Macrophage-expressed gene 1 protein

Overview
NameMacrophage-expressed gene 1 protein
Smed IDSMED30035691
Length (bp)2718
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Macrophage-expressed gene 1 protein (SMED30035691) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Macrophage-expressed gene 1 protein (SMED30035691) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Human
Match: MPEG1 (macrophage expressed 1 [Source:HGNC Symbol;Acc:HGNC:29619])

HSP 1 Score: 386.726 bits (992), Expect = 1.629e-121
Identity = 209/621 (33.66%), Postives = 336/621 (54.11%), Query Frame = 3
Query:  306 ERQVHKCKLTNKQYAFDILPGSGWDNLENKELGQVLEISYKECLASNDGSFLIPDNSVIIPIKRSTVELASDIFDHFSNFTSATSKSINADASYATPSYQISGSFSWEKKDVKNDQIKEKSLVSRVQLRHEFYTVSFQPDSKFDRQFKNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITSRTLPEFDEKIIYKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCSGPD-----YQCMDVAAKNPVTNSYACPDNYDTIELQSGLN-------KCINYCTKYLFSTQCHYEC--------SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPFIDLGFGPNMTVITSLDTPMGVRLSVDENGK-W---SHNHQYKL 2096
            E  V KCK   K    ++LPG GWDNL N ++G+V+E++Y  C  + DG ++IPD    IP K+S +E+ S+I + ++N+ S+TS SIN + S  +   +++G FS E + +K  Q+K++++ +RVQ+R+  YTV   P  +    F+  +LDI   L E   T    YLA+L+V ++GTHV  SVDAGA LI+ D L++++++  +   + + A+A  +    ++   +  Y         + SN  +++V++ GG+PF     L+ W++ +  +LVAIDR G PL + I    LP+    ++ K++  ++ AV RYY  NT  GC ++ S NFN  AN D G+CE   T +SFGG +Q C+          C  +  KNP+T  ++CP  Y  + L S ++       +C   CT  +F   C   C        +++  +WC ++++   + G LFGG +++   NP+TN+ SCP  Y   R   N KVC + +        +PFGGF+SC VGNPL+D  +      P    + C  G+S H A++   CQ+SYCVK+   +    PP   PPF      P +    + +T   V ++  EN + W   S  HQ++L
Sbjct:   28 EVGVQKCKNALKLPVLEVLPGGGWDNLRNVDMGRVMELTYSNCRTTEDGQYIIPDEIFTIPQKQSNLEMNSEILESWANYQSSTSYSINTELSLFS---KVNGKFSTEFQRMKTLQVKDQAITTRVQVRNLVYTVKINPTLELSSGFRKELLDISDRL-ENNQTRMATYLAELLVLNYGTHVTTSVDAGAALIQEDHLRASFLQDSQSSRSAVTASAGLAFQNTVNFKFEENYTSQNVLTKSYLSNRTNSRVQSIGGVPFYPGITLQAWQQGITNHLVAIDRSGLPLHFFINPNMLPDLPGPLVKKVSKTVETAVKRYYTFNTYPGCTDLNSPNFNFQANTDDGSCEGKMTNFSFGGVYQECTQLSGNRDVLLCQKLEQKNPLTGDFSCPSGYSPVHLLSQIHEEGYNHLECHRKCTLLVF---CKTVCEDVFQVAKAEFRAFWCVASSQVPENSGLLFGGLFSSKSINPMTNAQSCPAGYFPLRLFENLKVCVSQDYELGSRFAVPFGGFFSCTVGNPLVDPAISRDLGAPSL--KKCPGGFSQHPALISDGCQVSYCVKSGLFTGGSLPPARLPPFTR----PPLMSQAATNT---VIVTNSENARSWIKDSQTHQWRL 632          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Match: mpeg1.1 (macrophage expressed 1, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030131-7347])

HSP 1 Score: 358.992 bits (920), Expect = 3.170e-111
Identity = 206/575 (35.83%), Postives = 307/575 (53.39%), Query Frame = 3
Query:  324 CKLTNKQYAFDILPGSGWDNLENKELGQVLEISYKECLASNDGSFLIPDNSVIIPIKRSTVELASDIFDHFSNFTSATSKSINADASYATPSYQISGSFSWEKKDVKNDQIKEKSLVSRVQLRHEFYTVSFQPDSKFDRQFKNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITSRTLPEFDEKIIYKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCS--GPDYQ--CMDVAAKNPVTNSYACPDNYDTIELQS-----GLN--KCINYCTKYLF---STQCHYEC--------SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNA-KVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPF 1979
            C+  +   A ++LPG GWDNL N ++G+V+ +SY +C  + DG +LIPD   +IP K S VE  S+I   +    S+TS S+NAD S+ +    ++  FS E + +K  Q+KE S+ +RVQ+R+  YTV   PD   D +F  +  +I   + E   T +  YL++ +V D+GTHVI SVDAGATL++ D LK +Y+   + D + ++A+A  +    +  ++ G     ++  + +  N   + +++ GG  F     L+ W+++   NLVAIDR G PL Y +   T P+     + K+A+ +++A  RYY  NT  GC+N++S NFN  ANVD  +CE P T  SFGG +Q C+   PD    C + A KNP T  Y+CP +Y+T  L S     G N  +C  +C    F   ST C   C        ++    WCSST+KT  + G LFGG +     NPLT S SCP  Y   RF  N   +C + +        +PF GF+SC+ GNPL +                C   +S H+A +   CQ+ YCV++   S     P+  PPF
Sbjct:   33 CRKNSSLTALEVLPGGGWDNLRNIDMGRVMNLSYSQCQTTEDGVYLIPDEVFVIPQKVSGVETNSEIIMSWLEQKSSTSSSVNADVSFFS---VLNAKFSTENQRMKTHQVKEGSVTARVQVRNHLYTVKAYPDFTLDSRFAKQAEEIADAI-ENNQTRHANYLSEKLVLDYGTHVITSVDAGATLVQEDYLKMSYISNSQSDKSSVSASAGANFFDKVKFDIGGNTSQGSSQSSSYQGNITYSLIQSHGGALFYPGITLQKWQQSTLNNLVAIDRSGLPLHYFLNPSTFPDLPTPTVNKLASTVRKAAERYYKVNTIPGCVNVDSPNFNFQANVDDASCEGPITNLSFGGIYQRCTPLTPDGNIICDETAQKNPATGGYSCPQHYNTTLLHSEIVEKGFNHYECHTHCHSCGFLGLSTCCDKTCGDSYHVRRAKLETLWCSSTHKTPENSGYLFGGLFGPGIQNPLTKSSSCPPSYFTQRFLSNGMMICMSNDYEIGTRFSVPFAGFFSCQSGNPLSNG------------QSRCPPQFSQHLAAISDGCQVLYCVQSGVFSGGHLKPVRLPPF 591          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Match: mpeg1.1 (macrophage expressed 1, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030131-7347])

HSP 1 Score: 358.992 bits (920), Expect = 3.170e-111
Identity = 206/575 (35.83%), Postives = 307/575 (53.39%), Query Frame = 3
Query:  324 CKLTNKQYAFDILPGSGWDNLENKELGQVLEISYKECLASNDGSFLIPDNSVIIPIKRSTVELASDIFDHFSNFTSATSKSINADASYATPSYQISGSFSWEKKDVKNDQIKEKSLVSRVQLRHEFYTVSFQPDSKFDRQFKNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITSRTLPEFDEKIIYKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCS--GPDYQ--CMDVAAKNPVTNSYACPDNYDTIELQS-----GLN--KCINYCTKYLF---STQCHYEC--------SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNA-KVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPF 1979
            C+  +   A ++LPG GWDNL N ++G+V+ +SY +C  + DG +LIPD   +IP K S VE  S+I   +    S+TS S+NAD S+ +    ++  FS E + +K  Q+KE S+ +RVQ+R+  YTV   PD   D +F  +  +I   + E   T +  YL++ +V D+GTHVI SVDAGATL++ D LK +Y+   + D + ++A+A  +    +  ++ G     ++  + +  N   + +++ GG  F     L+ W+++   NLVAIDR G PL Y +   T P+     + K+A+ +++A  RYY  NT  GC+N++S NFN  ANVD  +CE P T  SFGG +Q C+   PD    C + A KNP T  Y+CP +Y+T  L S     G N  +C  +C    F   ST C   C        ++    WCSST+KT  + G LFGG +     NPLT S SCP  Y   RF  N   +C + +        +PF GF+SC+ GNPL +                C   +S H+A +   CQ+ YCV++   S     P+  PPF
Sbjct:   33 CRKNSSLTALEVLPGGGWDNLRNIDMGRVMNLSYSQCQTTEDGVYLIPDEVFVIPQKVSGVETNSEIIMSWLEQKSSTSSSVNADVSFFS---VLNAKFSTENQRMKTHQVKEGSVTARVQVRNHLYTVKAYPDFTLDSRFAKQAEEIADAI-ENNQTRHANYLSEKLVLDYGTHVITSVDAGATLVQEDYLKMSYISNSQSDKSSVSASAGANFFDKVKFDIGGNTSQGSSQSSSYQGNITYSLIQSHGGALFYPGITLQKWQQSTLNNLVAIDRSGLPLHYFLNPSTFPDLPTPTVNKLASTVRKAAERYYKVNTIPGCVNVDSPNFNFQANVDDASCEGPITNLSFGGIYQRCTPLTPDGNIICDETAQKNPATGGYSCPQHYNTTLLHSEIVEKGFNHYECHTHCHSCGFLGLSTCCDKTCGDSYHVRRAKLETLWCSSTHKTPENSGYLFGGLFGPGIQNPLTKSSSCPPSYFTQRFLSNGMMICMSNDYEIGTRFSVPFAGFFSCQSGNPLSNG------------QSRCPPQFSQHLAAISDGCQVLYCVQSGVFSGGHLKPVRLPPF 591          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Match: mpeg1.3 (macrophage expressed 1, tandem duplicate 3 [Source:ZFIN;Acc:ZDB-GENE-081105-5])

HSP 1 Score: 352.443 bits (903), Expect = 2.410e-109
Identity = 209/616 (33.93%), Postives = 328/616 (53.25%), Query Frame = 3
Query:  315 VHKCKLTNKQYAFDILPGSGWDNLENKELGQVLEISYKECLASNDGSFLIPDNSVIIPIKRSTVELASDIFDHFSNFTSATSKSINADASYATPSYQISGSFSWEKKDVKNDQIKEKSLVSRVQLRHEFYTVSFQPDSKFDRQFKNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTY-VGDTTSLNE-FNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITSRTLPEFDEKIIYKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCSGPDYQ----CMDVAAKNPVTNSYACPDNYDTIELQSGL-------NKCINYCTKYLF---STQCHYEC--------SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSC-PQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMRE-----QPPLYRPPFIDLGFGPNMTVITSLDTPMGVRLSVDENGKW 2072
            +++C   +   A ++LPG GWDNL N ++G+V+ +SY +C  + DG +LIPD   +IP K +TVE  S++   + +  S+TS SINAD S+ +    ++G FS E + +K  Q+KE S+ SRVQ+R+  YTV   P+   D +F  ++ +I   +   + T    YL++ ++ D+GTHVI SV+AGA+L++ D LK +Y+   + D + ++A+A F+      V L  +Y  G  TSLN  +  N   + +++ GG  F     L+ W+++   NLVAIDR G PL Y +   T P+  E ++ K+A  + +A  +YY  NT  GC+N++S+NFN  ANVD  +CE P T  SFGG +Q C+         C ++A KNP T  Y+C   Y+T  L+S +        +C + C    F   ST C   C        ++    WC ST K     G +FGG Y  +  NP T SY+C P ++V         VC + +  +A +  +PFGGF+SC+ GNPL +                C   +S H+A +   CQ+ YCV++   S  +      PP   PP + +    ++ V+T L+   G  + V ++  W
Sbjct:   30 LNECHKNSNLVALEVLPGGGWDNLRNIDMGRVMNLSYSQCQTTEDGVYLIPDEVFVIPQKENTVETNSEMIMSWLDQKSSTSSSINADVSFFS---WLNGKFSREHQRIKTHQVKESSVTSRVQVRNRLYTVKAYPNFPLDSRFAQQVEEIADAITNDQ-TRLATYLSEKLILDYGTHVITSVEAGASLVQEDYLKMSYILKNQLDLSSVSASAGFNFFD--KVKLDPSYNGGQKTSLNSSYQGNITYSLIQSHGGALFYPGMTLQKWQESTLNNLVAIDRSGLPLHYFLNPSTFPDISEALVRKLALSVSQAAEQYYKVNTIPGCVNVDSKNFNFQANVDDVSCEGPITNLSFGGMYQQCTPLTIDGSTICDEMAQKNPATGGYSCSQKYNTTLLRSEIIERGYTRYECQDNCRSCGFLGWSTCCSQTCNNVNYIRRAKVDTLWCYSTQKIPEYSGYIFGGLYGPSMQNPFTRSYTCPPNFFVQPILSRAIMVCLSNDYVKATKSAVPFGGFFSCQSGNPLSNG------------ESRCPPQFSQHLAAISDGCQVLYCVQSGVFSGGQLKPVLLPPYTSPPLVGMTVTNSVVVMTDLN---GSLVGVGQSRMW 624          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Match: mpeg1.2 (macrophage expressed 1, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-050522-305])

