U2 small nuclear ribonucleoprotein A'

Overview
NameU2 small nuclear ribonucleoprotein A'
Smed IDSMED30035650
Length (bp)1143
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of U2 small nuclear ribonucleoprotein A' (SMED30035650) t-SNE clustered cells

Violin plots show distribution of expression levels for U2 small nuclear ribonucleoprotein A' (SMED30035650) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of U2 small nuclear ribonucleoprotein A' (SMED30035650) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for U2 small nuclear ribonucleoprotein A' (SMED30035650) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035650

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30035650h1SMcG0019712 SmedASXL_019339SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30035650h1SMcG0019712 SmedASXL_019339SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30035650h1SMcG0019712 dd_Smed_v4_3389_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Human
Match: SNRPA1 (small nuclear ribonucleoprotein polypeptide A' [Source:HGNC Symbol;Acc:HGNC:11152])

HSP 1 Score: 222.631 bits (566), Expect = 2.241e-70
Identity = 115/246 (46.75%), Postives = 167/246 (67.89%), Query Frame = 3
Query:   63 MTKITLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKERKQAAQLFAGKTGEQLMK-IQRIPIYNGKSKSVEVGSDSNIQEQVDIDSSKQVIMRPSSADMYALRASIQNATTMEEVDRLNFILNSGKYAG 797
            M K+T ELIE + Q TN ++DRELDL+G KI +IENLG TLDQFD++DF+DNEI + DGFP L+RL ++   NN+I +I + L+Q +P +T L+ TNN++ EL ++D L+  K L +L++L+NP+    +YRLYVI+K+PQVR+LDF +VK KER++A ++F GK G QL K I R      +SK+   G+       +  D  K     PS  D+ A++ +I NA+T+ EV+RL  +L SG+  G
Sbjct:    1 MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIAR------RSKTFNPGAG------LPTDKKKG---GPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPG 231          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Human
Match: SNRPA1 (small nuclear ribonucleoprotein polypeptide A' [Source:HGNC Symbol;Acc:HGNC:11152])

HSP 1 Score: 177.178 bits (448), Expect = 4.549e-54
Identity = 82/153 (53.59%), Postives = 117/153 (76.47%), Query Frame = 3
Query:   63 MTKITLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDK 521
            M K+T ELIE + Q TN ++DRELDL+G KI +IENLG TLDQFD++DF+DNEI + DGFP L+RL ++   NN+I +I + L+Q +P +T L+ TNN++ EL ++D L+  K L +L++L+NP+    +YRLYVI+K+PQVR+LDF +VK K
Sbjct:    1 MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLK 153          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Human
Match: SNRPA1 (small nuclear ribonucleoprotein polypeptide A' [Source:HGNC Symbol;Acc:HGNC:11152])

HSP 1 Score: 177.178 bits (448), Expect = 4.549e-54
Identity = 82/153 (53.59%), Postives = 117/153 (76.47%), Query Frame = 3
Query:   63 MTKITLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDK 521
            M K+T ELIE + Q TN ++DRELDL+G KI +IENLG TLDQFD++DF+DNEI + DGFP L+RL ++   NN+I +I + L+Q +P +T L+ TNN++ EL ++D L+  K L +L++L+NP+    +YRLYVI+K+PQVR+LDF +VK K
Sbjct:    1 MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLK 153          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Human
Match: SNRPA1 (small nuclear ribonucleoprotein polypeptide A' [Source:HGNC Symbol;Acc:HGNC:11152])

HSP 1 Score: 102.064 bits (253), Expect = 1.547e-25
Identity = 58/141 (41.13%), Postives = 87/141 (61.70%), Query Frame = 3
Query:  378 IDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKERKQAAQLFAGKTGEQLMK-IQRIPIYNGKSKSVEVGSDSNIQEQVDIDSSKQVIMRPSSADMYALRASIQNATTMEEVDRLNFILNSGKYAG 797
            +D L+  K L +L++L+NP+    +YRLYVI+K+PQVR+LDF +VK KER++A ++F GK G QL K I R      +SK+   G+       +  D  K     PS  D+ A++ +I NA+T+ EV+RL  +L SG+  G
Sbjct:    1 LDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIAR------RSKTFNPGAG------LPTDKKKGG---PSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPG 126          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Human
Match: CNTRL (centriolin [Source:HGNC Symbol;Acc:HGNC:1858])

