Calmodulin-regulated spectrin-associated protein 1

Overview
NameCalmodulin-regulated spectrin-associated protein 1
Smed IDSMED30035680
Length (bp)4418
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calmodulin-regulated spectrin-associated protein 1 (SMED30035680) t-SNE clustered cells

Violin plots show distribution of expression levels for Calmodulin-regulated spectrin-associated protein 1 (SMED30035680) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Calmodulin-regulated spectrin-associated protein 1 (SMED30035680) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Calmodulin-regulated spectrin-associated protein 1 (SMED30035680) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035680

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30035680SMESG000017885.1 dd_Smed_v4_7356_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035680SMESG000017885.1 dd_Smed_v4_7356_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30035680SMESG000017885.1 dd_Smed_v4_7356_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30035680SMESG000017885.1 dd_Smed_v6_7356_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30035680SMESG000017885.1 dd_Smed_v6_7356_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Human
Match: CAMSAP1 (calmodulin regulated spectrin associated protein 1 [Source:HGNC Symbol;Acc:HGNC:19946])

HSP 1 Score: 149.443 bits (376), Expect = 1.766e-35
Identity = 79/181 (43.65%), Postives = 113/181 (62.43%), Query Frame = 1
Query: 3226 GNLPSASLQRNTWFSSMRISNRNTSQSTSKLNDNLIMDSNKFGVPLPPQEYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYWNAR 3768
            G  PS   QR     ++ I +RN S+ST +  +     S+   V     EYTGPKLF +   K+N+ +I NAISHCCLAG VNE  K S+L++L   +  H++ILFRDA CQ+RA+Y +  + +E+  ++G+GPK IT +M++K YKY+S  KQFNL I  K +S +VDA+ I    W  +
Sbjct: 1140 GGTPS---QRVESMEALPILSRNPSRSTDRDWETASAASSLASV----AEYTGPKLFKEPSSKSNKPIIHNAISHCCLAGKVNEPHKNSILEELEKCDANHYIILFRDAGCQFRALYCYYPDTEEIYKLTGTGPKNITKKMIDKLYKYSSDRKQFNL-IPAKTMSVSVDALTIHNHLWQPK 1312          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Human
Match: CAMSAP1 (calmodulin regulated spectrin associated protein 1 [Source:HGNC Symbol;Acc:HGNC:19946])

HSP 1 Score: 149.058 bits (375), Expect = 2.894e-35
Identity = 79/181 (43.65%), Postives = 113/181 (62.43%), Query Frame = 1
Query: 3226 GNLPSASLQRNTWFSSMRISNRNTSQSTSKLNDNLIMDSNKFGVPLPPQEYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYWNAR 3768
            G  PS   QR     ++ I +RN S+ST +  +     S+   V     EYTGPKLF +   K+N+ +I NAISHCCLAG VNE  K S+L++L   +  H++ILFRDA CQ+RA+Y +  + +E+  ++G+GPK IT +M++K YKY+S  KQFNL I  K +S +VDA+ I    W  +
Sbjct: 1418 GGTPS---QRVESMEALPILSRNPSRSTDRDWETASAASSLASV----AEYTGPKLFKEPSSKSNKPIIHNAISHCCLAGKVNEPHKNSILEELEKCDANHYIILFRDAGCQFRALYCYYPDTEEIYKLTGTGPKNITKKMIDKLYKYSSDRKQFNL-IPAKTMSVSVDALTIHNHLWQPK 1590          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Human
Match: CAMSAP1 (calmodulin regulated spectrin associated protein 1 [Source:HGNC Symbol;Acc:HGNC:19946])

HSP 1 Score: 149.058 bits (375), Expect = 3.274e-35
Identity = 79/181 (43.65%), Postives = 113/181 (62.43%), Query Frame = 1
Query: 3226 GNLPSASLQRNTWFSSMRISNRNTSQSTSKLNDNLIMDSNKFGVPLPPQEYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYWNAR 3768
            G  PS   QR     ++ I +RN S+ST +  +     S+   V     EYTGPKLF +   K+N+ +I NAISHCCLAG VNE  K S+L++L   +  H++ILFRDA CQ+RA+Y +  + +E+  ++G+GPK IT +M++K YKY+S  KQFNL I  K +S +VDA+ I    W  +
Sbjct: 1429 GGTPS---QRVESMEALPILSRNPSRSTDRDWETASAASSLASV----AEYTGPKLFKEPSSKSNKPIIHNAISHCCLAGKVNEPHKNSILEELEKCDANHYIILFRDAGCQFRALYCYYPDTEEIYKLTGTGPKNITKKMIDKLYKYSSDRKQFNL-IPAKTMSVSVDALTIHNHLWQPK 1601          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Human
Match: CAMSAP2 (calmodulin regulated spectrin associated protein family member 2 [Source:HGNC Symbol;Acc:HGNC:29188])

HSP 1 Score: 142.124 bits (357), Expect = 3.316e-33
Identity = 62/132 (46.97%), Postives = 93/132 (70.45%), Query Frame = 1
Query: 3373 EYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYWNAR 3768
            EYTGPKL+ +   K+N+ +I NA++HCCLAG VNE  K+ +L+++  ++  +F+ILFRD+ CQ+R++YT+    +E+N ++G GPK IT +M+E  YKYNS  KQF+  I  K LS +VDAI I +  W  +
Sbjct: 1335 EYTGPKLYKEPSAKSNKHIIQNALAHCCLAGKVNEGQKKKILEEMEKSDANNFLILFRDSGCQFRSLYTYCPETEEINKLTGIGPKSITKKMIEGLYKYNSDRKQFSH-IPAKTLSASVDAITIHSHLWQTK 1465          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Human
Match: CAMSAP2 (calmodulin regulated spectrin associated protein family member 2 [Source:HGNC Symbol;Acc:HGNC:29188])

HSP 1 Score: 142.124 bits (357), Expect = 3.568e-33
Identity = 62/132 (46.97%), Postives = 93/132 (70.45%), Query Frame = 1
Query: 3373 EYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYWNAR 3768
            EYTGPKL+ +   K+N+ +I NA++HCCLAG VNE  K+ +L+++  ++  +F+ILFRD+ CQ+R++YT+    +E+N ++G GPK IT +M+E  YKYNS  KQF+  I  K LS +VDAI I +  W  +
Sbjct: 1346 EYTGPKLYKEPSAKSNKHIIQNALAHCCLAGKVNEGQKKKILEEMEKSDANNFLILFRDSGCQFRSLYTYCPETEEINKLTGIGPKSITKKMIEGLYKYNSDRKQFSH-IPAKTLSASVDAITIHSHLWQTK 1476          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Celegans
Match: ptrn-1 (Patronin (microtubule-binding protein) homolog [Source:UniProtKB/Swiss-Prot;Acc:U4PAZ9])

HSP 1 Score: 115.546 bits (288), Expect = 5.140e-27
Identity = 52/124 (41.94%), Postives = 74/124 (59.68%), Query Frame = 1
Query: 3388 KLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYW 3759
            KL+ K   K+NR +I NA+      G+VN   +++ +  +A +   HF+ILFRD +CQYR +YT++  +D    ISG GP K T  M+   +KY+SGAK F   I+TKHLS  +D   I   YW
Sbjct:  248 KLYAKTVTKSNRGLINNALQFSVFPGAVNNATRQATITQMASSSSKHFLILFRDQKCQYRGLYTWDEISDTAVKISGQGPPKCTEAMMNSMFKYDSGAKNFT-NIATKHLSATIDGFAILDQYW 370          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Celegans
Match: ptrn-1 (Patronin (microtubule-binding protein) homolog [Source:UniProtKB/Swiss-Prot;Acc:U4PAZ9])

HSP 1 Score: 115.161 bits (287), Expect = 6.090e-26
Identity = 52/124 (41.94%), Postives = 74/124 (59.68%), Query Frame = 1
Query: 3388 KLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYW 3759
            KL+ K   K+NR +I NA+      G+VN   +++ +  +A +   HF+ILFRD +CQYR +YT++  +D    ISG GP K T  M+   +KY+SGAK F   I+TKHLS  +D   I   YW
Sbjct:  459 KLYAKTVTKSNRGLINNALQFSVFPGAVNNATRQATITQMASSSSKHFLILFRDQKCQYRGLYTWDEISDTAVKISGQGPPKCTEAMMNSMFKYDSGAKNFT-NIATKHLSATIDGFAILDQYW 581          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Celegans
Match: ptrn-1 (Patronin (microtubule-binding protein) homolog [Source:UniProtKB/Swiss-Prot;Acc:U4PAZ9])

HSP 1 Score: 113.62 bits (283), Expect = 5.434e-25
Identity = 52/124 (41.94%), Postives = 74/124 (59.68%), Query Frame = 1
Query: 3388 KLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYW 3759
            KL+ K   K+NR +I NA+      G+VN   +++ +  +A +   HF+ILFRD +CQYR +YT++  +D    ISG GP K T  M+   +KY+SGAK F   I+TKHLS  +D   I   YW
Sbjct:  974 KLYAKTVTKSNRGLINNALQFSVFPGAVNNATRQATITQMASSSSKHFLILFRDQKCQYRGLYTWDEISDTAVKISGQGPPKCTEAMMNSMFKYDSGAKNFT-NIATKHLSATIDGFAILDQYW 1096          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Celegans
Match: ptrn-1 (Patronin (microtubule-binding protein) homolog [Source:UniProtKB/Swiss-Prot;Acc:U4PAZ9])

HSP 1 Score: 113.62 bits (283), Expect = 5.472e-25
Identity = 52/124 (41.94%), Postives = 74/124 (59.68%), Query Frame = 1
Query: 3388 KLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYW 3759
            KL+ K   K+NR +I NA+      G+VN   +++ +  +A +   HF+ILFRD +CQYR +YT++  +D    ISG GP K T  M+   +KY+SGAK F   I+TKHLS  +D   I   YW
Sbjct:  972 KLYAKTVTKSNRGLINNALQFSVFPGAVNNATRQATITQMASSSSKHFLILFRDQKCQYRGLYTWDEISDTAVKISGQGPPKCTEAMMNSMFKYDSGAKNFT-NIATKHLSATIDGFAILDQYW 1094          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Fly
Match: Patronin (gene:FBgn0263197 transcript:FBtr0332262)

HSP 1 Score: 135.961 bits (341), Expect = 1.567e-31
Identity = 55/132 (41.67%), Postives = 86/132 (65.15%), Query Frame = 1
Query: 3373 EYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYWNAR 3768
            EY+GPKL+ +   K+NR +I+NA+ +C   G VN   K+ VL+ +A +E  HF++LFRDA CQ+RA+Y++    D++  + G+GP ++   M +KF+KYNSG K F+  + TKHL+  +DA  I    W  +
Sbjct: 1536 EYSGPKLYKQPAAKSNRGIILNAVEYCVFPGVVNREAKQKVLEKIARSEAKHFLVLFRDAGCQFRALYSYQPETDQVTKLYGTGPSQVEEVMFDKFFKYNSGGKCFSQ-VHTKHLTVTIDAFTIHNSLWQGK 1666          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Fly
Match: Patronin (gene:FBgn0263197 transcript:FBtr0332260)

