871:SF340S RIBOSOMAL PROTEIN S18coord: 1..152
IPR02743730s ribosomal protein S13, C-terminalGENE3DG3DSA:4.10.910.10coord: 92..143
e-value: 2.3E-26
score: 93.4
IPR018269Ribosomal protein S13, conserved sitePROSITEPS00646RIBOSOMAL_S13_1coord: 121..134
IPR010979Ribosomal protein S13-like, H2THSUPERFAMILYSSF46946S13-like H2TH domaincoord: 13..152