HSP 1 Score: 60.8474 bits (146), Expect = 1.420e-9
Identity = 44/147 (29.93%), Postives = 76/147 (51.70%), Query Frame = 3
Query:  132 LDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKERKQAAQLFAGKTGEQL 572
            L+L  N I  IE L   L +   L+ + N+I + +G   +  L  +N   N+I  I   L + + ++  L    N I  L++I  L   +DL  L L++NP+VTLP+Y  + I  L  +  L+   V  ++R++A + F+ +  E+L
Sbjct:  130 LNLSYNLIGKIEKLDKLL-KLRELNLSYNKISKIEGIENMCNLQKLNLAGNEIEHIPVWLGKKLKSLRVLNLKGNKISSLQDISKLKPLQDLISLILVENPVVTLPHYLQFTIFHLRSLESLEGQPVTTQDRQEAFERFSLEEVERL 275          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Celegans
Match: mog-2 (Probable U2 small nuclear ribonucleoprotein A' [Source:UniProtKB/Swiss-Prot;Acc:Q9BLB6])

HSP 1 Score: 170.244 bits (430), Expect = 1.642e-50
Identity = 95/242 (39.26%), Postives = 144/242 (59.50%), Query Frame = 3
Query:   63 MTKITLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKERKQAAQLFAGKTGEQLMKIQRIPIYNGKSKSVEVGSDSNIQEQVDIDSSKQVIMRPSSADMYALRASIQNATTMEEVDRLNFILNSGK 788
            M ++T EL     Q  N +  RE++L+G KI +IEN+G T DQFD +D TDN+I + D FP   RL ++   NN+I  I+ D+   +PN+ TL  TNNNI EL +I+ L+  K LE++  + NPI    NYR+Y+I+KLP VR++DF+RV+  ER+ A ++F GK+G++          +   KSV     S I+     ++S     R +  D   ++ +I+NA ++ EV+ L  IL SGK
Sbjct:    1 MVRLTTELFAERPQFVNSVNMREINLRGQKIPVIENMGVTRDQFDVIDLTDNDIRKLDNFPTFSRLNTLYLHNNRINYIAPDIATKLPNLKTLALTNNNICELGDIEPLAECKKLEYVTFIGNPITHKDNYRMYMIYKLPTVRVIDFNRVRLTEREAAKKMFKGKSGKKAR--------DAIQKSVHTEDPSEIEPN---ENSSGGGARLTDEDREKIKEAIKNAKSLSEVNYLQSILASGK 231          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Celegans
Match: mog-2 (Probable U2 small nuclear ribonucleoprotein A' [Source:UniProtKB/Swiss-Prot;Acc:Q9BLB6])

HSP 1 Score: 170.244 bits (430), Expect = 1.642e-50
Identity = 95/242 (39.26%), Postives = 144/242 (59.50%), Query Frame = 3
Query:   63 MTKITLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKERKQAAQLFAGKTGEQLMKIQRIPIYNGKSKSVEVGSDSNIQEQVDIDSSKQVIMRPSSADMYALRASIQNATTMEEVDRLNFILNSGK 788
            M ++T EL     Q  N +  RE++L+G KI +IEN+G T DQFD +D TDN+I + D FP   RL ++   NN+I  I+ D+   +PN+ TL  TNNNI EL +I+ L+  K LE++  + NPI    NYR+Y+I+KLP VR++DF+RV+  ER+ A ++F GK+G++          +   KSV     S I+     ++S     R +  D   ++ +I+NA ++ EV+ L  IL SGK
Sbjct:    1 MVRLTTELFAERPQFVNSVNMREINLRGQKIPVIENMGVTRDQFDVIDLTDNDIRKLDNFPTFSRLNTLYLHNNRINYIAPDIATKLPNLKTLALTNNNICELGDIEPLAECKKLEYVTFIGNPITHKDNYRMYMIYKLPTVRVIDFNRVRLTEREAAKKMFKGKSGKKAR--------DAIQKSVHTEDPSEIEPN---ENSSGGGARLTDEDREKIKEAIKNAKSLSEVNYLQSILASGK 231          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Fly
Match: U2A (gene:FBgn0033210 transcript:FBtr0088941)