HSP 1 Score: 134.806 bits (338), Expect = 3.228e-31
Identity = 55/132 (41.67%), Postives = 86/132 (65.15%), Query Frame = 1
Query: 3373 EYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYWNAR 3768
            EY+GPKL+ +   K+NR +I+NA+ +C   G VN   K+ VL+ +A +E  HF++LFRDA CQ+RA+Y++    D++  + G+GP ++   M +KF+KYNSG K F+  + TKHL+  +DA  I    W  +
Sbjct: 1545 EYSGPKLYKQPAAKSNRGIILNAVEYCVFPGVVNREAKQKVLEKIARSEAKHFLVLFRDAGCQFRALYSYQPETDQVTKLYGTGPSQVEEVMFDKFFKYNSGGKCFSQ-VHTKHLTVTIDAFTIHNSLWQGK 1675          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Fly
Match: Patronin (gene:FBgn0263197 transcript:FBtr0332266)

HSP 1 Score: 133.265 bits (334), Expect = 9.764e-31
Identity = 65/197 (32.99%), Postives = 111/197 (56.35%), Query Frame = 1
Query: 3208 GRQDSVGNLPSASLQRNTWFSSMRISNRNTSQSTSKLNDNLI-MDSNKFGVPLPPQEY---------TGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYWNAR 3768
            G QDS+     A ++R    S + ++  +T     + +++L+ +  +  G   PP+           +GPKL+ +   K+NR +I+NA+ +C   G VN   K+ VL+ +A +E  HF++LFRDA CQ+RA+Y++    D++  + G+GP ++   M +KF+KYNSG K F+  + TKHL+  +DA  I    W  +
Sbjct: 1474 GSQDSLTVKEPAGVERGRTLSRISVAKGSTLNFRGRKSNSLMNLCDSGLGRATPPRRAPSPGMGMGASGPKLYKQPAAKSNRGIILNAVEYCVFPGVVNREAKQKVLEKIARSEAKHFLVLFRDAGCQFRALYSYQPETDQVTKLYGTGPSQVEEVMFDKFFKYNSGGKCFSQ-VHTKHLTVTIDAFTIHNSLWQGK 1669          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Fly
Match: Patronin (gene:FBgn0263197 transcript:FBtr0273447)

HSP 1 Score: 132.494 bits (332), Expect = 1.687e-30
Identity = 54/130 (41.54%), Postives = 84/130 (64.62%), Query Frame = 1
Query: 3379 TGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYWNAR 3768
            TGPKL+ +   K+NR +I+NA+ +C   G VN   K+ VL+ +A +E  HF++LFRDA CQ+RA+Y++    D++  + G+GP ++   M +KF+KYNSG K F+  + TKHL+  +DA  I    W  +
Sbjct: 1457 TGPKLYKQPAAKSNRGIILNAVEYCVFPGVVNREAKQKVLEKIARSEAKHFLVLFRDAGCQFRALYSYQPETDQVTKLYGTGPSQVEEVMFDKFFKYNSGGKCFSQ-VHTKHLTVTIDAFTIHNSLWQGK 1585          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Fly
Match: Patronin (gene:FBgn0263197 transcript:FBtr0086948)

HSP 1 Score: 132.109 bits (331), Expect = 1.969e-30
Identity = 54/130 (41.54%), Postives = 84/130 (64.62%), Query Frame = 1
Query: 3379 TGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYWNAR 3768
            TGPKL+ +   K+NR +I+NA+ +C   G VN   K+ VL+ +A +E  HF++LFRDA CQ+RA+Y++    D++  + G+GP ++   M +KF+KYNSG K F+  + TKHL+  +DA  I    W  +
Sbjct: 1375 TGPKLYKQPAAKSNRGIILNAVEYCVFPGVVNREAKQKVLEKIARSEAKHFLVLFRDAGCQFRALYSYQPETDQVTKLYGTGPSQVEEVMFDKFFKYNSGGKCFSQ-VHTKHLTVTIDAFTIHNSLWQGK 1503          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Zebrafish
Match: camsap1b (calmodulin regulated spectrin-associated protein 1b [Source:NCBI gene;Acc:561094])

HSP 1 Score: 154.066 bits (388), Expect = 5.806e-37
Identity = 83/190 (43.68%), Postives = 119/190 (62.63%), Query Frame = 1
Query: 3199 VASGRQDSVGNLPSASLQRNTWFSSMRISNRNTSQSTSKLNDNLIMDSNKFGVPLPPQEYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYWNAR 3768
            VA+   DSV N   A  QR     S    +RN+S++T +  DN    S+     +   EYTGPKLF +   K+N+ +I NAISHCCLAG VNE  K S+L++L   E  H MILFRD+ CQ+RA+Y++  + +E++ ++G+GPK IT +M++K YKY+S  KQF  +I  K +S +VDA+ I    W A+
Sbjct: 1363 VATTEPDSV-NSGGAGSQRGESVESFPGLSRNSSRTTERDWDNGSTASSITSTSM--AEYTGPKLFKEPSAKSNKPIIHNAISHCCLAGKVNEPQKNSILEELERCESNHLMILFRDSGCQFRALYSYFPDTEEIHKLTGTGPKSITKKMIDKLYKYSSDRKQFT-VIPAKTVSVSVDALTIHNHLWQAK 1548          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Zebrafish
Match: camsap2b (calmodulin regulated spectrin-associated protein family, member 2b [Source:ZFIN;Acc:ZDB-GENE-070912-80])

HSP 1 Score: 137.117 bits (344), Expect = 2.340e-36
Identity = 62/129 (48.06%), Postives = 90/129 (69.77%), Query Frame = 1
Query: 3373 EYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYW 3759
            EYTGPKL+ +   K+N+ +I NA++HCCLAG VNE  K  +L+++   E  +F+ILFRD  CQ+R++YT+   A+E+N ++G GPK IT +M+E  YKY+S  KQF+  I  K +S +VDAI I +  W
Sbjct:   38 EYTGPKLYKEPSAKSNKYIIQNALAHCCLAGRVNEGQKNKILEEMEKTEANNFLILFRDTGCQFRSLYTYYPEAEEMNKLAGIGPKTITPKMIENLYKYSSDKKQFSK-IPAKTMSASVDAITIYSHLW 165          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Zebrafish
Match: camsap2b (calmodulin regulated spectrin-associated protein family, member 2b [Source:ZFIN;Acc:ZDB-GENE-070912-80])

HSP 1 Score: 141.354 bits (355), Expect = 4.477e-36
Identity = 62/129 (48.06%), Postives = 90/129 (69.77%), Query Frame = 1
Query: 3373 EYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYW 3759
            EYTGPKL+ +   K+N+ +I NA++HCCLAG VNE  K  +L+++   E  +F+ILFRD  CQ+R++YT+   A+E+N ++G GPK IT +M+E  YKY+S  KQF+  I  K +S +VDAI I +  W
Sbjct:  186 EYTGPKLYKEPSAKSNKYIIQNALAHCCLAGRVNEGQKNKILEEMEKTEANNFLILFRDTGCQFRSLYTYYPEAEEMNKLAGIGPKTITPKMIENLYKYSSDKKQFSK-IPAKTMSASVDAITIYSHLW 313          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Zebrafish
Match: camsap1a (calmodulin regulated spectrin-associated protein 1a [Source:ZFIN;Acc:ZDB-GENE-060518-4])

HSP 1 Score: 142.51 bits (358), Expect = 1.809e-33
Identity = 101/326 (30.98%), Postives = 163/326 (50.00%), Query Frame = 1
Query: 2854 FVISTDQEKEESQRKKAELLALREEKRRIKLELLKQKREQDRENRLSATIDELMXXXXXXXXXXXXXDSLLQKYLDRKKGETNTSSNNTAFEK-----------RSASAANTPVKL----------RTNSKTPRPVVASGRQDSVGNLPSASLQRNTWFSSMRISNRNTSQSTSKLNDNLIMDSNKFGVPLPPQEYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYWNAR 3768
            F    DQ+ E+   KK     L+++++  +  + KQ+ E + E +      +  E   +K +EK +R+ + Q+YL RK+ E                       R+ S+ + PV L            ++ T    VASG          AS  R     S  I +RN S++  +  DN    S+   V     EY GP+LF +   K+N+ +I NAI+HCCLAG VNE  K ++L ++   E  H +ILFRD  CQ+RA+Y ++   +E+  + G+GP+ I+ +M+++ YKY+S  KQF  +I  K +S +VDA+ I +  W A+
Sbjct: 1110 FFFKDDQKAEDELAKKRAAFLLKQQRKAEEARIRKQQLEAESELKRDEARRKAEEDRVRKEEEKARRELIKQEYLRRKQQELLEEQGAAKPRPRNRRPRPKSLHRAESSCSAPVSLCSAPSGSSLSLASAATEGDSVASG---------GASSHRGESVESFPILSRNASRNMERDWDNGSTASSITSV----AEYNGPRLFKEPSAKSNKPIIQNAIAHCCLAGKVNEAQKNAILDEIERCESNHLIILFRDGGCQFRALYIYSPETEEIIKLKGTGPRAISRKMIDRLYKYSSDRKQFT-VIPAKSVSVSVDALTIHSHLWQAK 1421          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Zebrafish
Match: camsap1a (calmodulin regulated spectrin-associated protein 1a [Source:ZFIN;Acc:ZDB-GENE-060518-4])

HSP 1 Score: 140.198 bits (352), Expect = 7.976e-33
Identity = 72/184 (39.13%), Postives = 110/184 (59.78%), Query Frame = 1
Query: 3217 DSVGNLPSASLQRNTWFSSMRISNRNTSQSTSKLNDNLIMDSNKFGVPLPPQEYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYWNAR 3768
            DSV +   AS  R     S  I +RN S++  +  DN    S+   V     EY GP+LF +   K+N+ +I NAI+HCCLAG VNE  K ++L ++   E  H +ILFRD  CQ+RA+Y ++   +E+  + G+GP+ I+ +M+++ YKY+S  KQF  +I  K +S +VDA+ I +  W A+
Sbjct: 1273 DSVAS-GGASSHRGESVESFPILSRNASRNMERDWDNGSTASSITSV----AEYNGPRLFKEPSAKSNKPIIQNAIAHCCLAGKVNEAQKNAILDEIERCESNHLIILFRDGGCQFRALYIYSPETEEIIKLKGTGPRAISRKMIDRLYKYSSDRKQFT-VIPAKSVSVSVDALTIHSHLWQAK 1450          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Xenopus
Match: CAMSAP1 (calmodulin regulated spectrin associated protein 1 [Source:NCBI gene;Acc:100488075])