HSP 1 Score: 332.413 bits (851), Expect = 2.571e-101
Identity = 197/612 (32.19%), Postives = 310/612 (50.65%), Query Frame = 3
Query:  315 VHKCKLTNKQYAFDILPGSGWDNLENKELGQVLEISYKECLASNDGSFLIPDNSVIIPIKRSTVELASDIFDHFSNFTSATSKSINADASYATPSYQISGSFSWEKKDVKNDQIKEKSLVSRVQLRHEFYTVSFQPDSKFDRQFKNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITSRTLPEFDEKIIYKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCS--GPDYQ--CMDVAAKNPVTNSYACPDNYDTIEL-----QSGLN--KCINYCTK-YLFSTQCHYEC--------SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNA-KVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNA-----LSMREQPPLYRPPFIDLGFGPNMTVITSLDTPMGVRLSVDENGKW 2072
            + +C+  +   A ++LPG GWDNL N ++G+V+ ++Y +C  + DG +LIPD   +IP K S VE  S+    + +  S+TS SINADASY T    ++G FS E   +K  Q++  S+ +RVQ+R+  YTV+  PD   D +F  +I ++   + E   T    YL++ ++ ++GTHVI S+DAGATL++ D +K +YV     + + ++A+A  +   M++ N        T+    +  N   + V++ GG  F     ++ W+++ + +LVAIDR G P+ Y +     P+     ++K+A  +++A  RYY  NT  GC +  S+NFN  ANV+  +CE P T  +FGG +QTC+   PD    C + A +NP T  + C   Y    L     Q G N  +C   C   +L    CH  C        +Q   YWCS++     + G LFGG +  +  NP T S+ CP  Y    F  N  ++C + +        +PFGG +SC+ GNP   +               C   YS H+A +   CQ+ YCV++       L     PP  +PP I++     + V+T  D      + V    KW
Sbjct:   27 LRECRQNSNLTALEVLPGGGWDNLRNLDVGRVMNLTYSQCQTTEDGLYLIPDEVFVIPRKTSGVETHSETIMSWLDQRSSTSGSINADASYLTV---LNGKFSEENTRMKIHQVRGNSVTTRVQVRNHLYTVNAYPDFTLDSRFSQQISELADAI-ENNQTRQAMYLSEKVILEYGTHVITSIDAGATLVQEDYIKRSYVSDTNSERSSVSASAGINFFNMVNFNFGSKETEQTSETLTYQQNITYSLVQSHGGALFYQGITMQKWQESTQNHLVAIDRSGLPIHYFLNPAVFPDLPVPTLHKLAFSVQKAAERYYNINTTPGCTDQSSQNFNFQANVNDTSCEGPVTNLTFGGVYQTCTPESPDGNVICDEFAQRNPDTGDFTCRQPYSATRLHSENVQQGYNNYECHEECHSCWLILDCCHQVCGNVYYVRQAQIDTYWCSTSQTVPENTGYLFGGLFGPSLQNPQTKSHDCPANYFEQVFLTNGMRICLSNDYEAGTISSVPFGGLFSCQSGNPQAGNQYR------------CPPQYSQHLATISDGCQVLYCVQSGVFTGGQLKPVHLPPFTKPPLINMMATNTVAVMTEGDKAW---MRVGGTKKW 619          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Match: mpeg1.1 (macrophage expressed 1, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030131-7347])

HSP 1 Score: 68.5514 bits (166), Expect = 1.051e-13
Identity = 25/60 (41.67%), Postives = 41/60 (68.33%), Query Frame = 3
Query:  324 CKLTNKQYAFDILPGSGWDNLENKELGQVLEISYKECLASNDGSFLIPDNSVIIPIKRST 503
            C+  +   A ++LPG GWDNL N ++G+V+ +SY +C  + DG +LIPD   +IP K+++
Sbjct:   33 CRKNSSLTALEVLPGGGWDNLRNIDMGRVMNLSYSQCQTTEDGVYLIPDEVFVIPQKKTS 92          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Mouse
Match: Pfpl (pore forming protein-like [Source:MGI Symbol;Acc:MGI:1860266])

HSP 1 Score: 372.474 bits (955), Expect = 1.936e-116
Identity = 198/578 (34.26%), Postives = 320/578 (55.36%), Query Frame = 3
Query:  306 ERQVHKCKLTNKQYAFDILPGSGWDNLENKELGQVLEISYKECLASNDGSFLIPDNSVIIPIKRSTVELASDIFDHFSNFTSATSKSINADASYATPSYQISGSFSWEKKDVKNDQIKEKSLVSRVQLRHEFYTVSFQPDSKFDRQFKNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITSRTLPEFDEKIIYKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTC---SGPDY--QCMDVAAKNPVTNSYACPDNYDTIELQSGLN-------KCINYCTKYLF-STQCHYEC----SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPFIDL 1988
            E    KC+        ++LPG GWDNL N ++GQV++++Y  C  + DG ++IPD+   IP K S +E+ S+I D + N+ S TS SIN +  Y     +++G FS E + +K  Q++++++ +R Q+R+  YTV   P+++ +  FK  +++I   L E   T    YLA+L++ ++GTH+I SVDAGATL++ D +KS+Y+K  KG+   +AA+A F+   +++  ++  +         +  N   ++V++ GGIPF     +E W+K +  +LVA+DR G PL + I    LP F   ++ ++A  ++ A   YY  NT  GC N+ S NF+  AN D G+C+       FGG +Q C   SG DY   C+D   KNP+T  ++CP +Y  + L S  +       +C + C   +F  T C  E     ++ + YWC+++++   + G LFGG +T+   NP+TN  SCP  Y   +   N KVC +L+     ++ +PFGGF+SC  GNPL      +   +  + P+ C  G+S  +A +   CQ+SYCVK    +     P   PP+  L
Sbjct:   28 EYGFQKCQNALNLPVLEVLPGGGWDNLRNMDMGQVMDLTYNNCKTTEDGQYIIPDDVFTIPQKESNLEMNSEILDSWENYRSTTSFSINLNLDYRP---RVNGKFSSEFQRIKTTQVRDQAVTTRAQVRNLVYTVKANPNAELNLGFKKELMEICDRL-EKNQTKMATYLAELLILNYGTHIITSVDAGATLVQEDHVKSSYLKNNKGNRAAVAASAGFTFAKVVNFKIETGFEYQNNLATGYLQNRTGSRVQSIGGIPFYPGMTIETWQKGIINHLVAVDRAGLPLHFFIKPEKLPAFPRHLVEQLAKTVETAAESYYNFNTYPGCTNINSPNFDFQANTDDGSCDGKLVNAPFGGVYQLCRQLSGHDYDDMCLDFHQKNPLTGDFSCPPDYTPVHLLSQTHEKGYTGMECRDKCILKIFCRTSCKDEFRVAKAEVSSYWCAASSQVPENSGILFGGVFTDKSINPMTNEPSCPTSYFPLKLFENVKVCVSLDHELGPKYSVPFGGFFSCTKGNPLYGS-FTSGDLEKSFLPK-CPGGFSQQLAAIIDGCQVSYCVKAGVFTRASLAPARLPPYTQL 599          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Mouse
Match: Mpeg1 (macrophage expressed gene 1 [Source:MGI Symbol;Acc:MGI:1333743])

HSP 1 Score: 369.392 bits (947), Expect = 4.087e-115
Identity = 195/591 (32.99%), Postives = 326/591 (55.16%), Query Frame = 3
Query:  324 CKLTNKQYAFDILPGSGWDNLENKELGQVLEISYKECLASNDGSFLIPDNSVIIPIKRSTVELASDIFDHFSNFTSATSKSINADASYATPSYQISGSFSWEKKDVKNDQIKEKSLVSRVQLRHEFYTVSFQPDSKFDRQFKNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITSRTLPEFDEKIIYKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCS--GPDYQCMDVAAKNPVTNSYACPDNYDTIELQSGLN-------KCINYCTKYLFSTQCHYEC--------SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVK-----NNALSMREQPPLYRPPFIDLGFGPNMTVITSLDT 2030
            CK   K    ++LPG GWDNL N ++G+V++++Y  C  + DG ++IPD    IP K S +E+ S++ + + N+ S TS SIN + +  +   +++G FS E + +K  Q+K++++ +RVQ+R+  YTV   P S+    F   ++DI   L E   T    YLA+L++ ++GTHVI SVDAGA L++ D ++S+++   +     + A+A  +   +++  ++  Y+  T+   ++ SN  +++V++FGG+PF     LE W+K +  +LVAIDR G PL + I    LP     ++ K++  ++ AV  YY  NT  GC N++S NFN  AN+D  +C+   T ++FGG +Q C+    D  C ++  KN +T  ++CP  Y  + L S  +       +C   CT  +F   C   C        +++  YWC +  +   + G LFGG +T+   NP+TN+ SCP  Y+      + KVC +L+     +  +PFGGF+SC +GNPL++       + P    + C  G+S H+A++   CQ+SYCVK       +L     PP  +PP +      N  ++T+ +T
Sbjct:   41 CKNALKLPVLEVLPGGGWDNLRNVDMGRVMDLTYTNCKTTEDGQYIIPDEVYTIPQKESNLEMNSEVLESWMNYQSTTSLSINTELALFS---RVNGKFSTEFQRMKTLQVKDQAVTTRVQVRNRIYTVKTTPTSELSLGFTKALMDICDQL-EKNQTKMATYLAELLILNYGTHVITSVDAGAALVQEDHVRSSFLLDNQNSQNTVTASAGIAFLNIVNFKVETDYISQTSLTKDYLSNRTNSRVQSFGGVPFYPGITLETWQKGITNHLVAIDRAGLPLHFFIKPDKLPGLPGPLVKKLSKTVETAVRHYYTFNTHPGCTNVDSPNFNFQANMDDDSCDAKVTNFTFGGVYQECTELSGDVLCQNLEQKNLLTGDFSCPPGYTPVHLLSQTHEEGYSRLECKKKCTLKIF---CKTVCEDVFRVAKAEFRAYWCVAAGQVPDNSGLLFGGVFTDKTINPMTNAQSCPAGYIPLNLFESLKVCVSLDYELGFKFSVPFGGFFSCIMGNPLVNSDTAKDVRAPSL--KKCPGGFSQHLAVISDGCQVSYCVKAGIFTGGSLLPVRLPPYTKPPLMS-QVATNTVIVTNSET 621          
BLAST of Macrophage-expressed gene 1 protein vs. UniProt/SwissProt
Match: sp|Q2KJC3|MPEG1_BOVIN (Macrophage-expressed gene 1 protein OS=Bos taurus OX=9913 GN=MPEG1 PE=2 SV=2)