HSP 1 Score: 192.2 bits (487), Expect = 1.066e-58
Identity = 102/254 (40.16%), Postives = 154/254 (60.63%), Query Frame = 3
Query:   63 MTKITLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKERKQAAQLFAGKTGEQLMK-IQR-----------IPIYNGKSKSVEVGSDSNIQEQVDIDSSKQVIMRPSSADMYALRASIQNATTMEEVDRLNFILNSGK 788
            M K+T ELI  S+Q  NP ++RELDL+G KI  IENLG TLDQFD++D +DN++ + D  P+L RL  +   NN+I++IS+ L + +PN+ +++ T NN+QEL +++ L  F  LE + LL NP+ T PNYR Y+ +K PQ+R+LDF ++K K+R+ A + F  K G+ ++K I R               NGK +  E G  +N Q                  DM  +R +I+ A+++ EV+RL+ IL SG+
Sbjct:    1 MVKLTPELINQSMQYINPCRERELDLRGYKIPQIENLGATLDQFDTIDLSDNDLRKLDNLPHLPRLKCLLLNNNRILRISEGLEEAVPNLGSIILTGNNLQELSDLEPLVGFTKLETICLLINPVSTKPNYREYMAYKFPQLRLLDFRKIKQKDRQAAQEFFRTKQGKDVLKEISRKSKMSAAAAIAAEAGNGKGRGSEGGRLANPQ------------------DMQRIREAIKRASSLAEVERLSQILQSGQ 236          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Fly
Match: Cep97 (gene:FBgn0031575 transcript:FBtr0077504)

HSP 1 Score: 61.6178 bits (148), Expect = 5.177e-10
Identity = 44/156 (28.21%), Postives = 78/156 (50.00%), Query Frame = 3
Query:  126 RELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIP-NITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPN------YRLYVIHKLPQVRILDFSRVKDKERKQAAQLFAGKTGEQL 572
            R L+L+GN I  IE+L T ++  + L+  DN I       YL+ L  +    N++  + +  ++ +P ++ TL    N+I +L EI  LS   +L  +++  NP VT+ N      YR +V++    ++ +D   V   E  +A  L++   G Q 
Sbjct:   99 RVLNLEGNNIKTIEHLNTNVN-LECLNLADNSIGSISDMSYLRNLKELYLHGNRLTHL-RQCDKCLPTSLETLTLAKNSINDLNEICTLSHLSNLLSISIADNPCVTMINSLDGFDYRPFVLNWCMSLKYIDGFVVDPIESLKAEWLYSQGRGRQF 252          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Fly
Match: tilB (gene:FBgn0014395 transcript:FBtr0077345)

HSP 1 Score: 57.7658 bits (138), Expect = 6.683e-9
Identity = 48/160 (30.00%), Postives = 73/160 (45.62%), Query Frame = 3
Query:   63 MTKITLELIENSIQRTNPLKD--RELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKERKQA 536
            M  IT EL+    +    L     E+ L    I +IE++         L    N I R +    LKRL  +N   N I ++     +   +++ L  T N I+EL  +++L    +L  L L+ NP V  P+YR YV+  LPQ+  LD   +   ER +A
Sbjct:    1 MVLITEELVRKKSEHNERLISTLEEISLHQEDIEVIEHIQNWCRDLKILLLQSNLIARLENLHKLKRLEYLNVAINNIERVEN--LEGCESLSKLDLTLNFIRELTSVESLCGNYNLRELVLIGNPCVDYPHYRDYVVATLPQLNSLDCVEITPSERLRA 158          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Fly
Match: TbCMF46 (gene:FBgn0032163 transcript:FBtr0079898)

HSP 1 Score: 51.9878 bits (123), Expect = 6.617e-7
Identity = 44/141 (31.21%), Postives = 69/141 (48.94%), Query Frame = 3
Query:  132 LDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNY--RLYVIHKLPQVRILDFSRVKDKERKQAAQLF 548
            L L  NKI +IE+L   L     L+ + N I R +    L +L  ++  +N+I KI       + N+  L   NN I  +  I+ L     L+ L L  NPI   P++   LYVI  LPQ+   ++  +K + R++A + F
Sbjct:   94 LCLNCNKIEVIEHL-EMLTALKDLNLSFNYITRIENLEKLVKLEKLSLFSNRIRKIEN--IHTLQNLVILSIGNNLIDTVEGIERLRFVSSLKVLNLEGNPIAKQPDFPLSLYVIAILPQLNYYEYVFIKTETREEAQKRF 231          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Fly
Match: CG14185 (gene:FBgn0036936 transcript:FBtr0074818)