HSP 1 Score: 142.51 bits (358), Expect = 2.157e-33
Identity = 63/124 (50.81%), Postives = 91/124 (73.39%), Query Frame = 1
Query: 3373 EYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICI 3744
            EY+GPKL+ +   K+N+ +I NAISHCCLAG VNETVK S L++L   +  H++ILFRDA CQ+RA+Y++  + +E+  + G+GPK IT +M++K YKY+S  KQF  +I  K +S +VDA+ I
Sbjct: 1256 EYSGPKLYKEPSSKSNKPIIHNAISHCCLAGKVNETVKNSTLEELEKCDSNHYIILFRDAGCQFRALYSYYPDTEEICKLMGTGPKNITKKMIDKLYKYSSDRKQFT-VIPAKTMSASVDALTI 1378          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Xenopus
Match: CAMSAP1 (calmodulin regulated spectrin associated protein 1 [Source:NCBI gene;Acc:100488075])

HSP 1 Score: 142.51 bits (358), Expect = 2.814e-33
Identity = 63/124 (50.81%), Postives = 91/124 (73.39%), Query Frame = 1
Query: 3373 EYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICI 3744
            EY+GPKL+ +   K+N+ +I NAISHCCLAG VNETVK S L++L   +  H++ILFRDA CQ+RA+Y++  + +E+  + G+GPK IT +M++K YKY+S  KQF  +I  K +S +VDA+ I
Sbjct: 1341 EYSGPKLYKEPSSKSNKPIIHNAISHCCLAGKVNETVKNSTLEELEKCDSNHYIILFRDAGCQFRALYSYYPDTEEICKLMGTGPKNITKKMIDKLYKYSSDRKQFT-VIPAKTMSASVDALTI 1463          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Xenopus
Match: CAMSAP1 (calmodulin regulated spectrin associated protein 1 [Source:NCBI gene;Acc:100488075])

HSP 1 Score: 142.124 bits (357), Expect = 3.192e-33
Identity = 63/124 (50.81%), Postives = 91/124 (73.39%), Query Frame = 1
Query: 3373 EYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICI 3744
            EY+GPKL+ +   K+N+ +I NAISHCCLAG VNETVK S L++L   +  H++ILFRDA CQ+RA+Y++  + +E+  + G+GPK IT +M++K YKY+S  KQF  +I  K +S +VDA+ I
Sbjct: 1388 EYSGPKLYKEPSSKSNKPIIHNAISHCCLAGKVNETVKNSTLEELEKCDSNHYIILFRDAGCQFRALYSYYPDTEEICKLMGTGPKNITKKMIDKLYKYSSDRKQFT-VIPAKTMSASVDALTI 1510          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Xenopus
Match: CAMSAP1 (calmodulin regulated spectrin associated protein 1 [Source:NCBI gene;Acc:100488075])

HSP 1 Score: 141.739 bits (356), Expect = 4.041e-33
Identity = 63/124 (50.81%), Postives = 91/124 (73.39%), Query Frame = 1
Query: 3373 EYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICI 3744
            EY+GPKL+ +   K+N+ +I NAISHCCLAG VNETVK S L++L   +  H++ILFRDA CQ+RA+Y++  + +E+  + G+GPK IT +M++K YKY+S  KQF  +I  K +S +VDA+ I
Sbjct: 1378 EYSGPKLYKEPSSKSNKPIIHNAISHCCLAGKVNETVKNSTLEELEKCDSNHYIILFRDAGCQFRALYSYYPDTEEICKLMGTGPKNITKKMIDKLYKYSSDRKQFT-VIPAKTMSASVDALTI 1500          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Xenopus
Match: CAMSAP2 (calmodulin regulated spectrin associated protein family member 2 [Source:NCBI gene;Acc:100488548])

HSP 1 Score: 141.739 bits (356), Expect = 4.056e-33
Identity = 62/132 (46.97%), Postives = 92/132 (69.70%), Query Frame = 1
Query: 3373 EYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYWNAR 3768
            EYTGPKL+ +   K+N+ +I NA+SHCCLAG VNE  K  +L+++  +   +F+ILFRDA CQ+R+VYT+    +E+N ++G GP+ I+ +M++  YKYNS  KQF+  I  K LS +VDA+ I +  W A+
Sbjct: 1324 EYTGPKLYKEPSAKSNKYIIQNALSHCCLAGKVNEGQKNKILEEMEKSNANNFLILFRDAGCQFRSVYTYCQEMEEINKLTGIGPRSISRKMIDGLYKYNSDRKQFSH-IPAKTLSASVDAVTIHSHLWQAK 1454          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Mouse
Match: Camsap1 (calmodulin regulated spectrin-associated protein 1 [Source:MGI Symbol;Acc:MGI:3036242])

HSP 1 Score: 148.673 bits (374), Expect = 2.835e-35
Identity = 66/132 (50.00%), Postives = 93/132 (70.45%), Query Frame = 1
Query: 3373 EYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYWNAR 3768
            EYTGPKLF +   K+N+ +I NAISHCCLAG VNE  K S+L++L   +  H++ILFRDA CQ+RA+Y +  + +E+  ++G+GPK IT +M++K YKY+S  KQFNL I  K +S +VDA+ I    W  +
Sbjct: 1440 EYTGPKLFKEPSSKSNKPIIHNAISHCCLAGKVNEPHKNSILEELEKCDANHYIILFRDAGCQFRALYCYQPDTEEIYKLTGTGPKSITKKMIDKLYKYSSDRKQFNL-IPAKTMSVSVDALTIHNHLWQPK 1570          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Mouse
Match: Camsap2 (calmodulin regulated spectrin-associated protein family, member 2 [Source:MGI Symbol;Acc:MGI:1922434])

HSP 1 Score: 144.436 bits (363), Expect = 1.774e-34
Identity = 62/132 (46.97%), Postives = 93/132 (70.45%), Query Frame = 1
Query: 3373 EYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYWNAR 3768
            EYTGPKL+ +   K+N+ +I NA++HCCLAG VNE  K+ +L+++  ++  +F+ILFRD+ CQ+R++YT+    +E+N ++G GPK IT +M+E  YKYNS  KQF+  I  K LS +VDAI I +  W  +
Sbjct:  671 EYTGPKLYKEPSAKSNKHIIQNALAHCCLAGKVNEGQKKKILEEMEKSDANNFLILFRDSGCQFRSLYTYCPETEEINKLTGIGPKSITKKMIEGLYKYNSDRKQFSH-IPAKTLSASVDAITIHSHLWQTK 801          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Mouse
Match: Camsap1 (calmodulin regulated spectrin-associated protein 1 [Source:MGI Symbol;Acc:MGI:3036242])

HSP 1 Score: 143.665 bits (361), Expect = 7.866e-34
Identity = 66/132 (50.00%), Postives = 92/132 (69.70%), Query Frame = 1
Query: 3373 EYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYWNAR 3768
            EYTGPKLF +   K+N+ +I NAISHCCLAG VNE  K S+L +L   +  H++ILFRDA CQ+RA+Y +  + +E+  ++G+GPK IT +M++K YKY+S  KQFNL I  K +S +VDA+ I    W  +
Sbjct: 1440 EYTGPKLFKEPSSKSNKPIIHNAISHCCLAGKVNEPHKNSIL-ELEKCDANHYIILFRDAGCQFRALYCYQPDTEEIYKLTGTGPKSITKKMIDKLYKYSSDRKQFNL-IPAKTMSVSVDALTIHNHLWQPK 1569          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Mouse
Match: Camsap1 (calmodulin regulated spectrin-associated protein 1 [Source:MGI Symbol;Acc:MGI:3036242])

HSP 1 Score: 143.665 bits (361), Expect = 7.866e-34
Identity = 66/132 (50.00%), Postives = 92/132 (69.70%), Query Frame = 1
Query: 3373 EYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYWNAR 3768
            EYTGPKLF +   K+N+ +I NAISHCCLAG VNE  K S+L +L   +  H++ILFRDA CQ+RA+Y +  + +E+  ++G+GPK IT +M++K YKY+S  KQFNL I  K +S +VDA+ I    W  +
Sbjct: 1440 EYTGPKLFKEPSSKSNKPIIHNAISHCCLAGKVNEPHKNSIL-ELEKCDANHYIILFRDAGCQFRALYCYQPDTEEIYKLTGTGPKSITKKMIDKLYKYSSDRKQFNL-IPAKTMSVSVDALTIHNHLWQPK 1569          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Mouse
Match: Camsap2 (calmodulin regulated spectrin-associated protein family, member 2 [Source:MGI Symbol;Acc:MGI:1922434])

HSP 1 Score: 142.124 bits (357), Expect = 2.237e-33
Identity = 62/132 (46.97%), Postives = 93/132 (70.45%), Query Frame = 1
Query: 3373 EYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYWNAR 3768
            EYTGPKL+ +   K+N+ +I NA++HCCLAG VNE  K+ +L+++  ++  +F+ILFRD+ CQ+R++YT+    +E+N ++G GPK IT +M+E  YKYNS  KQF+  I  K LS +VDAI I +  W  +
Sbjct: 1318 EYTGPKLYKEPSAKSNKHIIQNALAHCCLAGKVNEGQKKKILEEMEKSDANNFLILFRDSGCQFRSLYTYCPETEEINKLTGIGPKSITKKMIEGLYKYNSDRKQFSH-IPAKTLSASVDAITIHSHLWQTK 1448          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. UniProt/SwissProt
Match: sp|A5WUN7|CAM1B_DANRE (Calmodulin-regulated spectrin-associated protein 1-B OS=Danio rerio OX=7955 GN=camsap1b PE=3 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 4.383e-36
Identity = 83/190 (43.68%), Postives = 119/190 (62.63%), Query Frame = 1
Query: 3199 VASGRQDSVGNLPSASLQRNTWFSSMRISNRNTSQSTSKLNDNLIMDSNKFGVPLPPQEYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYWNAR 3768
            VA+   DSV N   A  QR     S    +RN+S++T +  DN    S+     +   EYTGPKLF +   K+N+ +I NAISHCCLAG VNE  K S+L++L   E  H MILFRD+ CQ+RA+Y++  + +E++ ++G+GPK IT +M++K YKY+S  KQF  +I  K +S +VDA+ I    W A+
Sbjct: 1363 VATTEPDSV-NSGGAGSQRGESVESFPGLSRNSSRTTERDWDNGSTASSITSTSM--AEYTGPKLFKEPSAKSNKPIIHNAISHCCLAGKVNEPQKNSILEELERCESNHLMILFRDSGCQFRALYSYFPDTEEIHKLTGTGPKSITKKMIDKLYKYSSDRKQFT-VIPAKTVSVSVDALTIHNHLWQAK 1548          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. UniProt/SwissProt
Match: sp|Q5T5Y3|CAMP1_HUMAN (Calmodulin-regulated spectrin-associated protein 1 OS=Homo sapiens OX=9606 GN=CAMSAP1 PE=1 SV=2)