HSP 1 Score: 392.889 bits (1008), Expect = 3.714e-123
Identity = 203/578 (35.12%), Postives = 323/578 (55.88%), Query Frame = 3
Query:  306 ERQVHKCKLTNKQYAFDILPGSGWDNLENKELGQVLEISYKECLASNDGSFLIPDNSVIIPIKRSTVELASDIFDHFSNFTSATSKSINADASYATPSYQISGSFSWEKKDVKNDQIKEKSLVSRVQLRHEFYTVSFQPDSKFDRQFKNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITSRTLPEFDEKIIYKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTC---SGPDY--QCMDVAAKNPVTNSYACPDNYDTIEL-----QSGLN--KCINYCTKYLFSTQCHYEC--------SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPF 1979
            E     CK   K     +LPG GWDNL N + G+V+E++Y  C  + DG +++PD    IP K+S +E+ S I + + N+ S+TS SIN + S  +   +++G FS E + +K  Q+K++++ ++VQ+R+  YTV   PD++    FK  ++DI   L E   T    YLA+L+V ++GTHVI SVDAGA LI+ D ++S++++  +   + + A+A  +   +++   +  Y    T    + SN  +++V++FGG+PF     L+ W++ +  +LVA+DR G PL + I    LP+    ++ K++  ++ AV RYYA NT  GC ++ S NFN  AN D G+CE   T +SFGG +Q C   SG +    C ++  KNP+T S +CP  Y  ++L     + G N  +C   CT Y+F   C   C        +++  +WC+++ +   + G LFGG ++    NPLTN+ SCP  Y   +   N KVC +L+        +PFGGF+SC  GNPL+D         P    + C  G+S H+A++   CQ+SYCVK    +    PP+  PP+
Sbjct:   28 EPGFQNCKNALKLPVLPVLPGGGWDNLRNVDTGRVMELAYSHCRTTEDGQYIVPDEIFTIPQKQSNLEMNSKILESWVNYQSSTSNSINMELSLFS---KVNGKFSLEFQRIKTLQVKDQAVTTQVQVRNLVYTVKINPDAELSLGFKKALMDISEQL-ENNQTRMATYLAELLVLNYGTHVITSVDAGAALIQEDHIRSSFLQDSQSSRSAVTASAGITFLNIVNFKFEENYTSQNTFTKSYLSNRTNSRVQSFGGLPFYPGITLQAWQQGVSNHLVAMDRAGLPLYFFINPERLPDLPGPLVRKLSKTVEAAVRRYYAVNTYPGCTDLSSPNFNFQANTDDGSCEGKMTNFSFGGVYQECTQFSGNEVVQLCQNLEQKNPLTGSVSCPSGYSPVQLLTQTHEEGYNHLECSRKCTLYIF---CKTVCEDVFRVARAEFRAFWCAASGQVSENSGLLFGGLFSGKSINPLTNAQSCPAGYFQLKLFENLKVCASLDYELGYRFSIPFGGFFSCAAGNPLVDSATSKDLGAPSL--RKCPGGFSQHLALISDGCQVSYCVKAGLFTGGSLPPVRLPPY 596          
BLAST of Macrophage-expressed gene 1 protein vs. UniProt/SwissProt
Match: sp|Q2M385|MPEG1_HUMAN (Macrophage-expressed gene 1 protein OS=Homo sapiens OX=9606 GN=MPEG1 PE=1 SV=1)

HSP 1 Score: 386.726 bits (992), Expect = 7.823e-121
Identity = 209/621 (33.66%), Postives = 336/621 (54.11%), Query Frame = 3
Query:  306 ERQVHKCKLTNKQYAFDILPGSGWDNLENKELGQVLEISYKECLASNDGSFLIPDNSVIIPIKRSTVELASDIFDHFSNFTSATSKSINADASYATPSYQISGSFSWEKKDVKNDQIKEKSLVSRVQLRHEFYTVSFQPDSKFDRQFKNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITSRTLPEFDEKIIYKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCSGPD-----YQCMDVAAKNPVTNSYACPDNYDTIELQSGLN-------KCINYCTKYLFSTQCHYEC--------SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPFIDLGFGPNMTVITSLDTPMGVRLSVDENGK-W---SHNHQYKL 2096
            E  V KCK   K    ++LPG GWDNL N ++G+V+E++Y  C  + DG ++IPD    IP K+S +E+ S+I + ++N+ S+TS SIN + S  +   +++G FS E + +K  Q+K++++ +RVQ+R+  YTV   P  +    F+  +LDI   L E   T    YLA+L+V ++GTHV  SVDAGA LI+ D L++++++  +   + + A+A  +    ++   +  Y         + SN  +++V++ GG+PF     L+ W++ +  +LVAIDR G PL + I    LP+    ++ K++  ++ AV RYY  NT  GC ++ S NFN  AN D G+CE   T +SFGG +Q C+          C  +  KNP+T  ++CP  Y  + L S ++       +C   CT  +F   C   C        +++  +WC ++++   + G LFGG +++   NP+TN+ SCP  Y   R   N KVC + +        +PFGGF+SC VGNPL+D  +      P    + C  G+S H A++   CQ+SYCVK+   +    PP   PPF      P +    + +T   V ++  EN + W   S  HQ++L
Sbjct:   28 EVGVQKCKNALKLPVLEVLPGGGWDNLRNVDMGRVMELTYSNCRTTEDGQYIIPDEIFTIPQKQSNLEMNSEILESWANYQSSTSYSINTELSLFS---KVNGKFSTEFQRMKTLQVKDQAITTRVQVRNLVYTVKINPTLELSSGFRKELLDISDRL-ENNQTRMATYLAELLVLNYGTHVTTSVDAGAALIQEDHLRASFLQDSQSSRSAVTASAGLAFQNTVNFKFEENYTSQNVLTKSYLSNRTNSRVQSIGGVPFYPGITLQAWQQGITNHLVAIDRSGLPLHFFINPNMLPDLPGPLVKKVSKTVETAVKRYYTFNTYPGCTDLNSPNFNFQANTDDGSCEGKMTNFSFGGVYQECTQLSGNRDVLLCQKLEQKNPLTGDFSCPSGYSPVHLLSQIHEEGYNHLECHRKCTLLVF---CKTVCEDVFQVAKAEFRAFWCVASSQVPENSGLLFGGLFSSKSINPMTNAQSCPAGYFPLRLFENLKVCVSQDYELGSRFAVPFGGFFSCTVGNPLVDPAISRDLGAPSL--KKCPGGFSQHPALISDGCQVSYCVKSGLFTGGSLPPARLPPFTR----PPLMSQAATNT---VIVTNSENARSWIKDSQTHQWRL 632          
BLAST of Macrophage-expressed gene 1 protein vs. UniProt/SwissProt
Match: sp|Q5RBP9|MPEG1_PONAB (Macrophage-expressed gene 1 protein OS=Pongo abelii OX=9601 GN=MPEG1 PE=2 SV=1)

HSP 1 Score: 386.341 bits (991), Expect = 8.972e-121
Identity = 208/621 (33.49%), Postives = 338/621 (54.43%), Query Frame = 3
Query:  306 ERQVHKCKLTNKQYAFDILPGSGWDNLENKELGQVLEISYKECLASNDGSFLIPDNSVIIPIKRSTVELASDIFDHFSNFTSATSKSINADASYATPSYQISGSFSWEKKDVKNDQIKEKSLVSRVQLRHEFYTVSFQPDSKFDRQFKNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITSRTLPEFDEKIIYKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCSGPD-----YQCMDVAAKNPVTNSYACPDNYDTIELQSGLN-------KCINYCTKYLFSTQCHYEC--------SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPFIDLGFGPNMTVITSLDTPMGVRLSVDENGK-W---SHNHQYKL 2096
            E  V KCK   K    ++LPG GWDNL N ++G+V+E++Y  C  + DG ++IPD    IP K+S +E+ S+I + ++N+ S+TS SIN + S  +   +++G FS E + +K  Q+K++++ +RVQ+R+  YTV   P  + +  F+  +LDI   L E   T    YLA+L+V ++GTHVI SVDAGA LI+ D +++++++  +   + + A+A  +    ++   +  Y         + SN  +++V++ GG+PF     L+ W++ +  +LVAIDR G PL + I    LP+    ++ K++  ++ AV RYY  NT  GC ++ S NFN  AN D G+CE   T +SFGG +Q C+          C  +  KNP+T  ++CP  Y  + L S ++       +C   CT  +F   C   C        +++  +WC ++++   + G LFGG +++   NP+TN+ SCP  Y       N KVC + +        +PFGGF+SC VGNPL+D  +      P    + C  G+S H+A++   CQ+SYCVK+   +    PP   PPF      P +    + +T   V ++  EN + W   S  HQ++L
Sbjct:   28 EVGVQKCKNALKLPVLEVLPGGGWDNLRNVDMGRVMELTYSNCRTTEDGQYIIPDEIFTIPQKQSNLEMNSEILESWANYQSSTSYSINTELSLFS---KVNGKFSTEFQRMKTLQLKDQAITTRVQVRNLIYTVKINPALELNWSFRKELLDISDRL-ENNQTRMATYLAELLVLNYGTHVITSVDAGAALIQEDHIRASFLQDSQSSRSAVTASAGLAFQNTVNFKFEENYTSQNVLTKSYLSNRTNSRVQSIGGVPFYPGITLQAWQQGITNHLVAIDRSGLPLHFFINPNMLPDLPGPLVKKVSKTVETAVKRYYTFNTYPGCTDLNSPNFNFQANTDDGSCEGKMTNFSFGGVYQECTQLSGNRDVLLCQKLEQKNPLTGDFSCPSGYSPVRLLSQIHEEGYNHLECHRKCTLLVF---CKTVCEDVFQVAKAEFRAFWCVASSQVPENSGLLFGGLFSSKSINPMTNAQSCPAGYFPLSLFENLKVCVSQDYELGSRFAVPFGGFFSCTVGNPLVDPAISRDLGVPSL--KKCPGGFSQHLALISDGCQVSYCVKSGLFTGGSLPPARLPPFTR----PPLMSQAATNT---VIVTNSENARSWIKDSQTHQWRL 632          
BLAST of Macrophage-expressed gene 1 protein vs. UniProt/SwissProt
Match: sp|Q9WV57|MPEG1_RAT (Macrophage-expressed gene 1 protein OS=Rattus norvegicus OX=10116 GN=Mpeg1 PE=2 SV=2)

HSP 1 Score: 372.859 bits (956), Expect = 1.389e-115
Identity = 206/608 (33.88%), Postives = 332/608 (54.61%), Query Frame = 3
Query:  279 SESNRDL--PSERQVHKCKLTNKQYAFDILPGSGWDNLENKELGQVLEISYKECLASNDGSFLIPDNSVIIPIKRSTVELASDIFDHFSNFTSATSKSINADASYATPSYQISGSFSWEKKDVKNDQIKEKSLVSRVQLRHEFYTVSFQPDSKFDRQFKNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITSRTLPEFDEKIIYKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCS--GPDYQCMDVAAKNPVTNSYACPDNYDTIELQSGLN-------KCINYCTKYLFSTQCHYEC--------SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVK-----NNALSMREQPPLYRPPFIDLGFGPNMTVITSLDT 2030
            +E+++ L  P       CK T K    ++LPG GWDNL N ++G+V++++Y  C  + DG ++IPD    IP K S +E+ S+I D + N+ S TS SIN + S  +   +++G FS E + +K  Q+K++++ +RVQ+R+  YTV   P S+    F N ++DI   L E   T    YLA+L+V ++GTHVI SVDAGA L++ D ++S+++   +     + A+A  +   +++  ++  +   T     + SN  +++V++FGGIPF     LE W+K +  +LVAIDR G PL + I    LP     ++ K++  ++ AV  YY  NT  GC N++S NFN  AN++  +C+   T ++FGG +Q C+    D  C ++  KN +T  ++CP  Y  + L S  +       +C   CT  +F   C   C        +Q+  YWC +T +   + G LFGG +T+   NP+TN+ SCP  Y+      + KVC +L+     +  +PFGGF+SC +GNPL++         P    + C  G+S H+A++   CQ+SYCVK       +L     PP  +PP +      N  ++TS +T
Sbjct:   17 AEADKPLRDPGMTGFQTCKDTLKLPVLEVLPGGGWDNLRNIDMGRVIDLTYTNCKTTEDGQYIIPDEVYTIPQKESNLEMNSEIRDSWVNYQSTTSFSINTELSLFS---KVNGKFSTEFQRMKTLQVKDQAVTTRVQVRNRIYTVKNSPTSELSFGFTNALMDICDQL-EKNQTKMATYLAELLVLNYGTHVITSVDAGAALVQEDHIRSSFLLDNQNSENTVTASAGIAFLNIVNFKVETDHTSQTLLTKSYLSNRTNSRVQSFGGIPFYPGITLETWQKGITNHLVAIDRAGLPLHFFIKPDKLPGLPGGLVKKLSKTVETAVRHYYTFNTHPGCTNVDSPNFNFQANMEDDSCDAKVTNFTFGGLYQECTELSGDALCQNLEQKNLLTGDFSCPSGYTPVHLLSQTHEEGYSRLECKKKCTLKIF---CKTVCEDVFRVAKAQFRAYWCVATGQVPDNSGLLFGGLFTDKSINPMTNAQSCPAGYIPLNLFESLKVCVSLDYELGYKFSVPFGGFFSCIMGNPLVNSDTAKDIGAPSL--KKCPGGFSQHLAVISDGCQVSYCVKAGIFTGGSLLPVRLPPYTKPPLMS-QVATNTVIVTSSET 614          
BLAST of Macrophage-expressed gene 1 protein vs. UniProt/SwissProt
Match: sp|A1L314|MPEG1_MOUSE (Macrophage-expressed gene 1 protein OS=Mus musculus OX=10090 GN=Mpeg1 PE=1 SV=1)