HSP 1 Score: 51.6026 bits (122), Expect = 6.677e-7
Identity = 38/131 (29.01%), Postives = 65/131 (49.62%), Query Frame = 3
Query:  132 LDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKE 524
            LDL G+ ++ + +LG  L Q   LD ++  ++ FDG   L  +  +    N I ++   L + + ++  L   NN I EL  +  L     L+ + L  NP+  LP YR  +   +P +++LD  RV + E
Sbjct:  149 LDLSGSVLSSLRDLGYGLLQLTRLDISNCGLNSFDGTSGLPAIRVLIADGNMIQRVDP-LAELV-HLRVLKARNNRISELGLLSFLGMCPQLQEVELQGNPVCRLPLYRSLLARSVPTLQLLD-GRVLNGE 276          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Zebrafish
Match: snrpa1 (small nuclear ribonucleoprotein polypeptide A' [Source:ZFIN;Acc:ZDB-GENE-041114-82])

HSP 1 Score: 213.386 bits (542), Expect = 1.352e-66
Identity = 111/246 (45.12%), Postives = 169/246 (68.70%), Query Frame = 3
Query:   63 MTKITLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKERKQAAQLFAGKTGEQLMK-IQRIPIYNGKSKSVEVGSDSNIQEQVDIDSSKQVIMRPSSADMYALRASIQNATTMEEVDRLNFILNSGKYAG 797
            M K+T ELIE + Q TNP++DRELDL+G KI ++ENLG TLDQFD++D +DNE+ + DGFP LKRL ++   NN+I +I ++L Q +P++  L+ T+NNIQEL ++D L+  K L  L+LL+NP+    +YRLYVI+K+PQ+R+LDF +VK KER++A ++F GK G QL K I +      +SK+   G+    +++            PS+A++ A++ +I NAT++ EV+RL  +L +G+  G
Sbjct:    1 MVKLTAELIEQAAQYTNPVRDRELDLRGYKIPVLENLGATLDQFDTIDLSDNEVRKLDGFPLLKRLKTLLVNNNRICRIGENLEQALPDLKELILTSNNIQELGDLDPLATVKSLSLLSLLRNPVTNKKHYRLYVINKIPQIRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIAK------QSKTFTPGAGLQTEKKTG----------PSAAEVEAIKNAIANATSLAEVERLKGLLQAGQIPG 230          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Zebrafish
Match: snrpa1 (small nuclear ribonucleoprotein polypeptide A' [Source:ZFIN;Acc:ZDB-GENE-041114-82])

HSP 1 Score: 168.703 bits (426), Expect = 8.837e-51
Identity = 82/153 (53.59%), Postives = 117/153 (76.47%), Query Frame = 3
Query:   63 MTKITLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDK 521
            M K+T ELIE + Q TNP++DRELDL+G KI ++ENLG TLDQFD++D +DNE+ + DGFP LKRL ++   NN+I +I ++L Q +P++  L+ T+NNIQEL ++D L+  K L  L+LL+NP+    +YRLYVI+K+PQ+R+LDF +VK K
Sbjct:    1 MVKLTAELIEQAAQYTNPVRDRELDLRGYKIPVLENLGATLDQFDTIDLSDNEVRKLDGFPLLKRLKTLLVNNNRICRIGENLEQALPDLKELILTSNNIQELGDLDPLATVKSLSLLSLLRNPVTNKKHYRLYVINKIPQIRVLDFQKVKLK 153          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Zebrafish
Match: lrrc51 (leucine rich repeat containing 51 [Source:ZFIN;Acc:ZDB-GENE-060929-962])