HSP 1 Score: 149.058 bits (375), Expect = 1.390e-34
Identity = 79/181 (43.65%), Postives = 113/181 (62.43%), Query Frame = 1
Query: 3226 GNLPSASLQRNTWFSSMRISNRNTSQSTSKLNDNLIMDSNKFGVPLPPQEYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYWNAR 3768
            G  PS   QR     ++ I +RN S+ST +  +     S+   V     EYTGPKLF +   K+N+ +I NAISHCCLAG VNE  K S+L++L   +  H++ILFRDA CQ+RA+Y +  + +E+  ++G+GPK IT +M++K YKY+S  KQFNL I  K +S +VDA+ I    W  +
Sbjct: 1418 GGTPS---QRVESMEALPILSRNPSRSTDRDWETASAASSLASV----AEYTGPKLFKEPSSKSNKPIIHNAISHCCLAGKVNEPHKNSILEELEKCDANHYIILFRDAGCQFRALYCYYPDTEEIYKLTGTGPKNITKKMIDKLYKYSSDRKQFNL-IPAKTMSVSVDALTIHNHLWQPK 1590          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. UniProt/SwissProt
Match: sp|D3Z8E6|CAMP1_RAT (Calmodulin-regulated spectrin-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Camsap1 PE=1 SV=2)

HSP 1 Score: 148.288 bits (373), Expect = 2.161e-34
Identity = 66/132 (50.00%), Postives = 93/132 (70.45%), Query Frame = 1
Query: 3373 EYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYWNAR 3768
            EYTGPKLF +   K+N+ +I NAISHCCLAG VNE  K S+L++L   +  H++ILFRDA CQ+RA+Y +  + +E+  ++G+GPK IT +M++K YKY+S  KQFNL I  K +S +VDA+ I    W  +
Sbjct: 1462 EYTGPKLFKEPSSKSNKPIIHNAISHCCLAGKVNEPHKNSILEELEKCDANHYIILFRDAGCQFRALYCYQPDTEEIYKLTGTGPKSITKKMIDKLYKYSSDRKQFNL-IPAKTMSVSVDALTIHNHLWQPK 1592          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. UniProt/SwissProt
Match: sp|Q6IRN6|CAMP1_XENLA (Calmodulin-regulated spectrin-associated protein 1 OS=Xenopus laevis OX=8355 GN=camsap1 PE=2 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 4.330e-33
Identity = 63/132 (47.73%), Postives = 92/132 (69.70%), Query Frame = 1
Query: 3373 EYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYWNAR 3768
            EY+GPKL+ +   K+N+ +I NAISHCCLAG VNE +K S L +L   +  H++ILFRDA CQ+RA+Y++    +E+  ++G+GPK IT +M++K YKY+S  KQF  +I  K +S +VDA+ I    W A+
Sbjct: 1434 EYSGPKLYKEPSSKSNKPLIHNAISHCCLAGKVNEAIKNSTLDELEKCDSNHYIILFRDAGCQFRALYSYYPETEEICKLTGTGPKNITKKMIDKLYKYSSDRKQFT-VIPAKTMSASVDALTIHNHLWQAK 1564          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. UniProt/SwissProt
Match: sp|A2AHC3|CAMP1_MOUSE (Calmodulin-regulated spectrin-associated protein 1 OS=Mus musculus OX=10090 GN=Camsap1 PE=1 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 5.502e-33
Identity = 66/132 (50.00%), Postives = 92/132 (69.70%), Query Frame = 1
Query: 3373 EYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYWNAR 3768
            EYTGPKLF +   K+N+ +I NAISHCCLAG VNE  K S+L +L   +  H++ILFRDA CQ+RA+Y +  + +E+  ++G+GPK IT +M++K YKY+S  KQFNL I  K +S +VDA+ I    W  +
Sbjct: 1440 EYTGPKLFKEPSSKSNKPIIHNAISHCCLAGKVNEPHKNSIL-ELEKCDANHYIILFRDAGCQFRALYCYQPDTEEIYKLTGTGPKSITKKMIDKLYKYSSDRKQFNL-IPAKTMSVSVDALTIHNHLWQPK 1569          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. TrEMBL
Match: A0A448WAP0 (CKK domain-containing protein (Fragment) OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS562 PE=3 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 5.820e-52
Identity = 83/126 (65.87%), Postives = 103/126 (81.75%), Query Frame = 1
Query: 3385 PKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYWN 3762
            P+LF K K K+NR VIVNAI HCCLAG+VNE VK S LK+LA A GTHF+ILFRD+RCQYR+VYTF+L  +EL+++ GSGP+K+TH+MV+KF+KYN G+K F+ I STKHLSP VDAI I   +W 
Sbjct:   60 PRLFVKPKAKSNRMVIVNAIGHCCLAGAVNEPVKLSTLKELASAPGTHFIILFRDSRCQYRSVYTFDLETEELHILCGSGPRKVTHDMVDKFFKYNCGSKSFSQITSTKHLSPVVDAITIHGHFWG 185          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. TrEMBL
Match: Q5BSP1 (SJCHGC03663 protein (Fragment) OS=Schistosoma japonicum OX=6182 PE=2 SV=2)

HSP 1 Score: 194.512 bits (493), Expect = 1.227e-51
Identity = 101/216 (46.76%), Postives = 130/216 (60.19%), Query Frame = 1
Query: 3187 PRPVVASGRQDSVGNLPSASLQRNTWFSSMRISNRNTSQSTSKLNDNLI-------------------------MDSNKFGVPLPPQEYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYW 3759
            P PV   G  D      SA L  ++  SS+R +   T+++T  +N N                            +S   G  +P Q    P+LF K K K+NR+V+VNAISHCCLAG+VNE  K+  LK+LA  EGTHFMILFRD+RCQYRAVY+F+L  +EL +I G+GP++ITH+MV +F+KYNSG KQF  I STKHLSP VDA+ I    W
Sbjct:   61 PPPVTTRGSGDGEAVEASAELDYDS--SSLREAKVRTARATRHINGNTAPVNNAGSRNLLPSGISLSSLHRLGASESPSSGPGVPVQCLNQPRLFVKPKAKSNRTVVVNAISHCCLAGTVNEPTKQLALKELAATEGTHFMILFRDSRCQYRAVYSFDLELEELKIICGNGPRRITHDMVNRFFKYNSGTKQFTQITSTKHLSPVVDAVTIHDALW 274          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. TrEMBL
Match: G7YKC3 (Calmodulin-regulated spectrin-associated protein 1-B OS=Clonorchis sinensis OX=79923 GN=CLF_110152 PE=3 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 2.181e-51
Identity = 131/364 (35.99%), Postives = 190/364 (52.20%), Query Frame = 1
Query: 2854 FVISTDQ-EKEESQRKKAELLALREEKRRIKLELLKQKREQDRENRLSATIDELMXXXXXXXXXXXXXDSLLQKYLDRKKGETNTSSNNTAFEKRSASAA---------NTPVKLRTNSKTPRPVVASGRQDSVGNLPS--------------------ASLQRNTWFSSMRISN----RNTSQSTSKLNDNL--------------IMDSNKFGVPLPPQEYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYWNARPGSQIIQNAVS 3801
            F I+ D+ + +  QRK  +L A R  ++ +  + L+ +R Q+RE +L+  I++  +      +EK   +++LQ Y +++  ++N+   +  +  R  SAA          +P   RT S++  P     RQ S    P+                    A+L+ N    ++  S+     + +Q   + N                   DS+  G  L     T PKLF K K K+NR VIVNAI H CLAG+VNE +K++ LK+LA  EGTHFMILFRD+RCQYRAVY+F+L  +EL LI G+GP++ITHEM  +F+KYNSG K F  I ST HLSP VDAI I    W+   G     N +S
Sbjct:   68 FFIAFDEPDPQRMQRKCDQLEARRAAEKALVAQQLQTRRSQEREIKLA--IEQAQQERRANEREKR--EAILQAYKEKRDTDSNSPRPSELYPVRPGSAALSRSEANIAASPRDRRTGSQSVAPNKRGPRQPSRNTRPANPSDRRKSLTKSSTSLHSSSAALRGNADGEAVETSDGDIESDETQKKGRTNGTRLPSGLSLSSLHRLGCTDSSSSGPGLQVPSSTQPKLFVKPKAKSNRMVIVNAIGHACLAGAVNEPMKQATLKELAATEGTHFMILFRDSRCQYRAVYSFDLELEELRLICGTGPRRITHEMANRFFKYNSGGKHFTEITSTNHLSPVVDAITIHEALWSKSNGQAAALNLLS 427          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. TrEMBL
Match: A0A3R7EWD1 (Calmodulin-regulated spectrin-associated protein 1-B OS=Clonorchis sinensis OX=79923 GN=camsap1b PE=3 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 1.950e-50
Identity = 135/367 (36.78%), Postives = 198/367 (53.95%), Query Frame = 1
Query: 2854 FVISTDQ-EKEESQRKKAELLALREEKRRIKLELLKQKREQDRENRLSATIDELMXXXXXXXXXXXXXDSLLQKYLDRKKGETNTSSNNTAFEKRSASAA---------NTPVKLRTNSKT--------------PRPVVASGRQDSV---------------------------GNLPSASLQRNTWFSSMRISNRNTSQSTSKLNDNLIMDSNKFGVPLPPQEYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYWNARPGSQIIQNAVS 3801
            F I+ D+ + +  QRK  +L A R  ++ +  + L+ +R Q+RE +L+  I++   ++E++  E+EKR+++LQ Y +++  ++N+   +  +  R  SAA          +P   RT S++               RP   SGR+ S+                           G++ S   Q+    +  R+ +  +  S  +L      DS+  G  L     T PKLF K K K+NR VIVNAI H CLAG+VNE +K++ LK+LA  EGTHFMILFRD+RCQYRAVY+F+L  +EL LI G+GP++ITHEM  +F+KYNSG K F  I ST HLSP VDAI I    W+   G     N +S
Sbjct:  242 FFIAFDEPDPQRMQRKCDQLEARRAAEKALVAQQLQTRRSQEREIKLA--IEQ--AQQERRANEREKREAILQAYKEKRDTDSNSPRPSELYPVRPGSAALSRSEANIAASPRDRRTGSQSVAPNKRGPRQPSRNTRPANPSGRRKSLTKSSTSLHSSSAALRGNADGEAVETSDGDIESDETQKKGRTNGTRLPSGLSLSSLHRLG---CTDSSSSGPGLQVPSSTQPKLFVKPKAKSNRMVIVNAIGHACLAGAVNEPMKQATLKELAATEGTHFMILFRDSRCQYRAVYSFDLELEELRLICGTGPRRITHEMANRFFKYNSGGKHFTEITSTNHLSPVVDAITIHEALWSKSNGQAAALNLLS 601          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. TrEMBL
Match: A0A3P7LJ74 (CKK domain-containing protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS9281 PE=3 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 1.138e-49
Identity = 79/125 (63.20%), Postives = 106/125 (84.80%), Query Frame = 1
Query: 3385 PKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYW 3759
            P+L+ K K K+NR+VIVNAISHCCLAG+VN+++K++ L++LA  +G+HF++LFRD+RCQYRA+Y F+  ++ELNLISG+GP+KI H+MV+KF+KYNSG KQF  I STKHLS  VDAI I+  YW
Sbjct:   32 PRLYAKPKPKSNRAVIVNAISHCCLAGTVNDSLKKTTLQELAAVDGSHFIVLFRDSRCQYRALYAFDHESEELNLISGNGPRKIMHKMVDKFFKYNSGLKQFTEITSTKHLSTVVDAITIKNSYW 156          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000043780.1 (pep primary_assembly:Astyanax_mexicanus-2.0:14:26203540:26205202:-1 gene:ENSAMXG00000030624.1 transcript:ENSAMXT00000043780.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 146.362 bits (368), Expect = 8.004e-40
Identity = 66/136 (48.53%), Postives = 94/136 (69.12%), Query Frame = 1
Query: 3373 EYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYWNA-RPGS 3777
            EY GP+LF +   K+N+ +I NAI+HCCLAG VNE  K ++L+++   E  H MILFRD  CQ+RA+YTF L+ +E+  ++G+GP+ IT +M++K +KY+S  KQF  +I  K +S +VDAI I    W   RPGS
Sbjct:   28 EYNGPRLFKEPSAKSNKPIIQNAIAHCCLAGKVNEAQKNAILEEIERCESNHLMILFRDGGCQFRALYTFALDTEEILKLAGTGPRAITRKMIDKLFKYSSDRKQFT-VIPAKTVSASVDAITIHNHLWQVKRPGS 162          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000032448.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000101.1:5372420:5373665:1 gene:ENSAMXG00000040731.1 transcript:ENSAMXT00000032448.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 135.961 bits (341), Expect = 3.722e-36
Identity = 66/136 (48.53%), Postives = 89/136 (65.44%), Query Frame = 1
Query: 3373 EYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYWNA-RPGS 3777
            EYTGPKL+ +   K+N+ +I NAIS CCLAG VNE  K  +++++  +   HF+ILFRD+ CQ+RAVYT N   +EL  ++G GP+ I   MVE  YKY+S  KQF  I S K +S +VDA  I    W + RPG+
Sbjct:   29 EYTGPKLYKEPSFKSNKFIIHNAISRCCLAGKVNEPQKNKIIEEMEKSAANHFLILFRDSSCQFRAVYTMNPETEELVRLTGIGPRLIGPSMVESIYKYSSDRKQFTAIPS-KTMSMSVDAFTIPGHLWQSKRPGT 163          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Cavefish
Match: camsap1b (calmodulin-regulated spectrin-associated protein 1-B-like [Source:NCBI gene;Acc:103025505])