HSP 1 Score: 370.163 bits (949), Expect = 1.189e-114
Identity = 195/591 (32.99%), Postives = 326/591 (55.16%), Query Frame = 3
Query:  324 CKLTNKQYAFDILPGSGWDNLENKELGQVLEISYKECLASNDGSFLIPDNSVIIPIKRSTVELASDIFDHFSNFTSATSKSINADASYATPSYQISGSFSWEKKDVKNDQIKEKSLVSRVQLRHEFYTVSFQPDSKFDRQFKNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITSRTLPEFDEKIIYKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCS--GPDYQCMDVAAKNPVTNSYACPDNYDTIELQSGLN-------KCINYCTKYLFSTQCHYEC--------SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVK-----NNALSMREQPPLYRPPFIDLGFGPNMTVITSLDT 2030
            CK   K    ++LPG GWDNL N ++G+V++++Y  C  + DG ++IPD    IP K S +E+ S++ + + N+ S TS SIN + +  +   +++G FS E + +K  Q+K++++ +RVQ+R+  YTV   P S+    F   ++DI   L E   T    YLA+L++ ++GTHVI SVDAGA L++ D ++S+++   +     + A+A  +   +++  ++  Y+  T+   ++ SN  +++V++FGG+PF     LE W+K +  +LVAIDR G PL + I    LP     ++ K++  ++ AV  YY  NT  GC N++S NFN  AN+D  +C+   T ++FGG +Q C+    D  C ++  KN +T  ++CP  Y  + L S  +       +C   CT  +F   C   C        +++  YWC +  +   + G LFGG +T+   NP+TN+ SCP  Y+      + KVC +L+     +  +PFGGF+SC +GNPL++       + P    + C  G+S H+A++   CQ+SYCVK       +L     PP  +PP +      N  ++T+ +T
Sbjct:   34 CKNALKLPVLEVLPGGGWDNLRNVDMGRVMDLTYTNCKTTEDGQYIIPDEVYTIPQKESNLEMNSEVLESWMNYQSTTSLSINTELALFS---RVNGKFSTEFQRMKTLQVKDQAVTTRVQVRNRIYTVKTTPTSELSLGFTKALMDICDQL-EKNQTKMATYLAELLILNYGTHVITSVDAGAALVQEDHVRSSFLLDNQNSQNTVTASAGIAFLNIVNFKVETDYISQTSLTKDYLSNRTNSRVQSFGGVPFYPGITLETWQKGITNHLVAIDRAGLPLHFFIKPDKLPGLPGPLVKKLSKTVETAVRHYYTFNTHPGCTNVDSPNFNFQANMDDDSCDAKVTNFTFGGVYQECTELSGDVLCQNLEQKNLLTGDFSCPPGYSPVHLLSQTHEEGYSRLECKKKCTLKIF---CKTVCEDVFRVAKAEFRAYWCVAAGQVPDNSGLLFGGVFTDKTINPMTNAQSCPAGYIPLNLFESLKVCVSLDYELGFKFSVPFGGFFSCIMGNPLVNSDTAKDVRAPSL--KKCPGGFSQHLAVISDGCQVSYCVKAGIFTGGSLLPVRLPPYTKPPLMS-QVATNTVIVTNSET 614          
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Match: A0A2B4RFA8 (Macrophage-expressed gene 1 protein OS=Stylophora pistillata OX=50429 GN=Mpeg1 PE=4 SV=1)

HSP 1 Score: 442.58 bits (1137), Expect = 3.553e-139
Identity = 224/599 (37.40%), Postives = 338/599 (56.43%), Query Frame = 3
Query:  252 CGVLSFKCKSESNRDLPSERQVHKCKLTNKQYAFDILPGSGWDNLENKELGQVLEISYKECLASNDGSFLIPDNSVIIPIKRSTVELASDIFDHFSNFTSATSKSINADASYATPSYQISGSFSWEKKDVKNDQIKEKSLVSRVQLRHEFYTVSFQPDSKFDRQFKNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITSRTLPEFDEKIIYKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTC----SGPDYQCMDVAAKNPVTNSYACPDNYDTIELQSGL--NKCINYCTKYLFSTQCHYEC--SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPL---------------LDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPF 1979
            CG++S +  S     +   R    C L +  Y F++LPG GWDNL N  +G V  ++Y +C  S+DG +LIPD+  + P+K S V + ++++DH++N++S T+KSINA+AS       +SGS+S E + VK  Q+++KS+ +R QLRH+ YTV  QPD+     FK+R+L+I + L+   +T Y  +LA ++VRDFGTH + SV AGA L K D L   +V  F  D +KI AAAS S   +   +   T   D   L+++  N+A + V TFGG PF  NF + +WE  +   LVA+DR G+PL +AIT  ++PE  E++++K+A+++++A+ +YY  NT  GC  M+S +F+  AN+D G+CE P   Y+FGG +QTC    S     C     KNP+T  Y C + Y+ + +  G     C   C  +     C   C  + Y  YWC +      + G LFGG Y+N   NP+T  +SCP  + A RFG    VC + +     +  +PFGGF+SC  GNPL                   L+        WP+ C  GYS H+  ++  C+I++CVK+N  + +  P + RPP+
Sbjct:   25 CGLVSSENDSSPRFPVGDPRN---CPLASGVYRFEVLPGGGWDNLRNLHMGAVSVMNYSKCKTSDDGKYLIPDDVFLYPVKESKVHVFAEMYDHWNNYSSTTTKSINAEASGTFGFGSVSGSYSSEFESVKKHQVEDKSVTTRAQLRHDLYTVKLQPDAPLQPAFKSRLLEIASHLQH-NNTAYASFLAQVLVRDFGTHYVTSVMAGAALAKVDHLTKKFVADFDEDKSKITAAASASFFGVFGASASYTQTTDKKVLDQYTKNTAYSTVYTFGGPPFRVNFTINEWEDQMADELVAVDRSGDPLHFAITHGSVPELSEELVFKLASVVEKAIKQYYEHNTIKGCTKMDSPDFSFQANLDDGSCESPTNNYTFGGVYQTCQCEGSPSSNPCGSFVQKNPLTADYTCSNGYEPVMVHQGRTPQTCHRECHGWWIFKSCDTYCGFANYYTYWCVAKGAVPPNTGYLFGGLYSNVLKNPVTQDHSCPLKFYALRFGATMHVCVSDDYELGFQQSVPFGGFFSCNTGNPLGVKKSSSRAKGSNGHSSLELFVKQSGSSVWPKTCPIGYSQHLGAIEENCEINFCVKSNVFNSKGFPIIKRPPY 619          
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Match: A0A210Q242 (Macrophage-expressed gene 1 protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT10885 PE=4 SV=1)

HSP 1 Score: 433.721 bits (1114), Expect = 4.724e-136
Identity = 223/594 (37.54%), Postives = 340/594 (57.24%), Query Frame = 3
Query:  351 FDILPGSGWDNLENKELGQVLEISYKECLASNDGSFLIPDNSVIIPIKRSTVELASDIFDHFSNFTSATSKSINADASYATPSYQISGSFSWEKKDVKNDQIKEKSLVSRVQLRHEFYTVSFQPDSKFDRQFKNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFG-SNFKLEDWEKTLETNLVAIDRKGEPLSYAITSRTLPEFDEKIIYKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCSGP----DYQCMDVAAKNPVTNSYACPDNYDTIELQSGLNKCINY------CTKYLFSTQC-HYECSQYALY---WCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLL-----DDPLYNITQD------------PKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPFIDL---GFGPNMTVITSLD 2027
            +++LPG GWDNL NK  GQV+  +Y  C  ++DG +L+PD    +P+K+S +E  +++F H+ N+TS TS ++NA+A +    + I GSFS E   V++ Q+ ++S+ +RVQ+R+  Y+   QPD+ F+ +FK R+L I   + + + T   +Y + L+VRDFGTHVI SVDAGA L++ D +K+ Y + +  D +K+ A+AS S  ++  +     +      ++++  N   ++ +T GG  F   NF L DW +++  NLVA+DR G+PL + IT   LPE    ++Y++   +K+A+N YY  N   GC N +S NF+  ANVD G C+  +  Y+FGG +QTCS         C D+   NP+T   +CP NY+ + +  G+ +  N       C    FST C  Y  SQ A Y   WC +T K     G LFGG +T+T  NPLT   +CP Y+ A +   + +VC + +      + +PF GF+SC+ GNPL      +D       D            P +WP+GC TGYS H+A+V   C+ISYC+K NALS    P + RPPF+++   GF  N +V+ S D
Sbjct:   55 YEVLPGGGWDNLRNKHGGQVIYYNYSLCQTTDDGQYLLPDGINTVPLKKSKLETFAELFTHWQNYTSTTSSTVNAEAGFHIEHFGIGGSFSHETGSVRSRQMMDESVTTRVQMRYVRYSAKLQPDTAFNPKFKARLLTIATQIAKNQ-TNMARYESQLLVRDFGTHVITSVDAGAALVQQDQIKTTYARSYSMDKSKVMASASASFGSVFGIKTGYDHSTSNEMIDQYLGNRTHSETDTIGGSVFQPQNFSLNDWAESVAENLVAVDRAGDPLHFVITPMALPELPSSVVYELIMHVKDAINLYYKHNIYKGCTNADSPNFSFQANVDDGTCQSLSNNYTFGGVYQTCSLSGNIRSNTCADLRQMNPLTGDDSCPPNYEAVMIDKGIKRTPNTVRRCHSCGFLGFSTCCGDYAASQTASYTGFWCVTTGKVPADSGYLFGGLFTSTIGNPLTGGRTCPPYFYALKVSSSLRVCVSDDYELGYRYSVPFAGFFSCRTGNPLKLTSDEEDRHKRSNTDMFVLETFLKSAGPSHWPRGCPTGYSEHMAVVANGCEISYCIKANALSGEGLPTIVRPPFMEIPITGFSDNSSVMISED 647          
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Match: A7SEK6 (Predicted protein (Fragment) OS=Nematostella vectensis OX=45351 GN=v1g115372 PE=4 SV=1)

HSP 1 Score: 426.402 bits (1095), Expect = 3.012e-135
Identity = 217/552 (39.31%), Postives = 325/552 (58.88%), Query Frame = 3
Query:  354 DILPGSGWDNLENKELGQVLEISYKECLASNDGSFLIPDNSVIIPIKRSTVELASDIFDHFSNFTSATSKSINADASYATPSYQISGSFSWEKKDVKNDQIKEKSLVSRVQLRHEFYTVSFQPDSKFDRQFKNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITSRTLPEFDEKIIYKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTC----SGPDYQCMDVAAKNPVTNSYACPDNYDTIELQSGL--NKCINYCTK-YLFSTQCHYEC--SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPFI 1982
            ++LPG GWDNL N  +G V  ++Y  C +S+DG FL+PDN  + P+K+S V   ++ +DH++N++S T+KSINA+A  +     +SGSFS E + VK  Q+++K++ +RVQLRH FYT   QPDS     FK+R+L+I + L+   +T Y  +LA ++VRDFGTH + SVDAGA L K D L   +V     D +KI A+AS S       +   +   DT +L+E+   +  +   T+GG PF  NF + +WE  +   LVA+DR G+PL Y IT  +LPE  E+  +++A ++K A+ +YY  NT  GC  M+S NF+  AN+D G+C+ P   Y+FGG +QTC    S     C  +A KNP+T  Y C   Y+ + +  G     C   C + +LF  +C  +C    ++ YWC + +    + G LFGG Y++   NPLT  +SCP  + A +FG   KVC + +     +  LPFGGF+SC  GNPL         + P    +GC TG+S H+  ++  C+I YCVK+N  +++  P + RPP++
Sbjct:    1 EVLPGGGWDNLRNLHMGAVSAMNYSLCRSSDDGKFLVPDNVFLYPVKKSKVNTFAEFYDHWNNYSSTTTKSINAEAKASFGFGSVSGSFSSEYESVKKHQVEDKTVTTRVQLRHVFYTAKLQPDSPLQPAFKDRLLEIASHLQH-NNTAYASFLAQVLVRDFGTHYVSSVDAGAVLAKVDHLTKKFVADSNEDKSKITASASASFFHFFGASGSYSKSTDTKTLDEYTKATVYSTTYTYGGPPFRVNFTINEWEDKMLDELVAVDRSGDPLHYTITPGSLPELCEQATFQLAAVVKNAIKQYYIHNTIKGCTKMDSPNFSFQANMDDGSCQSPTNNYTFGGVYQTCQTDGSPSSDPCAPLAQKNPLTADYTCTPGYEPVLVHQGRTPQSCHKDCHRVWLFFKRCSVQCGFGSFSTYWCVAKSAVPANSGYLFGGLYSDVLKNPLTQDHSCPLKFYALKFGATMKVCVSDDYELGYQQSLPFGGFFSCNAGNPL-------AFKKPPTGDKGCPTGFSQHLGAIEANCEIQYCVKSNVFNLQGLPIVRRPPYL 544          
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Match: K1RDW7 (MACPF domain-containing protein OS=Crassostrea gigas OX=29159 GN=CGI_10027905 PE=4 SV=1)