HSP 1 Score: 150.984 bits (380), Expect = 3.866e-36
Identity = 69/135 (51.11%), Postives = 94/135 (69.63%), Query Frame = 1
Query: 3373 EYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYWNA-RPG 3774
            EYTGPKLF +   K+N+ +I NAISHCCLAG VNE  K S+L++L   E  H MILFRD  CQ+RA+Y++  + +E+  ++G+GPK IT +M++K YKY+S  KQF  +I  K +S +VDA+ I    W A RPG
Sbjct: 1400 EYTGPKLFKEPSAKSNKPIIHNAISHCCLAGKVNEPQKNSILEELEKCESNHLMILFRDGGCQFRALYSYFPDTEEIQKLTGTGPKNITKKMIDKLYKYSSDRKQFT-VIPAKTVSVSVDALTIHNHLWQAKRPG 1533          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Cavefish
Match: camsap1b (calmodulin-regulated spectrin-associated protein 1-B-like [Source:NCBI gene;Acc:103025505])

HSP 1 Score: 150.984 bits (380), Expect = 4.312e-36
Identity = 69/135 (51.11%), Postives = 94/135 (69.63%), Query Frame = 1
Query: 3373 EYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYWNA-RPG 3774
            EYTGPKLF +   K+N+ +I NAISHCCLAG VNE  K S+L++L   E  H MILFRD  CQ+RA+Y++  + +E+  ++G+GPK IT +M++K YKY+S  KQF  +I  K +S +VDA+ I    W A RPG
Sbjct: 1415 EYTGPKLFKEPSAKSNKPIIHNAISHCCLAGKVNEPQKNSILEELEKCESNHLMILFRDGGCQFRALYSYFPDTEEIQKLTGTGPKNITKKMIDKLYKYSSDRKQFT-VIPAKTVSVSVDALTIHNHLWQAKRPG 1548          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Cavefish
Match: camsap2a (calmodulin regulated spectrin associated protein family member 2 [Source:NCBI gene;Acc:103034174])

HSP 1 Score: 140.584 bits (353), Expect = 5.409e-33
Identity = 61/136 (44.85%), Postives = 96/136 (70.59%), Query Frame = 1
Query: 3373 EYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYWNA-RPGS 3777
            EYTGPKL+ +   K+N+ +I NA++HCCLAG VNE  K  +L+++  +E  +F+ILFRDA CQ+R++YT+  + ++++ ++G GPK I+ +M++  YKYNS  KQF+  I  K +S +VDAI I +  W   +PG+
Sbjct: 1264 EYTGPKLYKEPSAKSNKHIIQNALAHCCLAGKVNEGQKNKILEEMEKSEANNFLILFRDAGCQFRSLYTYCPDTEDISKLTGIGPKSISRKMIDGLYKYNSDRKQFSQ-IPAKTMSASVDAITIHSHLWQTKKPGT 1398          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004216.1 (pep scaffold:Pmarinus_7.0:GL476360:496900:533135:-1 gene:ENSPMAG00000003828.1 transcript:ENSPMAT00000004216.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 140.969 bits (354), Expect = 9.704e-34
Identity = 65/139 (46.76%), Postives = 93/139 (66.91%), Query Frame = 1
Query: 3373 EYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYWNA-RPGSQII 3786
            EYTGPKL+ +   K+N+ +I NA+S+CCLAG VNE  K+ V+++L   +  H+MILFRDA CQYRA+Y F    +E+  ++G GPK ++ +M+++ YKY+S  KQF   I  K +S ++DA  IQ   W   RP S II
Sbjct: 1372 EYTGPKLYKEPSAKSNKHIIHNALSYCCLAGKVNELQKQKVIEELERCDANHYMILFRDAGCQYRALYAFFPETEEIQRVTGFGPKAVSAKMLDRLYKYSSDRKQFT-SIPAKTISVSMDAFTIQNHLWQPRRPSSTII 1509          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Nematostella
Match: EDO46314 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ86])

HSP 1 Score: 123.635 bits (309), Expect = 4.026e-28
Identity = 57/137 (41.61%), Postives = 94/137 (68.61%), Query Frame = 1
Query: 3373 EYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYW-NARPGSQ 3780
            E++GP+ + K   K+NR +IVNAIS+ CL+G+VN+  KE  L+ ++++ G HFM+LF+D   ++R +Y+FN   ++L  + G GP+ IT +M++  YKY+SG K+F + I +K LS +VD + I   YW +++P  Q
Sbjct: 2755 EFSGPQCYVKPSGKSNRKLIVNAISYVCLSGTVNKDAKERCLQAISESNGYHFMVLFKDG-LKFRGLYSFNPENEQLYKVFGIGPRVITAKMIDNLYKYSSGGKEF-VKIHSKTLSISVDGLSIMKQYWQSSKPAVQ 2889          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Nematostella
Match: EDO27938 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7V9])

HSP 1 Score: 49.2914 bits (116), Expect = 5.815e-6
Identity = 23/55 (41.82%), Postives = 35/55 (63.64%), Query Frame = 1
Query: 3601 LNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYWNA 3765
            L  + G GP+ IT +M++  YKY+SG K+F + I +K LS +VD + I   YW +
Sbjct:  218 LYKVFGIGPRVITAKMIDNLYKYSSGGKEF-VKIHSKTLSISVDGLSIMKQYWQS 271          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Medaka
Match: camsap3 (calmodulin-regulated spectrin-associated protein 3 [Source:NCBI gene;Acc:101163173])

HSP 1 Score: 150.214 bits (378), Expect = 6.954e-36
Identity = 73/170 (42.94%), Postives = 107/170 (62.94%), Query Frame = 1
Query: 3268 SSMRISNRNTSQSTSKLNDNLIMDSNKFGVPLPPQEYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYWNARPGS 3777
            S +R   R ++Q+  K  +N    S+   +P    EYTGPKL+ +   K+N+ +I NAI+ CCLAG VNE  K  +++D+  +   HF+ILFRD+ CQ+RAVYT N   +E+  ++G GP+ IT +MVE  YKY+S  KQF  +I +K +S +VDA  I   +W  RPG+
Sbjct: 1260 SRLRSPGRMSAQNGDKDWENGSTISSPASIP----EYTGPKLYKEPSFKSNKFIIHNAITRCCLAGKVNEPQKNKIVEDMETSTANHFLILFRDSSCQFRAVYTMNPETEEMVRLTGIGPRLITLDMVESIYKYSSDRKQFT-VIPSKTMSMSVDAFTIPGHFWQKRPGT 1424          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Medaka
Match: camsap3 (calmodulin-regulated spectrin-associated protein 3 [Source:NCBI gene;Acc:101163173])

HSP 1 Score: 149.828 bits (377), Expect = 7.322e-36
Identity = 73/170 (42.94%), Postives = 107/170 (62.94%), Query Frame = 1
Query: 3268 SSMRISNRNTSQSTSKLNDNLIMDSNKFGVPLPPQEYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYWNARPGS 3777
            S +R   R ++Q+  K  +N    S+   +P    EYTGPKL+ +   K+N+ +I NAI+ CCLAG VNE  K  +++D+  +   HF+ILFRD+ CQ+RAVYT N   +E+  ++G GP+ IT +MVE  YKY+S  KQF  +I +K +S +VDA  I   +W  RPG+
Sbjct: 1261 SRLRSPGRMSAQNGDKDWENGSTISSPASIP----EYTGPKLYKEPSFKSNKFIIHNAITRCCLAGKVNEPQKNKIVEDMETSTANHFLILFRDSSCQFRAVYTMNPETEEMVRLTGIGPRLITLDMVESIYKYSSDRKQFT-VIPSKTMSMSVDAFTIPGHFWQKRPGT 1425          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Medaka
Match: camsap1a (calmodulin-regulated spectrin-associated protein 1-B [Source:NCBI gene;Acc:101161659])

HSP 1 Score: 149.828 bits (377), Expect = 9.643e-36
Identity = 67/136 (49.26%), Postives = 93/136 (68.38%), Query Frame = 1
Query: 3373 EYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYWN-ARPGS 3777
            EY GPKLF +   K+N+ +I+NAI+HCCLAG VNE  K  VL++L   E  H +ILFRD  CQ+RA+YT++   +E+   +G+GP+ I+H+M++K YKY+S  KQF  II  K +S +VDA+ I    W   RPGS
Sbjct: 1393 EYNGPKLFKEPSSKSNKPIIINAIAHCCLAGKVNEVQKNLVLEELEKCECNHLIILFRDGGCQFRAIYTYSPETEEITKFTGTGPRSISHKMIDKLYKYSSDRKQFT-IIPAKSVSASVDALTIHNHLWQIKRPGS 1527          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Medaka
Match: camsap1b (calmodulin regulated spectrin associated protein 1 [Source:NCBI gene;Acc:101174352])

HSP 1 Score: 148.673 bits (374), Expect = 1.946e-35
Identity = 66/135 (48.89%), Postives = 93/135 (68.89%), Query Frame = 1
Query: 3373 EYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYWNARPGS 3777
            EYTGPKLF +   K+N+ +I NAISHCCLAG VNE  K  +L++L   E  H MILFRD  CQ+RA+Y++  + +E+  ++G+GPK I+ +M++K YKYNS  KQF  +I  K +S +VDA+ I    W A+ G+
Sbjct: 1387 EYTGPKLFKEPSAKSNKPIIHNAISHCCLAGKVNEPQKNQILEELEKCESNHLMILFRDGGCQFRALYSYFPDTEEIQKLTGTGPKSISKKMIDKLYKYNSDRKQFT-VIPAKTVSVSVDALTIHNHLWQAKRGT 1520          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Medaka
Match: camsap1b (calmodulin regulated spectrin associated protein 1 [Source:NCBI gene;Acc:101174352])

HSP 1 Score: 148.673 bits (374), Expect = 2.148e-35
Identity = 66/135 (48.89%), Postives = 93/135 (68.89%), Query Frame = 1
Query: 3373 EYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYWNARPGS 3777
            EYTGPKLF +   K+N+ +I NAISHCCLAG VNE  K  +L++L   E  H MILFRD  CQ+RA+Y++  + +E+  ++G+GPK I+ +M++K YKYNS  KQF  +I  K +S +VDA+ I    W A+ G+
Sbjct: 1398 EYTGPKLFKEPSAKSNKPIIHNAISHCCLAGKVNEPQKNQILEELEKCESNHLMILFRDGGCQFRALYSYFPDTEEIQKLTGTGPKSISKKMIDKLYKYNSDRKQFT-VIPAKTVSVSVDALTIHNHLWQAKRGT 1531          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Planmine SMEST
Match: SMESG000017885.1 (SMESG000017885.1)

HSP 1 Score: 2229.52 bits (5776), Expect = 0.000e+0
Identity = 1225/1251 (97.92%), Postives = 1232/1251 (98.48%), Query Frame = 1
Query:   85 TWLFYYSQSKSKSRYLDLSIEIDSDNHLKKQLCSSIPYIECSRNLNFILPNNVTGFRAIFHYLSNHKGRIIDKLTDQDLQSYIEHLENIKSFSVKHHISIIKCYMKAYVCELAPLMRIRKSFVSMAIPSSINLDDETYRNIQKHLIIWTNNSAVKGLQKLLQKSIKMFSESDARQFISSCSFSSQMVFCMSYFAQTKMIQYNIPVPEINTLIRNEPCKEELSNSHSEILLKAFSEICDGQDTFPIQRDKLCSISMENIQATLAIALVFHWIFGNSLKQLENLLKLSSPADTNKSQNRPTSIFINTNNEKLDEVKTNKTFYISSCNGKSERLNQIFTPRKTTNVRNLLDETQVDNKSSIDDGDSSPEIFLTPTEEEPPITFITPSINSIKLLSPKPIPSQPNKTMLVKQEIPEQMTISLKSEFXXXXXXXXXXXXXXVTLIPANETTWLAQNQKNTITPIPLTPKKSTMSLPSPTSTDVKNLTKAQLNEIQIKLGLKRQKIQQNQKQSAKETEKNIKDSKQKAFFQVLNKTNIQRRNSLESKHTANCPNNNHQLEKRLSLFMNNNKSGTEILSSTNIEINPXXXXXXXXXXXXXXXNLVADEKNQIDYDEYEENIKEIELPYSLQESDLAVCPVQIIQEQTIEIPVENSIEHTSQTHSHLNYIPEVSLLEEAXXXXXXXXXXXXXXXXXXXXXXDKLMINQEEYYKXXXXXXXXXXXXXXXXXXXXXXXXXWNRHITPELSVRDTSLETSIEVNKQTSESKSIPETPTNNFTSLTEITDIAKIKEQVNDCNFLSSHLPTITSHKSLEPSEFHKVVDLETQDSFKGVRYQHSTSLCDEDHENVNPSYLIKPNSLEHAPHSNETQTVSKKLNNLTESTVNVPIMIEENNNSVIXXXXXXXXXXXXAAGMXXXXXXXXXXXXXXXXXFVISTDQEKEESQRKKAELLALREEKRRIKLELLKQKREQDRENRLSATIDELMXXXXXXXXXXXXXDSLLQKYLDRKKGETNTSSNNTAFEKRSASAANTPVKLRTNSKTPRPVVASGRQDSVGNLPSASLQRNTWFSSMRISNRNTSQSTSKLNDNLIMDSNKFGVPLPPQEYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYWNARPGSQIIQNAVSMASINQSKSRKI 3837
            TWLFYYSQSKSKSRYLDLSIEIDSDNHLKKQLCSSIPYIECSRNLNFILPNNVTGFRAIFHYLSNHKGRIIDKLTDQDLQSYIEHLENI SFSVKHHISIIKCYMKAYVCELAPLMRIRKSFVSMAIPSSINLDDETYRNIQKHLIIWTNNSAVKGLQKLLQKSIKMFSESDARQFISSCSFSSQMVFCMSYFAQTKMIQYNIPVPEINTLIRNEP               +FSEICDGQDTFPIQRDKLCSISMENIQATLAIALVFHWIFGNSLKQLENLLKLSSP+DTNKSQNRPTSIFINTNNEKLDEVKTNKTFYISSCNGKSERLNQIFTPRKTTNVRNLLDETQVDNKSSIDDGDSSPEIFLTPTEEEPPITFITPSINSIKLLSPKPI SQPNKTMLVKQEIPEQMTISLKSEFQKKQQQKLN AKTKVTLIPANETTWLAQNQKNTITPIPLTPKKSTMSLPSPTSTDVKNLTKAQLNEIQIKLGLKRQKIQQNQKQSAKETEKNIKDSKQKAFFQVLNKTNIQRRNSLESKHTANCPN+NHQLEKRLSLFMNNNKSGTEILS+TNIEINPSDSDSLLLEKSSEEKNLV+DEKNQIDYDEYEENIKEIELPYSLQESDLAVCPVQIIQEQTIEIPVENSIEHTSQTHSHLNYIPEVSLLEEASVSRKNSSTSISSLSSISNKSSDKLMINQEEYYKSINILNQSLSSLQQEIRQLSQQQQSWNRHITPELSVRDTSLETSIEVNKQTSESKSIPETPTNNFTSLTEITDIAKIKEQVNDCNFLSSHLPTITSHKSLEPSEFHKVVDLETQDSFKGVRYQHS SLCDEDHENVNPSYLIKPNSLEHAPHSNETQT+SKKLNNLTESTVNVPIMIEENNNSVIHSSHTNSSTDDDAAGMTSSTDSSIISSNIPPITFVISTDQEKEESQRKKAELLALREEKRRIKLELLKQKREQDRENRLSATIDELMEREEKKRQEKEKRDSLLQKYLDRKKGETNTSSNNTAFEKRSASAANTPVKLRTNSKTPRPVVASGRQDSVGNLPSASLQRNTWFSSMRISNRNTSQSTSKLN+NLIMDSNKFGVPLPPQEYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYWNARPGSQIIQNAVSMASINQSKSRKI
Sbjct:    8 TWLFYYSQSKSKSRYLDLSIEIDSDNHLKKQLCSSIPYIECSRNLNFILPNNVTGFRAIFHYLSNHKGRIIDKLTDQDLQSYIEHLENINSFSVKHHISIIKCYMKAYVCELAPLMRIRKSFVSMAIPSSINLDDETYRNIQKHLIIWTNNSAVKGLQKLLQKSIKMFSESDARQFISSCSFSSQMVFCMSYFAQTKMIQYNIPVPEINTLIRNEP---------------SFSEICDGQDTFPIQRDKLCSISMENIQATLAIALVFHWIFGNSLKQLENLLKLSSPSDTNKSQNRPTSIFINTNNEKLDEVKTNKTFYISSCNGKSERLNQIFTPRKTTNVRNLLDETQVDNKSSIDDGDSSPEIFLTPTEEEPPITFITPSINSIKLLSPKPIRSQPNKTMLVKQEIPEQMTISLKSEFQKKQQQKLNLAKTKVTLIPANETTWLAQNQKNTITPIPLTPKKSTMSLPSPTSTDVKNLTKAQLNEIQIKLGLKRQKIQQNQKQSAKETEKNIKDSKQKAFFQVLNKTNIQRRNSLESKHTANCPNDNHQLEKRLSLFMNNNKSGTEILSTTNIEINPSDSDSLLLEKSSEEKNLVSDEKNQIDYDEYEENIKEIELPYSLQESDLAVCPVQIIQEQTIEIPVENSIEHTSQTHSHLNYIPEVSLLEEASVSRKNSSTSISSLSSISNKSSDKLMINQEEYYKSINILNQSLSSLQQEIRQLSQQQQSWNRHITPELSVRDTSLETSIEVNKQTSESKSIPETPTNNFTSLTEITDIAKIKEQVNDCNFLSSHLPTITSHKSLEPSEFHKVVDLETQDSFKGVRYQHSASLCDEDHENVNPSYLIKPNSLEHAPHSNETQTMSKKLNNLTESTVNVPIMIEENNNSVIHSSHTNSSTDDDAAGMTSSTDSSIISSNIPPITFVISTDQEKEESQRKKAELLALREEKRRIKLELLKQKREQDRENRLSATIDELMEREEKKRQEKEKRDSLLQKYLDRKKGETNTSSNNTAFEKRSASAANTPVKLRTNSKTPRPVVASGRQDSVGNLPSASLQRNTWFSSMRISNRNTSQSTSKLNENLIMDSNKFGVPLPPQEYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYWNARPGSQIIQNAVSMASINQSKSRKI 1243          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Planmine SMEST
Match: SMESG000062885.1 (SMESG000062885.1)