HSP 1 Score: 406.371 bits (1043), Expect = 1.403e-125
Identity = 210/581 (36.14%), Postives = 325/581 (55.94%), Query Frame = 3
Query:  327 KLTNKQYAFDILPGSGWDNLENKELGQVLEISYKECLASNDGSFLIPDNSVIIPIKRSTVELASDIFDHFSNFTSATSKSINADASYATPSYQISGSFSWEKKDVKNDQIKEKSLVSRVQLRHEFYTVSFQPDSKFDRQFKNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFG-SNFKLEDWEKTLETNLVAIDRKGEPLSYAITSRTLPEFDEKIIYKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTC--SGPDYQ--CMDVAAKNPVTNSYACPDNYDTIELQSGL------NKCINYCTKYLFSTQCH----YECSQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLL---------DDPLYNITQDPKY---WPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPFIDL 1988
            K+      F++LPG GWDNL+NKE G +++ +Y EC  ++DG +LIPD    +P+K S +E+  ++F H++NFTS TS S+N +A     S+ ISG +S E + V+  QI ++S+ +RVQ R+  Y+   QPD+  +  F++R+ +I   ++  K T   +Y + L+VRD+GTHVI SV AGA + + D +K+ +   +  D  ++ AAAS S   + +V  +  +   T  ++++  N   + +   GG  F  +NF L  W   L  +LVA+D+ G P+   I+++TLPE    I++ +   +K AV  YY  N   GC +++S NF+  ANVD G CE P T Y FGG +Q C  SG   Q  C  +  KNP+T + +CP  Y+++ L  G        +  ++C     S  C     Y  ++Y  +WC + +      G  FGG YTN   NPLT S  CP Y+   + G+  +VC + +      + +PF G +SC  GNPL           D L +++  PK    WP+GC TGYS H+A ++ +C+I+YCVK NA S +  PP+  PPF+DL
Sbjct:   46 KMGGNVARFEVLPGLGWDNLQNKEAGMLVQYNYSECRTTDDGRYLIPDGVFTVPLKSSQLEVFGELFQHWNNFTSTTSSSVNVEAGLHLGSFGISGKYSHESESVRKHQIMDRSVTTRVQARYARYSALLQPDTPLNPAFRDRLRNIAYYMQTNK-TNMARYHSQLLVRDYGTHVISSVQAGAIISQLDQIKTTFSNSYSMDRRQVVAAASASFMNVFNVGAEYKHSTSTEVIDQYLGNRTHSVINAIGGPVFQPNNFTLNQWASGLSGDLVAVDKSGYPIYELISAQTLPELPPSILFPLIQTVKSAVEEYYKFNIYRGCTDLDSPNFSFIANVDDGTCESPETNYKFGGVYQQCKQSGQLSQNLCNGLVQKNPLTGAQSCPSGYESVLLNEGTRSATESRRSCHHCGFLGLSHCCDNNNVYGSAKYQSFWCVAQDHVNQQSGFQFGGIYTNKIDNPLTQSRGCPLYFHPLKLGLGMQVCVSDDYELGFRYSVPFAGLFSCMTGNPLAVHQDTSFKNPDILQSLSSYPKASNNWPRGCPTGYSMHLATIENSCEINYCVKANAFSDKGLPPVRHPPFMDL 625          
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Match: A5A508 (Macrophage expressed protein OS=Haliotis diversicolor supertexta OX=283615 PE=2 SV=1)

HSP 1 Score: 405.986 bits (1042), Expect = 1.553e-125
Identity = 215/582 (36.94%), Postives = 322/582 (55.33%), Query Frame = 3
Query:  315 VHKCKLTNKQY-AFDILPGSGWDNLENKELGQVLEISYKECLASNDGSFLIPDNSVIIPIKRSTVELASDIFDHFSNFTSATSKSINADASYATPSYQISGSFSWEKKDVKNDQIKEKSLVSRVQLRHEFYTVSFQPDSKFDRQFKNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPF-GSNFKLEDWEKTLETNLVAIDRKGEPLSYAITSRTLPEFDEKIIYKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCSGPDYQ-----CMDVAAKNPVTNSYACPDNYDTIELQSGL---NKCINYCTK-YLFSTQCH----YECSQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDP------------LYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPF 1979
            V  C   NK+   F++LPG GWDNL N + G V+  +Y  C  + DG +LIPD    IP+K S + + +++  H+SN+TS T+  +N DA     S ++SG FS   +DVK+ QI ++S  +RVQLR+  YT   QPD+     FK+R+L I   L+  K T   +Y ++L+VRDFGTHVI  VDAGA L++ D + + +V   K   ++I A AS S+  + S+++             +  + +S++++T GG  F  SNF   DW   ++  LVA+DR G+PL + I S +LPE    ++Y++  L++E +  YY  NT  GC  ++S NF+  AN+D G C+ P T  +FGG FQTCS          C  +   +P T  + CPD Y+ +EL +G    +K ++ C   +LF   CH    +  + Y ++WC++T       G LFGG YT+   NPLT    CP  +     G +  +C + +    M++ +PFGGF SC  GNPL   P            L++  Q  K WP+ C  GYS H+A VD+ C+I+YC+K  +LS    P + RPPF
Sbjct:   33 VRACYRDNKKLDRFEVLPGQGWDNLRNVDAGLVVVYNYSRCRTTEDGRYLIPDTVNTIPLKTSKLNVYAELISHWSNYTSTTAHGVNVDAGLHFDSVKVSGKFSSGYEDVKSKQIGDRSYTTRVQLRYVRYTAKLQPDAALHPTFKSRLLSIAGSLQLNK-TDQARYDSELLVRDFGTHVITDVDAGAALVQEDQVSAEFVNSRKFSKSQITAGASASLFGIFSIDVSYHSSTSNEVQTAYEQHRSSSQIDTLGGPMFKASNFTANDWTSEVDHELVAVDRSGDPLLFLINSVSLPELPNSVLYQLQNLVQETILHYYEFNTYRGCTELDSPNFSPAANLDDGTCKSPYTNLTFGGVFQTCSMSSGSNNGDLCSGLDQVDPKTGGHTCPDGYEPVELHTGRLSNSKSVHSCHSCWLFFKCCHDNYYHSEATYIMHWCAATGSVSQESGYLFGGLYTSQLNNPLTQRKDCPVNFYTRTLGKDLHICISDDYELGMKYSMPFGGFISCTSGNPLAMSPKPEGNKNSALPSLHSFFQSSKSWPKHCPKGYSQHLAYVDQGCEINYCLKAGSLSEVGLPKIRRPPF 613          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Cavefish
Match: MPEG1 (macrophage expressed 1 [Source:HGNC Symbol;Acc:HGNC:29619])

HSP 1 Score: 306.22 bits (783), Expect = 4.617e-92
Identity = 190/571 (33.27%), Postives = 286/571 (50.09%), Query Frame = 3
Query:  399 LGQVLEISYKECLASNDGSFLIPDNSVIIPIKRSTVELASDIFDHFSNFTSATSKSINADASYATPSYQISGSFSWEKKDVKNDQIKEKSLVSRVQLRHEFYTVSFQPDSKFDRQFKNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITSRTLPEFDEKIIYKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTC----SGPDYQCMDVAAKNPVTNSYACPDNYDTIELQSGLNK-------CINYC--TKYLFSTQC---------HYECSQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSC-PQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMRE-----QPPLYRPPFIDLGFGPNMTVITSLD 2027
            +G+V+ ISY +C  + DG +LIPD   +IP K S VE+ S+I   +    S+TS SINAD S+ +    ++  FS E + +K  Q+K  S+ +RVQ+R+  YTV   PD   D +F  +  +I   + E   T + +YL++ +V D+GTHVI SVD GATL++ D LKS+YV   +   + ++A+A  +    +  ++       T+    +  N   +   + GG  F     L+ W+++   NLVAIDR G PL Y +     P+     + K+A  + +A+ RYY  NT  GC+  +S+NFN  ANVD  +CE PNT  SFGG +Q C    S  D  C ++A+KNP T SY+C   Y    L+S   +       C  +C    +L+   C         H   +Q   YWC++   T    G LFGG +  +  NPLT S SC P ++  T      K+C + +   A    +PFGGF+SC+  N L                  C   +S H+  +   CQI +CV++   +  E      PP  RPP I +     + V+T  D
Sbjct:    1 MGRVMNISYSQCQTTEDGVYLIPDEVFVIPQKVSKVEMNSEIISSWLEQKSSTSSSINADVSFFS---VVNAKFSTENQRMKTHQVKGNSVTARVQVRNHLYTVKAYPDFTLDSRFARQAEEIADAI-ENNQTRHAEYLSEKMVLDYGTHVITSVDTGATLVEEDYLKSSYVSDAQSSQSSVSASAGANFFDKVKFDIGTKDSQGTSETRNYQGNITYSITLSHGGALFYPGITLQKWQESTLNNLVAIDRSGLPLHYFLNPSVFPDLPLPTVNKLAVSVSQAIERYYKVNTHPGCVKPDSKNFNFQANVDDASCEGPNTNLSFGGVYQQCTPLNSYGDAICQELASKNPATGSYSCQQPYIATLLRSETQERPYDQYVCHRHCYGCGFLWLDTCCENICGNVYHVRRAQIKTYWCATNGATPEFSGYLFGGLFGPSLQNPLTKSRSCPPNFFTQTFLSSGFKICLSNDYEAATRFSVPFGGFFSCQSTNQLAGS------------QSRCPPQFSQHLVAISDGCQILFCVQSGIFTGGELLPIRLPPFTRPPVISMIATNTVAVMTEGD 555          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Cavefish
Match: ENSAMXT00000015822.2 (pep primary_assembly:Astyanax_mexicanus-2.0:6:8259512:8262317:1 gene:ENSAMXG00000015374.2 transcript:ENSAMXT00000015822.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 301.982 bits (772), Expect = 1.378e-90
Identity = 185/552 (33.51%), Postives = 285/552 (51.63%), Query Frame = 3
Query:  399 LGQVLEISYKECLASNDGSFLIPDNSVIIPIKRSTVELASDIFDHFSNFTSATSKSINADASYATPSYQISGSFSWEKKDVKNDQIKEKSLVSRVQLRHEFYTVSFQPDSKFDRQFKNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITSRTLPEFDEKIIYKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCS----GPDYQCMDVAAKNPVTNSYACPDNYDTIELQSGLNKCINYCTKYLFSTQCH-------YEC-------------SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNA-KVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPF 1979
            +G+V+ +SY +C  + DG +LIPD   +IP K S VE+ S+I   +    S+TS SINAD S+ +    ++  FS E + +K  Q+   S+ +RVQ+R+  YTV   PD   D +F  ++ +I   + E   T + +YL++ +V D+GTHVI SVDAGATL + D LKS+YV   +   + ++A+A  +    +  ++       T+    +  N   +   + GG  F     L+ W+++   NLVAIDR G PL Y +      +     + K+A L+ +A+ RYY  NTR GC+  +S NF+  ANVD  +CE P+T  SFGG +Q C+      D  C ++A+ NP T SY+C   Y    L+S   +      +Y+ +T CH       + C             +Q   YWC++   T    G LFGG +  +F NPLT S SCP  + A  F  N  K+C + +   A +  +PFGGF+SC+  N L     +            C   +S H+A +   CQI +CV++   +  E  P++ PPF
Sbjct:    1 MGRVMNMSYSQCQTTEDGVYLIPDEVFVIPQKVSKVEMNSEIISSWLEQRSSTSGSINADGSFFS---VLNCKFSAENQRMKTHQVNYNSVTARVQVRNHLYTVKAYPDFSLDSRFAQQVEEIADAI-ENNQTRHAEYLSEKLVLDYGTHVITSVDAGATLEEEDYLKSSYVSDTQSSQSSVSASAGANFFNKVQFDIGSKESQTTSETRNYLGNVTYSITLSHGGALFYPGITLQKWQESTLNNLVAIDRSGLPLHYFLNPSVFSDLPLPTVNKLALLVSQAIERYYKVNTRPGCVKPDSRNFDFQANVDDASCEGPSTNLSFGGVYQQCTPLTPDGDVICQELASTNPATGSYSCKQPYIATLLRSETQE--RPYDQYVCNTHCHDCGFLGLFTCCDQVCGNVYHVRRAQINTYWCATNGATPEFSGYLFGGIFGPSFQNPLTKSRSCPSNFFAQTFLSNGFKICLSSDYETATKFSVPFGGFFSCQSTNLLAGGQSH------------CPPQFSQHLATITDGCQILFCVQSGIFTGGELKPIHLPPF 534          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Nematostella
Match: EDO37879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEK6])

HSP 1 Score: 426.402 bits (1095), Expect = 4.166e-139
Identity = 217/552 (39.31%), Postives = 325/552 (58.88%), Query Frame = 3
Query:  354 DILPGSGWDNLENKELGQVLEISYKECLASNDGSFLIPDNSVIIPIKRSTVELASDIFDHFSNFTSATSKSINADASYATPSYQISGSFSWEKKDVKNDQIKEKSLVSRVQLRHEFYTVSFQPDSKFDRQFKNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITSRTLPEFDEKIIYKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTC----SGPDYQCMDVAAKNPVTNSYACPDNYDTIELQSGL--NKCINYCTK-YLFSTQCHYEC--SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPFI 1982
            ++LPG GWDNL N  +G V  ++Y  C +S+DG FL+PDN  + P+K+S V   ++ +DH++N++S T+KSINA+A  +     +SGSFS E + VK  Q+++K++ +RVQLRH FYT   QPDS     FK+R+L+I + L+   +T Y  +LA ++VRDFGTH + SVDAGA L K D L   +V     D +KI A+AS S       +   +   DT +L+E+   +  +   T+GG PF  NF + +WE  +   LVA+DR G+PL Y IT  +LPE  E+  +++A ++K A+ +YY  NT  GC  M+S NF+  AN+D G+C+ P   Y+FGG +QTC    S     C  +A KNP+T  Y C   Y+ + +  G     C   C + +LF  +C  +C    ++ YWC + +    + G LFGG Y++   NPLT  +SCP  + A +FG   KVC + +     +  LPFGGF+SC  GNPL         + P    +GC TG+S H+  ++  C+I YCVK+N  +++  P + RPP++
Sbjct:    1 EVLPGGGWDNLRNLHMGAVSAMNYSLCRSSDDGKFLVPDNVFLYPVKKSKVNTFAEFYDHWNNYSSTTTKSINAEAKASFGFGSVSGSFSSEYESVKKHQVEDKTVTTRVQLRHVFYTAKLQPDSPLQPAFKDRLLEIASHLQH-NNTAYASFLAQVLVRDFGTHYVSSVDAGAVLAKVDHLTKKFVADSNEDKSKITASASASFFHFFGASGSYSKSTDTKTLDEYTKATVYSTTYTYGGPPFRVNFTINEWEDKMLDELVAVDRSGDPLHYTITPGSLPELCEQATFQLAAVVKNAIKQYYIHNTIKGCTKMDSPNFSFQANMDDGSCQSPTNNYTFGGVYQTCQTDGSPSSDPCAPLAQKNPLTADYTCTPGYEPVLVHQGRTPQSCHKDCHRVWLFFKRCSVQCGFGSFSTYWCVAKSAVPANSGYLFGGLYSDVLKNPLTQDHSCPLKFYALKFGATMKVCVSDDYELGYQQSLPFGGFFSCNAGNPL-------AFKKPPTGDKGCPTGFSQHLGAIEANCEIQYCVKSNVFNLQGLPIVRRPPYL 544          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Nematostella
Match: EDO28266 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6Y8])

HSP 1 Score: 97.8265 bits (242), Expect = 3.113e-24
Identity = 48/109 (44.04%), Postives = 76/109 (69.72%), Query Frame = 3
Query:  354 DILPGSGWDNLENKELGQVLEISYKECLASNDGSFLIPDNSVIIPIKRSTVELASDIFDHFSNFTSATSKSINADASYATPSYQISGSFSWEKKDVKNDQIKEKSLVSR 680
            ++LPG GWDNL N  +G V  ++Y  C +S+DG FLIPDN  + P+K+S V   ++ +DH++N++S T+KSINA+A  +     +SGSFS E + VK  Q+++K++ +R
Sbjct:    1 EVLPGGGWDNLRNLHMGAVSAMNYSLCRSSDDGKFLIPDNVFLYPVKKSKVNTFAEFYDHWNNYSSTTTKSINAEAKASFGFGSVSGSFSSEYESVKKHQVEDKTVTTR 109          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Medaka
Match: MPEG1 (macrophage-expressed gene 1 protein [Source:NCBI gene;Acc:101169041])

HSP 1 Score: 345.51 bits (885), Expect = 3.858e-106
Identity = 197/569 (34.62%), Postives = 310/569 (54.48%), Query Frame = 3
Query:  348 AFDILPGSGWDNLENKELGQVLEISYKECLASNDGSFLIPDNSVIIPIKRSTVELASDIFDHFSNFTSATSKSINADASYATPSYQISGSFSWEKKDVKNDQIKEKSLVSRVQLRHEFYTVSFQPDSKFDRQFKNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITSRTLPEFDEKIIYKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTC------SGPDYQCMDVAAKNPVTNSYACPDNYDTIELQSGLNK-------C--INYCTKYL-----FSTQC----HYECSQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNA-KVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPF 1979
            A ++LPG GWDNL N ++G+V+  SY +C  + DG +LIPD   ++P K + VE  S+I   + +   +T+ SIN D S+      ++  FS E   +K  Q+K+ S  +RVQ+R+  Y+V   PD   D +F +++ +I   + E   T    YL++ +V DFGTHVI SVDAGA+L + D L+S+YV     D++ I A+A  +    L  ++   Y   +++L  + SN   + +++ GG PF     L+ W+++ + NLVAIDR G PL Y I + T+ +  +  + K+A  + +A+ RYY  NTR GC+++ ++N+N  ANVD  +C+ P T  SFGG +Q C      +GP   C ++A KNP T  ++C   Y    L+S + +       C  I Y   +L        QC    H   ++   YWCS   K   S G LFGG Y+ + PNP+TN+ SCP  Y++ RF  +  ++C + +   A    +PFGG +SC+  NPL ++             + C  GYS H+  V   C+I YCV++   +  +  P++ PPF
Sbjct:   69 ALEVLPGGGWDNLRNMDMGRVMNFSYFQCQTTEDGLYLIPDEVFVVPYKETGVETNSEIISSWLDQKGSTAASINDDVSFLP---VLNAKFSVEITRMKTHQVKDSSTTARVQVRNFIYSVKSYPDFALDSRFAHQVKEIADAI-ENNQTRRADYLSEKMVVDFGTHVITSVDAGASLSQEDYLRSSYVSNSVSDSSSIKASAGLNFFDKLKFDISSDYTQKSSTLQNYQSNITYSIIQSHGGTPFYPGISLQKWQESTKNNLVAIDRSGVPLHYLINTNTIQDLPQPTLNKVALTVSQAIERYYRINTRPGCVDVTAKNYNFQANVDDKSCKGPATNLSFGGVYQACTELSSDAGP--LCEELAQKNPNTGDFSCRSPYTPTLLRSEVRQKGYTTYDCYDIRYSCGFLGLFTCHRKQCQDNYHVRSARILTYWCSVNGKAPESSGYLFGGIYSPSSPNPITNAKSCPANYISLRFLSDGQRICVSQDYELATRFSVPFGGLFSCESVNPLANN------------QRRCPPGYSQHLGTVSDGCEILYCVQSGLFTGGKLLPIHLPPF 619          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Medaka
Match: ENSORLT00000006104.2 (pep primary_assembly:ASM223467v1:9:9652430:9669002:1 gene:ENSORLG00000027013.1 transcript:ENSORLT00000006104.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 340.117 bits (871), Expect = 7.381e-105
Identity = 195/569 (34.27%), Postives = 306/569 (53.78%), Query Frame = 3
Query:  348 AFDILPGSGWDNLENKELGQVLEISYKECLASNDGSFLIPDNSVIIPIKRSTVELASDIFDHFSNFTSATSKSINADASYATPSYQISGSFSWEKKDVKNDQIKEKSLVSRVQLRHEFYTVSFQPDSKFDRQFKNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITSRTLPEFDEKIIYKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTC------SGPDYQCMDVAAKNPVTNSYACPDNYDTIELQSGLNK-------C--INYCTKYLFSTQCHYECSQ--YAL-------YWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNA-KVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPF 1979
            A ++LPG GWDNL N ++G+V+   Y +C  + DG +L PD   ++P K + VE  S+I   + +   +T+ SIN D S       ++  FS E   +K  Q+K+ S  +RVQ+R+  Y+V   PD   D +F +++ +I   + E   T    YL++ +V DFGTHVI SVDAGA+L + D L S+YV     D + I   A  +    L  ++   Y   +++L  + SN   + +++ GG PF     L+ W+++ + NLVAIDR G PL Y I S T+ +  +  + K+A  + +A+ RYY  NTR GC+++ ++N+N  ANVD  +CE P T  SFGG +Q C      +GP   C ++A KNP+T  ++C   Y  + L+S + +       C  I Y   +L+   C  E  Q  Y++       YWCS       + G LFGG Y+ + PNP+TN+ SCP  Y++ +F  +  ++C + +   A    +PFGG +SC+  NPL ++             + C  GYS H+  V   C+I YCV++   +  E  P++ PPF
Sbjct:   41 ALEVLPGGGWDNLRNMDMGRVMNFGYFQCQTTKDGLYLNPDEVFVVPYKETGVETNSEIISSWLDQKGSTAASINDDVSDLP---VLNAKFSSEIIRMKTHQVKDSSTTARVQVRNFIYSVKSYPDFALDSRFAHQVKEIVDAI-ENNQTRRADYLSEKMVLDFGTHVITSVDAGASLSQEDYLHSSYVS--VSDRSLIKLQAGLNFYDKLKFDISSNYTQKSSTLQNYQSNITYSIIQSHGGAPFYPGISLQKWQESTKNNLVAIDRSGVPLHYLINSNTIQDLPQPTLNKVALTVSQAIERYYRINTRPGCVDVTAKNYNFQANVDDKSCEGPATNLSFGGVYQACTELSSDAGP--LCEELAQKNPITGDFSCRYPYTPLLLRSEVRQEGYTTRDCYDIIYSCGFLYLYTCQREQCQDNYSVRSARILTYWCSVNGTAPENSGYLFGGIYSPSSPNPITNAKSCPANYISLKFLSDGQRICVSQDYELANNFSVPFGGLFSCESVNPLANN------------QRRCPPGYSQHLGTVSNGCEILYCVQSGLFTGGELLPIHLPPF 589          
BLAST of Macrophage-expressed gene 1 protein vs. Planmine SMEST
Match: SMESG000071519.1 (SMESG000071519.1)