HSP 1 Score: 145.591 bits (366), Expect = 9.209e-35
Identity = 99/290 (34.14%), Postives = 165/290 (56.90%), Query Frame = 1
Query: 2899 KAELLAL--REEKRRIKLELLKQKREQDRENRLSATIDELMXXXXXXXXXXXXXDSLLQKYLDRKKGETNTSSNNTAFEKRSASAANTPVKLRTNSKTPRPVVASGRQDSVGNLPSASLQRNTWFSSMRISNRNTSQSTSKLNDNLIMDSNKFGVP-LPPQEYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYW 3759
            K +LL L  RE++R+ KLE +K+    + E RL   +++   +EE+KR+     ++ L+K L+++  +++ ++ +T   ++       PV  R  S  P                  ++QRN   + + +     +   S   D + ++S +  +P + P    GPKLF + K K+N+ VI+NAI +CCLAG VNE++K+  +++L   + +HFM+L R   CQYR++Y F + ++ L  ++G GPKKIT++MV+KF+KYNSGAK+F  I ST HLS  +D I I    W
Sbjct:  953 KEKLLHLEKREQERKEKLEKIKEITRLENEKRLQKELEKEKLKEERKRKRDAIFEAHLEKKLEKETFDSHKTTKDTKIIRK-------PV--RATSAVP------------------TMQRNELNNEIILDI--ATHPDSSFTDLITLNSKRERIPTICP----GPKLFVEPKSKSNKGVILNAIKYCCLAGRVNESLKQQTVEELERFDASHFMVLMRGG-CQYRSLYRFEIESECLTKLTGVGPKKITNKMVDKFFKYNSGAKKFMEITSTNHLSTVIDGITIFNTLW 1208          
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Planmine SMEST
Match: SMESG000062885.1 (SMESG000062885.1)

HSP 1 Score: 145.591 bits (366), Expect = 1.061e-34
Identity = 99/290 (34.14%), Postives = 165/290 (56.90%), Query Frame = 1
Query: 2899 KAELLAL--REEKRRIKLELLKQKREQDRENRLSATIDELMXXXXXXXXXXXXXDSLLQKYLDRKKGETNTSSNNTAFEKRSASAANTPVKLRTNSKTPRPVVASGRQDSVGNLPSASLQRNTWFSSMRISNRNTSQSTSKLNDNLIMDSNKFGVP-LPPQEYTGPKLFGKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFRDARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNLIISTKHLSPAVDAICIQALYW 3759
            K +LL L  RE++R+ KLE +K+    + E RL   +++   +EE+KR+     ++ L+K L+++  +++ ++ +T   ++       PV  R  S  P                  ++QRN   + + +     +   S   D + ++S +  +P + P    GPKLF + K K+N+ VI+NAI +CCLAG VNE++K+  +++L   + +HFM+L R   CQYR++Y F + ++ L  ++G GPKKIT++MV+KF+KYNSGAK+F  I ST HLS  +D I I    W
Sbjct:  950 KEKLLHLEKREQERKEKLEKIKEITRLENEKRLQKELEKEKLKEERKRKRDAIFEAHLEKKLEKETFDSHKTTKDTKIIRK-------PV--RATSAVP------------------TMQRNELNNEIILDI--ATHPDSSFTDLITLNSKRERIPTICP----GPKLFVEPKSKSNKGVILNAIKYCCLAGRVNESLKQQTVEELERFDASHFMVLMRGG-CQYRSLYRFEIESECLTKLTGVGPKKITNKMVDKFFKYNSGAKKFMEITSTNHLSTVIDGITIFNTLW 1205          
The following BLAST results are available for this feature:
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CAMSAP11.766e-3543.65calmodulin regulated spectrin associated protein 1... [more]
CAMSAP12.894e-3543.65calmodulin regulated spectrin associated protein 1... [more]
CAMSAP13.274e-3543.65calmodulin regulated spectrin associated protein 1... [more]
CAMSAP23.316e-3346.97calmodulin regulated spectrin associated protein f... [more]
CAMSAP23.568e-3346.97calmodulin regulated spectrin associated protein f... [more]
back to top
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ptrn-15.140e-2741.94Patronin (microtubule-binding protein) homolog [S... [more]
ptrn-16.090e-2641.94Patronin (microtubule-binding protein) homolog [S... [more]
ptrn-15.434e-2541.94Patronin (microtubule-binding protein) homolog [S... [more]
ptrn-15.472e-2541.94Patronin (microtubule-binding protein) homolog [S... [more]
back to top
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Patronin1.567e-3141.67gene:FBgn0263197 transcript:FBtr0332262[more]
Patronin3.228e-3141.67gene:FBgn0263197 transcript:FBtr0332260[more]
Patronin9.764e-3132.99gene:FBgn0263197 transcript:FBtr0332266[more]
Patronin1.687e-3041.54gene:FBgn0263197 transcript:FBtr0273447[more]
Patronin1.969e-3041.54gene:FBgn0263197 transcript:FBtr0086948[more]
back to top
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
camsap1b5.806e-3743.68calmodulin regulated spectrin-associated protein 1... [more]
camsap2b2.340e-3648.06calmodulin regulated spectrin-associated protein f... [more]
camsap2b4.477e-3648.06calmodulin regulated spectrin-associated protein f... [more]
camsap1a1.809e-3330.98calmodulin regulated spectrin-associated protein 1... [more]
camsap1a7.976e-3339.13calmodulin regulated spectrin-associated protein 1... [more]
back to top
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CAMSAP12.157e-3350.81calmodulin regulated spectrin associated protein 1... [more]
CAMSAP12.814e-3350.81calmodulin regulated spectrin associated protein 1... [more]
CAMSAP13.192e-3350.81calmodulin regulated spectrin associated protein 1... [more]
CAMSAP14.041e-3350.81calmodulin regulated spectrin associated protein 1... [more]
CAMSAP24.056e-3346.97calmodulin regulated spectrin associated protein f... [more]
back to top
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Camsap12.835e-3550.00calmodulin regulated spectrin-associated protein 1... [more]
Camsap21.774e-3446.97calmodulin regulated spectrin-associated protein f... [more]
Camsap17.866e-3450.00calmodulin regulated spectrin-associated protein 1... [more]
Camsap17.866e-3450.00calmodulin regulated spectrin-associated protein 1... [more]
Camsap22.237e-3346.97calmodulin regulated spectrin-associated protein f... [more]
back to top
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A5WUN7|CAM1B_DANRE4.383e-3643.68Calmodulin-regulated spectrin-associated protein 1... [more]
sp|Q5T5Y3|CAMP1_HUMAN1.390e-3443.65Calmodulin-regulated spectrin-associated protein 1... [more]
sp|D3Z8E6|CAMP1_RAT2.161e-3450.00Calmodulin-regulated spectrin-associated protein 1... [more]
sp|Q6IRN6|CAMP1_XENLA4.330e-3347.73Calmodulin-regulated spectrin-associated protein 1... [more]
sp|A2AHC3|CAMP1_MOUSE5.502e-3350.00Calmodulin-regulated spectrin-associated protein 1... [more]
back to top
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A448WAP05.820e-5265.87CKK domain-containing protein (Fragment) OS=Protop... [more]
Q5BSP11.227e-5146.76SJCHGC03663 protein (Fragment) OS=Schistosoma japo... [more]
G7YKC32.181e-5135.99Calmodulin-regulated spectrin-associated protein 1... [more]
A0A3R7EWD11.950e-5036.78Calmodulin-regulated spectrin-associated protein 1... [more]
A0A3P7LJ741.138e-4963.20CKK domain-containing protein OS=Dibothriocephalus... [more]
back to top
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000043780.18.004e-4048.53pep primary_assembly:Astyanax_mexicanus-2.0:14:262... [more]
ENSAMXT00000032448.13.722e-3648.53pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
camsap1b3.866e-3651.11calmodulin-regulated spectrin-associated protein 1... [more]
camsap1b4.312e-3651.11calmodulin-regulated spectrin-associated protein 1... [more]
camsap2a5.409e-3344.85calmodulin regulated spectrin associated protein f... [more]
back to top
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000004216.19.704e-3446.76pep scaffold:Pmarinus_7.0:GL476360:496900:533135:-... [more]
back to top
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO463144.026e-2841.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO279385.815e-641.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
camsap36.954e-3642.94calmodulin-regulated spectrin-associated protein 3... [more]
camsap37.322e-3642.94calmodulin-regulated spectrin-associated protein 3... [more]
camsap1a9.643e-3649.26calmodulin-regulated spectrin-associated protein 1... [more]
camsap1b1.946e-3548.89calmodulin regulated spectrin associated protein 1... [more]
camsap1b2.148e-3548.89calmodulin regulated spectrin associated protein 1... [more]
back to top
BLAST of Calmodulin-regulated spectrin-associated protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000017885.10.000e+097.92SMESG000017885.1[more]
SMESG000062885.19.209e-3534.14SMESG000062885.1[more]
SMESG000062885.11.061e-3434.14SMESG000062885.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035680 ID=SMED30035680|Name=Calmodulin-regulated spectrin-associated protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=4418bp
CGTTAATTTACTATATTTTAACTAACTTGAGTAAAATTTTCGAACTTTGA
TTCAAATTAATTTTAGGATAATAATTTTTTCTTTACTTGGCTTTTTTACT
ATTCACAATCCAAATCTAAGTCTAGATATTTAGATTTATCAATTGAAATT
GATTCTGATAATCATTTGAAAAAACAATTATGTTCTTCAATACCTTATAT
TGAATGCAGTAGAAATTTGAACTTTATTTTACCAAATAATGTTACCGGAT
TCCGCGCAATTTTCCATTATCTCTCGAATCACAAAGGTAGAATTATAGAT
AAATTAACGGATCAAGATCTGCAATCATATATCGAGCACTTAGAAAACAT
TAAAAGTTTCTCAGTGAAGCATCACATTTCTATCATCAAATGCTACATGA
AGGCCTATGTATGTGAATTAGCACCTTTGATGAGAATACGAAAATCTTTT
GTTTCAATGGCAATTCCTAGTAGCATTAATCTGGATGACGAAACTTATAG
AAATATTCAGAAACATCTCATAATATGGACCAATAATTCTGCAGTAAAAG
GTCTTCAAAAGCTTTTACAAAAATCTATAAAAATGTTTTCAGAATCTGAT
GCCAGGCAATTTATCAGTTCCTGTAGTTTTTCTAGTCAAATGGTATTTTG
TATGTCATATTTTGCACAAACGAAAATGATTCAATATAACATACCTGTGC
CAGAAATAAATACTTTGATTAGAAATGAGCCATGTAAGGAAGAATTGTCA
AATAGTCATTCGGAAATTTTACTGAAAGCTTTTTCTGAAATTTGCGATGG
TCAGGATACATTTCCCATTCAGCGTGACAAACTGTGCTCTATATCTATGG
AAAACATACAAGCCACCTTAGCTATAGCTCTAGTCTTTCATTGGATTTTT
GGAAATTCGTTGAAACAGTTGGAAAATCTTCTAAAATTGTCGTCACCTGC
TGATACGAATAAATCACAAAACCGACCAACAAGCATTTTTATCAATACAA
ACAATGAGAAGCTGGATGAAGTCAAAACCAATAAAACATTTTATATCTCC
TCATGTAATGGGAAAAGTGAGAGATTAAACCAAATTTTCACTCCTAGAAA
GACAACTAACGTGAGGAATTTGCTTGACGAAACTCAAGTTGACAATAAAT
CTAGTATTGATGATGGGGATAGTTCTCCCGAAATTTTCCTGACTCCTACA
GAAGAAGAGCCGCCTATCACATTTATAACTCCATCAATAAATTCCATTAA
GCTATTGTCACCAAAACCTATTCCCAGTCAGCCAAATAAAACTATGTTAG
TTAAACAAGAAATTCCCGAACAAATGACAATTAGTCTTAAATCTGAATTC
CAAAAGAAACAACAACAGAAACTAAACCAAGCAAAAACGAAAGTTACTCT
CATACCAGCCAATGAAACTACTTGGCTAGCTCAAAATCAAAAAAATACCA
TTACACCTATTCCATTAACACCTAAAAAAAGTACCATGTCTCTTCCGTCT
CCTACGTCAACAGATGTTAAAAATTTAACAAAAGCTCAGCTGAATGAAAT
TCAGATTAAATTAGGATTGAAGCGGCAAAAAATCCAGCAAAATCAAAAAC
AATCCGCAAAGGAAACTGAAAAAAACATTAAAGATTCCAAGCAAAAGGCA
TTTTTTCAGGTTCTCAACAAAACCAATATCCAGCGGAGAAATTCTTTGGA
ATCTAAACATACCGCAAATTGTCCCAATAATAATCACCAATTGGAAAAAC
GTTTATCATTATTTATGAACAATAACAAATCAGGTACCGAAATACTTTCC
AGCACAAACATAGAAATTAATCCCTCAGATTCTGATTCATTGCTGCTAGA
AAAGAGTTCTGAAGAAAAGAATTTAGTTGCCGACGAGAAAAACCAAATCG
ATTATGATGAATATGAAGAAAATATTAAAGAAATTGAACTTCCCTATTCT
CTTCAAGAATCAGATTTAGCCGTCTGTCCTGTTCAGATTATTCAAGAGCA
AACCATTGAAATCCCTGTTGAAAATTCCATTGAACACACCTCTCAAACTC
ATTCGCATTTAAATTACATACCAGAGGTCTCTTTGTTGGAGGAAGCATCT
GTCTCAAGAAAAAACAGTTCCACCTCAATCTCTAGTCTTTCTAGTATCAG
TAATAAAAGCTCGGACAAGTTAATGATTAACCAAGAAGAATATTATAAAT
CCATAAATATTCTGAATCAAAGTCTGTCATCCTTGCAACAGGAAATCCGC
CAATTAAGTCAACAACAACAATCATGGAATAGGCATATAACACCCGAATT
ATCAGTAAGAGACACTTCTTTGGAAACCAGCATAGAAGTCAATAAGCAAA
CCTCTGAAAGCAAATCTATTCCTGAAACTCCAACTAACAACTTTACATCA
TTGACAGAAATCACTGATATTGCTAAAATCAAAGAACAAGTTAATGATTG
CAATTTTTTGTCTTCTCATCTTCCAACAATCACATCACACAAATCATTAG
AACCTTCAGAGTTTCACAAGGTTGTTGACTTGGAAACACAAGATTCATTC
AAAGGAGTTCGATATCAACATTCTACGTCTCTATGTGATGAAGATCATGA
AAACGTAAATCCTTCATATTTAATTAAACCGAATTCCTTGGAACATGCTC
CTCATAGTAACGAGACGCAAACCGTGAGCAAAAAATTGAACAATCTAACT
GAAAGCACAGTTAATGTTCCGATTATGATTGAAGAGAATAACAATTCAGT
AATCCACTCATCACATACCAATTCTAGCACTGATGACGACGCAGCCGGGA
TGACTTCATCCACAGATTCCTCTATTATTTCTTCGAATATTCCCCCGATC
ACTTTTGTTATTAGCACTGATCAGGAAAAGGAAGAATCTCAAAGAAAAAA
AGCTGAATTATTAGCACTTCGAGAAGAGAAAAGGCGAATAAAACTAGAAT
TATTAAAACAAAAGCGTGAGCAAGATAGAGAAAATCGTTTAAGCGCAACG
ATAGATGAATTGATGGAACGCGAAGAGAAAAAGAGGCAAGAAAAAGAAAA
ACGAGATAGCTTGCTGCAAAAATATCTTGATCGTAAGAAAGGCGAAACGA
ATACTTCTTCCAATAATACCGCATTTGAAAAAAGATCAGCTTCTGCTGCA
AATACACCGGTAAAATTGCGTACCAATTCGAAAACTCCCAGACCTGTAGT
GGCTAGTGGTAGACAAGACTCTGTTGGCAATCTTCCATCAGCCAGTCTGC
AAAGGAATACTTGGTTTTCTTCAATGAGGATCAGTAATAGAAATACGTCA
CAATCTACATCAAAACTAAATGATAATCTTATCATGGATTCTAACAAATT
TGGTGTACCTCTTCCGCCTCAGGAATATACAGGCCCTAAATTATTCGGTA
AACGTAAAGTCAAAACCAACAGATCAGTAATTGTTAACGCCATTTCTCAC
TGTTGTTTGGCTGGCTCAGTCAATGAAACAGTTAAAGAATCAGTTCTGAA
GGACTTGGCGGACGCTGAAGGAACTCATTTCATGATTCTGTTCCGAGACG
CCAGGTGTCAGTATCGAGCAGTTTATACGTTTAATTTAAACGCGGATGAA
TTGAATTTGATTAGTGGCAGTGGACCCAAGAAAATAACTCATGAAATGGT
GGAAAAGTTTTATAAATACAATAGCGGTGCTAAACAATTCAATCTAATAA
TTTCCACCAAGCATTTATCCCCGGCAGTCGATGCGATATGTATACAAGCC
CTGTATTGGAACGCCCGACCTGGCAGTCAAATAATCCAAAATGCCGTATC
AATGGCTAGCATAAATCAATCAAAATCTAGAAAAATCTAAAGAAAAAAAT
TTAATTTTCAACCACCGAAAATTTTGAGATTGATTTTATTTATTTATTTA
TTAATATTATTAATCAAAAAATAGCATTGTGATCGGGATCATATTTTTGT
TCGTTTGTGTCTGTAAAAATTCGAGATTAACATATATGATAGAAGTGCTT
TATATATATTTGATTCATATTGAGATCGCTTTCTTTCAGTTATATAAATA
TATTATTCGCGTGAAATTTCTCGGTTTTATTATTGGAGGAAAATTTTAGT
AAATATATTGATTTTATCTTCATATGTTAAAATGCTGAGCTTGCATGTAT
TTCTCTGAGAAAAAGTTTCAGCTGATGCCATTATAGAGATTGGACTAAAT
ATTAATAAAATAGTTTTATTGGAAATTATCTGTGATATATTAATTTCTAG
TTGTTTTCTGTTGTTTTAATGAGGTAGCACATTTTCATTGATTTATTATT
ATTATTGATATTTGAATTGTTTTAATTATCGGAATAATATAAAAATATTG
ATTTAGAGAGATTTTTGTGTAAATATTATTCAAGTAATCGAGATAAAAAT
TAATGTTTTTTTCTTTTC
back to top