HSP 1 Score: 1093.18 bits (2826), Expect = 0.000e+0
Identity = 536/689 (77.79%), Postives = 595/689 (86.36%), Query Frame = 3
Query:  249 VCGVLSFKCKSESNRDLPSERQVHKCKLTNKQYAFDILPGSGWDNLENKELGQVLEISYKECLASNDGSFLIPDNSVIIPIKRSTVELASDIFDHFSNFTSATSKSINADASYATPSYQISGSFSWEKKDVKNDQIKEKSLVSRVQLRHEFYTVSFQPDSKFDRQFKNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITSRTLPEFDEKIIYKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCSGPDYQCMDVAAKNPVTNSYACPDNYDTIELQSGLNKCINYCTK-YLFSTQCHYECSQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPFIDLGFGPNMTVITSLDTPMGVRLSVDENGKWSHNHQYKLSNYNXXXXXXXXXXXXXXXXXXXXLGVQRFSRNRKGQVSPESHEFDSRYDSTKDVANLALPGEVPPFRVIID 2312
            VCGVLSFKCKSESNRDLPSERQVHKCKLTNKQYAFDILPGSGWDNLENKELGQVLEISYKECL SNDGSFLIPDNSVIIPIKRSTVELASDIFDHFSNFTSATSKSINADASYATPSYQISGSFSWEKKDVKNDQIKEKSLVSRVQLRHEFYTVSFQPDSKFDRQFKNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKS YV  FKGDTT IAAAASFSMT +L V +KG Y  DT SL+E+N+NSASTKVET GG PFGSNFKLEDWEK+L++NLVAIDR+G PL YAIT R+LPEFD+K + KI TLIK AVNRYYAANTRVGCMNMESENFNDDAN+DGGNCE P ++Y+ GGTFQTC GPDYQC +VA KNP+TNSYACP NY T+EL+SGL+KC   C + + FS  CHYECS YALYWC++T  T  SEG+LFGGFY+NT+PNP+TN+Y+CPQYY  +RFG+   +C A N+AE MEHHLPFGGFYSCKVGNPL D  + N TQDPKYW +GC+TGYSSHVAIV+R CQISYC+KNNALS REQPPL+RPPF+DLGFGPN T+ TSL+TP G++LSVDENGKWS N + K SNYNIII SV   A  +I III+ILG++   + R+  V PE +  D R +ST  + N      V PF+++ID
Sbjct:   11 VCGVLSFKCKSESNRDLPSERQVHKCKLTNKQYAFDILPGSGWDNLENKELGQVLEISYKECLTSNDGSFLIPDNSVIIPIKRSTVELASDIFDHFSNFTSATSKSINADASYATPSYQISGSFSWEKKDVKNDQIKEKSLVSRVQLRHEFYTVSFQPDSKFDRQFKNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSKYVNKFKGDTTTIAAAASFSMTKVLGVTIKGNYFSDTASLDEYNNNSASTKVETVGGRPFGSNFKLEDWEKSLDSNLVAIDRRGNPLFYAITPRSLPEFDDKTVNKIVTLIKNAVNRYYAANTRVGCMNMESENFNDDANIDGGNCETPKSYYTLGGTFQTCKGPDYQCENVAGKNPITNSYACPANYKTVELESGLSKCEKVCVRTFWFSYNCHYECSYYALYWCAATKATTKSEGSLFGGFYSNTYPNPITNAYNCPQYYYPSRFGMVGTICLAFNRAETMEHHLPFGGFYSCKVGNPLSDKFVDNTTQDPKYWSEGCATGYSSHVAIVNRGCQISYCIKNNALSKREQPPLFRPPFVDLGFGPNATITTSLETPTGLKLSVDENGKWSENKKSKSSNYNIIIFSVTAVAIITIMIIILILGIKIHRKTRRITVLPEYNGSD-RSNSTSSLNNPTTSNRVQPFKILID 698          
BLAST of Macrophage-expressed gene 1 protein vs. Planmine SMEST
Match: SMESG000067839.1 (SMESG000067839.1)

HSP 1 Score: 665.226 bits (1715), Expect = 0.000e+0
Identity = 329/409 (80.44%), Postives = 360/409 (88.02%), Query Frame = 3
Query:  207 VILCMXXXXXXXXXVCGVLSFKCKSESNRDLPSERQVHKCKLTNKQYAFDILPGSGWDNLENKELGQVLEISYKECLASNDGSFLIPDNSVIIPIKRSTVELASDIFDHFSNFTSATSKSINADASYATPSYQISGSFSWEKKDVKNDQIKEKSLVSRVQLRHEFYTVSFQPDSKFDRQFKNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITSRTLPEFDEKIIYKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCSGPDYQCMDVAAKN 1433
            +I C  N+II+ IFV GVLS  C+ E  RD PS R+VH+CKLT+ QY  ++LPGSGWDNLENKELGQVLEISYK C  SNDGSFLIPDN VI PIK+S VEL SDIFDHFSN TS T+ SINADASY+TPSY+ISGSFS+EK  +KNDQIKEKS +SR QLRHE Y V+FQP SK D +F+NRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTS+NEFN+NSASTKVETFGG PFGSNF+LE+WEKTLETNLVAIDRKGEPLSYAIT + LPEFDE+ ++KIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGG CE P ++Y+FGGTFQ CSG   QC  +  KN
Sbjct:    1 MIPCRLNSIILFIFVYGVLSVSCEIEPYRDQPSSRRVHECKLTSNQYPVNVLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSINEFNNNSASTKVETFGGRPFGSNFRLEEWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGTCEHPKSYYNFGGTFQNCSGNVDQCESITEKN 409          
BLAST of Macrophage-expressed gene 1 protein vs. Planmine SMEST
Match: SMESG000020344.1 (SMESG000020344.1)

HSP 1 Score: 557.755 bits (1436), Expect = 0.000e+0
Identity = 274/585 (46.84%), Postives = 378/585 (64.62%), Query Frame = 3
Query:  318 HKCKLTNKQYAFDILPGSGWDNLENKELGQVLEISYKECLASNDGSFLIPDNSVIIPIKRSTVELASDIFDHFSNFTSATSKSINADASYATPSYQISGSFSWEKKDVKNDQIKEKSLVSRVQLRHEFYTVSFQPDSKFDRQFKNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITSRTLPEFDEKIIYKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCSGPDYQCMDVAAKNPVTNSYACPDNYDTIELQSGLNKCINYCTKYLFSTQCHYECSQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPFIDLGFGPNMTVITSLDTPMGVRLSVDENGKW 2072
            H C+LTN +Y F++LPGSGWDNL N+E  QVL+ISY +C ASNDG FLIPD + ++P  +S V+L S++  HFS + S TSKSINA+AS  T  Y ISGSFS E++DVK +Q+  KS +S+ QLR++ Y +S   D++ D +F  RIL+IG L++  KD++Y  YLADLIVR+FGTHVI SVDAGA L K D+LK  YV   +   + ++ AASFS+  +        +  D T + E+N+N AST+++T GG PFGS+F LE+WEKTL+TNLVAIDR GEPL   IT   +PEF +K IY+I  L+K A+ +YY+ NTR+GCM+  S +F+++ANV+ G C      Y FGG +QTC   D +C     KNP T  Y+CP  ++ I+L    N  I +                    WC+  + +    G LFGG YT  +PN +TN+++CPQYY   ++G++ K+C   +K    ++ LPFGGFYSCK GNPL    +YN TQ    +P  C +GYS+H+A +   C  SYCVKNNA+  +   PLYRPPF+DL    N+ V++ L T  G++L + E+G W
Sbjct:    3 HGCQLTNNEYPFNVLPGSGWDNLSNREQAQVLKISYDKCKASNDGRFLIPDQTKLVPKMKSIVQLDSNLISHFSKYPSTTSKSINAEASGETKKYSISGSFSNEREDVKRNQLNSKSSISQSQLRYDLYKISHIVDAELDTKFHQRILNIGVLIETKKDSLYSAYLADLIVREFGTHVITSVDAGAVLSKIDILKQKYVLDSQVQNSDVSVAASFSLGQICGFKFGSNFKNDDTKIEEYNNNCASTRIKTIGGGPFGSDFSLEEWEKTLDTNLVAIDRIGEPLYNVITKHNIPEFSDKTIYEINLLVKTAIEKYYSTNTRLGCMDFNSHSFDENANVNSGLCNETGNTYPFGGVYQTCQNSD-KCDTYNQKNPATGDYSCPKAFNPIKLFELDNPSITFV-------------------WCAPRSSSSAINGYLFGGMYTEQYPNLVTNNHNCPQYYFPVQYGISGKICITQDKELGGKNSLPFGGFYSCKTGNPLA-LAIYNGTQTN--FPLTCGSGYSTHLASIFNNCHYSYCVKNNAIKTKAATPLYRPPFVDLQMDSNIEVVSELTTSAGMKLVLAEDGIW 564          
BLAST of Macrophage-expressed gene 1 protein vs. Planmine SMEST
Match: SMESG000020345.1 (SMESG000020345.1)

HSP 1 Score: 539.65 bits (1389), Expect = 0.000e+0
Identity = 258/496 (52.02%), Postives = 344/496 (69.35%), Query Frame = 3
Query:  294 DLPSERQVHKCKLTNKQYAFDILPGSGWDNLENKELGQVLEISYKECLASNDGSFLIPDNSVIIPIKRSTVELASDIFDHFSNFTSATSKSINADASYATPSYQISGSFSWEKKDVKNDQIKEKSLVSRVQLRHEFYTVSFQPDSKFDRQFKNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITSRTLPEFDEKIIYKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCSGPDYQCMDVAAKNPVTNSYACPDNYDTIELQSGLNKCINYCTKYLFSTQCHYECSQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFY 1781
            +LPS R VHKC LT  QY F++LPGSGWDNL NKE GQV +ISY  C  SNDG FLIPD+ +I P  +S V++ SD+  HFS +TS TSKSIN + S +TP+Y+ISGSFSWEKKD+K +Q+KEKS +S+VQLR+E Y V+FQPDSK D  FKNRI+ +G L++  K+ +Y QYLADLIVRD+GTHVIRSVDAGA L K D+LK+ Y+   KG  T I+ AAS S+ + + + + G+   + + + E+N N AS+K+ T GG P+GSNF+L +WEKT++ NLV IDR G+PL + IT R+LPEFD+  +YKI  LIK+A+ RYY  NTR GCM+++S+NF+ +ANV+ G C+     Y FGG +QTC G    C ++   NP T S +CP  Y+   +  GL      CT Y+FST C+   +  + YWC+   K       LFGGFY+  FPNP+TNS++CPQ ++A RFG ++ VC   +     +  LPFGGFY
Sbjct:    2 NLPSSRIVHKCHLTKTQYPFNVLPGSGWDNLANKESGQVYKISYDNCSGSNDGRFLIPDSIIITPYMKSKVQMDSDMVSHFSKYTSTTSKSINLEVSASTPNYEISGSFSWEKKDIKENQMKEKSSISKVQLRYELYHVAFQPDSKLDPIFKNRIIQLGVLMETQKNYLYSQYLADLIVRDYGTHVIRSVDAGAILSKVDILKAEYLSKHKGSQTTISLAASGSLNSAIGLKIGGSNKNNESEVREYNKNCASSKINTIGGGPYGSNFQLAEWEKTIQKNLVPIDRIGDPLFHVITKRSLPEFDDITVYKIGNLIKDAITRYYKINTRSGCMDIKSDNFDVNANVNNGICQDSKISYVFGGVYQTCEGN--SCENLIQTNPATGSTSCPAGYNATLVYHGLYSEQTICTYYVFSTVCNNFQTYISSYWCAPDPKKNPESVYLFGGFYSKVFPNPITNSFTCPQSFIALRFGHSSWVCVTSDSVLGRKFSLPFGGFY 495          
BLAST of Macrophage-expressed gene 1 protein vs. Planmine SMEST
Match: SMESG000044682.1 (SMESG000044682.1)

HSP 1 Score: 514.227 bits (1323), Expect = 1.792e-171
Identity = 250/614 (40.72%), Postives = 369/614 (60.10%), Query Frame = 3
Query:  264 SFKCKSESNRDLPSERQVHKCKLTNKQYAFDILPGSGWDNLENKELGQVLEISYKECLASNDGSFLIPDNSVIIPIKRSTVELASDIFDHFSNFTSATSKSINADASYATPSYQISGSFSWEKKDVKNDQIKEKSLVSRVQLRHEFYTVSFQPDSKFDRQFKNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITSRTLPEFDEKIIYKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCSGPDYQCMDVAAKNPVTNSYACPDNYDTIELQSGLNKCINYCTKYLFSTQCHYECSQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPK-----------YWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPFIDLGFGPNMTVITSLDTPMGVRLSVDENGKW 2072
            S KC  +++ +   +     C L + Q  FD+LPGSGWDNL N  +G++L++++ +C  SND  +LIP+   I P K S VE++S+IF HFSN+TS +S+SIN DA      ++I GSFS E   +K+DQ++ KS+++RVQLR+  +   F+PD+     FKNRI+DI  L+ E KD++YP+YLAD+IVRD+GTHVIR++DAGA L KTD L S YVK +  D++ I+ +AS S   M  ++ +       T+++EFN N+  T ++T GG  FG+N  L DWE ++  NLV IDR+GEPL YAIT R LPE D+  ++K+  L+K+A+ RYY AN R+GC+++ S NFN DAN+D GNCE P+  ++FGGT+Q C GP   C   A  NP+T  ++CP  + +I+L SGL +C   C  + F   C   CS +  +WC   N      G  FGG              SCP  Y+  +  ++ ++C  ++      + + FGGF+SC  GNPL  +    + + PK           YWP+ C+ GY +H+  +++ CQISYC + N +S+   P + +PPFI   + PN T +       G  +  D+ G W
Sbjct:   15 SVKCLDQNDGNKLFKNAYELCHLRSNQLTFDVLPGSGWDNLANVGMGRILDLNFSKCSFSNDNKYLIPNQLAIYPQKTSQVEISSEIFRHFSNYTSMSSQSINLDAEGLFGHWKIGGSFSTENTKIKSDQMETKSILTRVQLRYLVFQSMFEPDTPLYPTFKNRIIDIAGLVIENKDSLYPEYLADMIVRDYGTHVIRAIDAGAILSKTDALNSRYVKKYASDSSTISVSASASFLGMFKISGRYQTKTSQTNIDEFNHNADKTHIDTVGGAIFGANMSLSDWENSVMNNLVPIDRRGEPLYYAITPRALPELDQTTVHKVTELLKKAILRYYMANGRIGCLDIYSPNFNPDANIDSGNCEHPSVNFTFGGTYQVCGGP--ACGPYAQVNPLTGGFSCPSGFISIKLHSGLVRCDESCHGWWFWRSCDTTCSYFTTFWCYPVNIGPNYNGYQFGGIRQG----------SCPIGYIPLKVALSTEICVTVDADPFNPYAIKFGGFFSCSAGNPLAKE---YVNKKPKLPSNSKMEGLLYWPKTCAKGYVAHIVSIEQGCQISYCTETNKVSLGPLPLIIKPPFISTNYNPNSTKVFLFKNKKGETIIKDDLGYW 613          
The following BLAST results are available for this feature:
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
MPEG11.629e-12133.66macrophage expressed 1 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mpeg1.13.170e-11135.83macrophage expressed 1, tandem duplicate 1 [Source... [more]
mpeg1.13.170e-11135.83macrophage expressed 1, tandem duplicate 1 [Source... [more]
mpeg1.32.410e-10933.93macrophage expressed 1, tandem duplicate 3 [Source... [more]
mpeg1.22.571e-10132.19macrophage expressed 1, tandem duplicate 2 [Source... [more]
mpeg1.11.051e-1341.67macrophage expressed 1, tandem duplicate 1 [Source... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Pfpl1.936e-11634.26pore forming protein-like [Source:MGI Symbol;Acc:M... [more]
Mpeg14.087e-11532.99macrophage expressed gene 1 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2KJC3|MPEG1_BOVIN3.714e-12335.12Macrophage-expressed gene 1 protein OS=Bos taurus ... [more]
sp|Q2M385|MPEG1_HUMAN7.823e-12133.66Macrophage-expressed gene 1 protein OS=Homo sapien... [more]
sp|Q5RBP9|MPEG1_PONAB8.972e-12133.49Macrophage-expressed gene 1 protein OS=Pongo abeli... [more]
sp|Q9WV57|MPEG1_RAT1.389e-11533.88Macrophage-expressed gene 1 protein OS=Rattus norv... [more]
sp|A1L314|MPEG1_MOUSE1.189e-11432.99Macrophage-expressed gene 1 protein OS=Mus musculu... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2B4RFA83.553e-13937.40Macrophage-expressed gene 1 protein OS=Stylophora ... [more]
A0A210Q2424.724e-13637.54Macrophage-expressed gene 1 protein OS=Mizuhopecte... [more]
A7SEK63.012e-13539.31Predicted protein (Fragment) OS=Nematostella vecte... [more]
K1RDW71.403e-12536.14MACPF domain-containing protein OS=Crassostrea gig... [more]
A5A5081.553e-12536.94Macrophage expressed protein OS=Haliotis diversico... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
MPEG14.617e-9233.27macrophage expressed 1 [Source:HGNC Symbol;Acc:HGN... [more]
ENSAMXT00000015822.21.378e-9033.51pep primary_assembly:Astyanax_mexicanus-2.0:6:8259... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO378794.166e-13939.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO282663.113e-2444.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
MPEG13.858e-10634.62macrophage-expressed gene 1 protein [Source:NCBI g... [more]
ENSORLT00000006104.27.381e-10534.27pep primary_assembly:ASM223467v1:9:9652430:9669002... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000071519.10.000e+077.79SMESG000071519.1[more]
SMESG000067839.10.000e+080.44SMESG000067839.1[more]
SMESG000020344.10.000e+046.84SMESG000020344.1[more]
SMESG000020345.10.000e+052.02SMESG000020345.1[more]
SMESG000044682.11.792e-17140.72SMESG000044682.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035691 ID=SMED30035691|Name=Macrophage-expressed gene 1 protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2718bp
TATATTTTAGAGATTATGATTATAAAAATTTAAAGTGCCGACAGTTAATA
AAAACAATTAATGCTTACAACGTAAGGTCATCATGATGATGTAATCATTC
GGATGTTCTATGACGTTCGGATAACCCTTATCACGTGGATCCTAAACAAA
ATATATCAATCAACTAGGAATTACAATATACATTTGTTTGTTCAACAGTG
AAACCAGTGATACTTTGTATGTTTAATAATATAATAATAATTATATTTGT
CTGTGGAGTTCTATCTTTTAAATGTAAAAGCGAATCAAACAGAGACCTCC
CGTCAGAGAGGCAAGTCCATAAATGTAAACTTACTAACAAACAATACGCA
TTCGATATCCTCCCTGGATCTGGATGGGATAATCTTGAAAACAAGGAACT
CGGTCAAGTTTTAGAAATTTCATACAAGGAATGTTTGGCTTCGAATGATG
GCAGCTTTCTCATTCCTGACAACTCGGTGATTATTCCGATCAAAAGGTCA
ACTGTCGAATTGGCATCTGACATATTTGATCATTTCTCTAATTTCACATC
TGCCACGTCCAAATCCATAAATGCCGATGCAAGTTACGCCACACCAAGCT
ATCAGATTAGTGGCTCGTTTTCATGGGAAAAAAAGGATGTAAAAAATGAC
CAAATCAAAGAAAAGTCTTTGGTTTCTCGGGTACAATTGAGACACGAATT
TTACACCGTTTCATTTCAGCCAGACTCGAAATTTGATCGTCAATTCAAGA
ACAGAATTCTAGATATTGGAGCGTTATTGAAAGAAGGAAAAGACACAATT
TATCCACAATATTTAGCGGATTTAATTGTCCGTGACTTCGGCACTCACGT
CATTCGGTCGGTGGATGCGGGAGCGACACTAATAAAGACTGATGTTTTAA
AATCGAATTATGTCAAAGGTTTTAAAGGGGATACAACTAAGATTGCAGCT
GCGGCATCATTCAGTATGACAACAATGCTTTCAGTCAACCTCAAAGGAAC
CTATGTTGGTGATACCACGAGTCTCAATGAATTCAATAGTAATAGTGCAA
GTACAAAAGTCGAAACTTTTGGTGGTATACCGTTTGGTTCGAATTTTAAG
TTGGAAGATTGGGAGAAAACCCTTGAAACGAATTTGGTAGCAATTGATCG
CAAAGGTGAACCGTTGTCCTATGCTATTACATCAAGAACTCTTCCAGAAT
TTGACGAGAAAATTATTTACAAAATCGCTACTCTCATCAAAGAAGCAGTC
AATAGATATTATGCAGCCAACACGAGAGTGGGATGTATGAATATGGAGTC
AGAAAATTTCAATGACGACGCAAATGTTGACGGTGGAAACTGCGAACCTC
CTAATACATTTTACAGTTTTGGAGGAACTTTTCAAACCTGCTCAGGCCCT
GATTATCAGTGTATGGATGTCGCGGCAAAAAACCCAGTGACCAATAGTTA
TGCTTGTCCTGATAACTATGATACCATTGAATTACAAAGTGGATTGAATA
AATGCATAAATTATTGCACCAAATACTTATTTTCCACTCAATGTCATTAC
GAGTGTTCCCAATATGCATTGTATTGGTGTTCTTCTACAAACAAAACGAA
AATATCAGAAGGCGCACTTTTCGGGGGATTCTACACTAATACATTTCCGA
ATCCACTTACAAATTCCTATAGTTGTCCACAATACTATGTAGCGACAAGA
TTCGGCGTAAACGCCAAGGTTTGCACTGCACTCAATAAGGCAGAGGCTAT
GGAACACCATTTGCCGTTTGGAGGATTTTATAGTTGCAAAGTTGGAAATC
CTCTACTAGATGATCCTCTCTACAACATTACACAGGATCCCAAATATTGG
CCTCAAGGTTGTTCAACCGGATATTCATCACATGTAGCTATTGTCGACAG
AGCTTGTCAAATTTCCTATTGCGTTAAAAATAACGCCCTTAGCATGAGAG
AGCAACCGCCTCTCTACCGACCACCTTTTATTGATTTGGGATTTGGACCC
AATATGACAGTAATTACCTCTCTGGACACTCCAATGGGGGTCCGATTATC
TGTTGATGAAAACGGGAAATGGAGTCATAATCACCAATACAAATTATCCA
ATTACAATATTATAATAATATCAGTCATTATGGCGGCAGGAGCCAGCATT
GCAATTATTATTATAATTCTTGGAGTTCAAAGATTCAGCAGAAACCGAAA
AGGTCAAGTCTCACCGGAATCTCATGAATTTGATAGCAGATATGATTCTA
CTAAAGATGTTGCCAATCTTGCGTTACCCGGCGAGGTTCCACCGTTTCGT
GTTATAATTGACGGAGCGAAATGATGCTTGGAACCTTTTATTATTTCTGT
TGAATCTGATCTGTAAATGTTTTCAGAATATTTTTCTAATAAAATCGTTC
TGAAATTTTAAAGTGATCCTTGATGCTATTAAATGATGGACTTTATTGTA
CCCCGAATTGGGTCACCCTTGTTCACGCAAATTCGTGCTTAGGATATTTG
TACGGGCTTATGCAACTTTTTAAATTTTTATTTTTCCTTATTTTTATTAG
CAATCCGTTTTATTTATAACGACAAATGCTTGATGTTTGAATCAAATTTT
TATTATGTTTCTTAATGAAACATAGTGAACAATGTGCCACTAATTTCATA
ACCAAGGTCTAATCAAATAGTTTGGGTAGTGAAAGCAATATTACAGAGTT
TAGGTTTGTCATTCATAT
back to top

protein sequence of SMED30035691-orf-1

>SMED30035691-orf-1 ID=SMED30035691-orf-1|Name=SMED30035691-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=702bp
MFNNIIIIIFVCGVLSFKCKSESNRDLPSERQVHKCKLTNKQYAFDILPG
SGWDNLENKELGQVLEISYKECLASNDGSFLIPDNSVIIPIKRSTVELAS
DIFDHFSNFTSATSKSINADASYATPSYQISGSFSWEKKDVKNDQIKEKS
LVSRVQLRHEFYTVSFQPDSKFDRQFKNRILDIGALLKEGKDTIYPQYLA
DLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSM
TTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEK
TLETNLVAIDRKGEPLSYAITSRTLPEFDEKIIYKIATLIKEAVNRYYAA
NTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCSGPDYQCMD
VAAKNPVTNSYACPDNYDTIELQSGLNKCINYCTKYLFSTQCHYECSQYA
LYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAK
VCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCST
GYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPFIDLGFGPNMTVIT
SLDTPMGVRLSVDENGKWSHNHQYKLSNYNIIIISVIMAAGASIAIIIII
LGVQRFSRNRKGQVSPESHEFDSRYDSTKDVANLALPGEVPPFRVIIDGA
K*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000023embryonic pharynx
PLANA:0002031embryonic gut
PLANA:0002087primitive gut
Vocabulary: INTERPRO
TermDefinition
IPR039707MPEG1
IPR020864MACPF
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020864Membrane attack complex component/perforin (MACPF) domainPFAMPF01823MACPFcoord: 6..94
e-value: 1.1E-5
score: 25.7
IPR039707Macrophage-expressed gene 1 proteinPANTHERPTHR31463FAMILY NOT NAMEDcoord: 188..328
coord: 4..178
NoneNo IPR availablePANTHERPTHR31463:SF4MACROPHAGE-EXPRESSED GENE 1 PROTEINcoord: 188..328
coord: 4..178
NoneNo IPR availableTMHMMTMhelixcoord: 369..391