protein sequence of SMED30035680-orf-1

>SMED30035680-orf-1 ID=SMED30035680-orf-1|Name=SMED30035680-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1148bp
MKAYVCELAPLMRIRKSFVSMAIPSSINLDDETYRNIQKHLIIWTNNSAV
KGLQKLLQKSIKMFSESDARQFISSCSFSSQMVFCMSYFAQTKMIQYNIP
VPEINTLIRNEPCKEELSNSHSEILLKAFSEICDGQDTFPIQRDKLCSIS
MENIQATLAIALVFHWIFGNSLKQLENLLKLSSPADTNKSQNRPTSIFIN
TNNEKLDEVKTNKTFYISSCNGKSERLNQIFTPRKTTNVRNLLDETQVDN
KSSIDDGDSSPEIFLTPTEEEPPITFITPSINSIKLLSPKPIPSQPNKTM
LVKQEIPEQMTISLKSEFQKKQQQKLNQAKTKVTLIPANETTWLAQNQKN
TITPIPLTPKKSTMSLPSPTSTDVKNLTKAQLNEIQIKLGLKRQKIQQNQ
KQSAKETEKNIKDSKQKAFFQVLNKTNIQRRNSLESKHTANCPNNNHQLE
KRLSLFMNNNKSGTEILSSTNIEINPSDSDSLLLEKSSEEKNLVADEKNQ
IDYDEYEENIKEIELPYSLQESDLAVCPVQIIQEQTIEIPVENSIEHTSQ
THSHLNYIPEVSLLEEASVSRKNSSTSISSLSSISNKSSDKLMINQEEYY
KSINILNQSLSSLQQEIRQLSQQQQSWNRHITPELSVRDTSLETSIEVNK
QTSESKSIPETPTNNFTSLTEITDIAKIKEQVNDCNFLSSHLPTITSHKS
LEPSEFHKVVDLETQDSFKGVRYQHSTSLCDEDHENVNPSYLIKPNSLEH
APHSNETQTVSKKLNNLTESTVNVPIMIEENNNSVIHSSHTNSSTDDDAA
GMTSSTDSSIISSNIPPITFVISTDQEKEESQRKKAELLALREEKRRIKL
ELLKQKREQDRENRLSATIDELMEREEKKRQEKEKRDSLLQKYLDRKKGE
TNTSSNNTAFEKRSASAANTPVKLRTNSKTPRPVVASGRQDSVGNLPSAS
LQRNTWFSSMRISNRNTSQSTSKLNDNLIMDSNKFGVPLPPQEYTGPKLF
GKRKVKTNRSVIVNAISHCCLAGSVNETVKESVLKDLADAEGTHFMILFR
DARCQYRAVYTFNLNADELNLISGSGPKKITHEMVEKFYKYNSGAKQFNL
IISTKHLSPAVDAICIQALYWNARPGSQIIQNAVSMASINQSKSRKI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000428musculature system
PLANA:0000478pharynx musculature
Vocabulary: INTERPRO
TermDefinition
IPR038209CKK_dom_sf
IPR032940CAMSAP
IPR014797CKK_domain
IPR011033PRC_barrel-like_sf
Vocabulary: molecular function
TermDefinition
GO:0008017microtubule binding
GO:0005516calmodulin binding
Vocabulary: cellular component
TermDefinition
GO:0005874microtubule
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 699..767
NoneNo IPR availableCOILSCoilCoilcoord: 478..505
NoneNo IPR availableCOILSCoilCoilcoord: 272..292
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 775..817
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 750..774
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 750..817
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 664..683
NoneNo IPR availableTMHMMTMhelixcoord: 21..43
IPR014797CKK domainSMARTSM01051CAMSAP_CKK_2coord: 870..999
e-value: 2.5E-53
score: 193.2
IPR014797CKK domainPFAMPF08683CAMSAP_CKKcoord: 872..991
e-value: 1.0E-46
score: 158.0
IPR014797CKK domainPROSITEPS51508CKKcoord: 871..1006
score: 48.329
IPR038209CKK domain superfamilyGENE3DG3DSA:3.10.20.360coord: 883..992
e-value: 7.4E-40
score: 137.2
IPR032940Calmodulin-regulated spectrin-associated proteinPANTHERPTHR21595UNCHARACTERIZEDcoord: 62..999
IPR011033PRC-barrel-like superfamilySUPERFAMILYSSF50346PRC-barrel domaincoord: 867..999