HSP 1 Score: 65.4698 bits (158), Expect = 3.767e-12
Identity = 36/92 (39.13%), Postives = 54/92 (58.70%), Query Frame = 3
Query:  255 RLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKERK 530
            RLA ++ + N+I  I   L Q +  +  L    NNIQEL E+D L+    L  + L  NPIV+  +YR ++I  LP V+++DFS V  +ER+
Sbjct:   70 RLAWLDLSFNEIKHIDSVLTQ-LKELRLLYLHGNNIQELSEVDKLAVLPSLHTITLHGNPIVSERDYRAHLIATLPHVKMIDFSAVTKQERE 160          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Zebrafish
Match: cep72 (centrosomal protein 72 [Source:NCBI gene;Acc:553488])

HSP 1 Score: 62.7734 bits (151), Expect = 2.581e-10
Identity = 44/148 (29.73%), Postives = 72/148 (48.65%), Query Frame = 3
Query:  126 RELDLKGNKIALIENLGTTLDQF---DSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVT-LPNYRLYVIHKLPQVRILDFSRVKDKERKQAAQLFAGK 557
            R L L G     I +LGT+L  F    SLD + N +    G  +L+ L  +N   N++  +              +F+ + +Q L+++D            L  NP+V   P+YRLY++H +P++R LD   V+D+ERK A   F+ +
Sbjct:   28 RSLTLPGTYEGKICHLGTSLKNFVRLKSLDLSYNALVTVQGIEHLELLERLNLYYNRLASLQD------------IFSLHKLQNLKQLD------------LRLNPVVKKHPHYRLYLVHAIPKLRRLDDCPVRDRERKAALMHFSSE 151          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Zebrafish
Match: lrrc23 (leucine rich repeat containing 23 [Source:ZFIN;Acc:ZDB-GENE-041010-153])

HSP 1 Score: 53.5286 bits (127), Expect = 1.546e-7
Identity = 47/161 (29.19%), Postives = 75/161 (46.58%), Query Frame = 3
Query:   75 TLELIENSIQRTNPLKDREL------DLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNL-SCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKERKQA 536
            TL L  N IQ    L    L      +L+GN +   +  G  L     L    N I + +G   L+RL +++  +N++  +   L+  +  +  L    N I  +R +  L S  + L+ L LL NPI    +YRLYVI +LP +  +D   V  +E+ +A
Sbjct:  153 TLNLTGNGIQTMQGLDHPNLTNLVTLELRGNCLETTD--GIYLPNLRHLYLAQNNIKKLEGLEKLERLITLHLRHNQLETLDG-LSASMKCLEYLNVRGNLISSMRALQTLASVGQTLKALVLLDNPIAKTDDYRLYVISQLPHLERVDKDPVTPEEKFEA 310          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Xenopus
Match: SNRPA1 (small nuclear ribonucleoprotein polypeptide A' [Source:NCBI gene;Acc:100486145])

HSP 1 Score: 214.157 bits (544), Expect = 4.132e-67
Identity = 114/246 (46.34%), Postives = 166/246 (67.48%), Query Frame = 3
Query:   63 MTKITLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKERKQAAQLFAGKTGEQLMK-IQRIPIYNGKSKSVEVGSDSNIQEQVDIDSSKQVIMRPSSADMYALRASIQNATTMEEVDRLNFILNSGKYAG 797
            M K+T +LIE + Q TN ++DRELDL+G KI +IENLG TLDQFD++D +DNEI + DGFP LKRL ++   NN+I +I + +   +PN+T L+ TNN+I EL ++DNLS  K L +++LL+NP+    +YR+YVI+K+PQVR+LDF +VK  ER++AA +F GK G QL K I +      +SK+   G+    +++            PS  D+ A++ +I NATT+ EV+RLN +L SG+  G
Sbjct:    1 MVKLTADLIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDTIDCSDNEIRKLDGFPLLKRLKTLLLNNNRICRIGEGIEHALPNLTELILTNNSITELGDLDNLSPCKHLTYISLLRNPVTNKRHYRMYVIYKIPQVRVLDFEKVKQSEREEAANMFKGKRGAQLAKDIAK------RSKTFVPGAGLPTEKKK---------AGPSPGDVEAIKNAIANATTLAEVERLNGLLQSGQIPG 231          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Xenopus
Match: SNRPA1 (small nuclear ribonucleoprotein polypeptide A' [Source:NCBI gene;Acc:100486145])

HSP 1 Score: 183.726 bits (465), Expect = 1.266e-55
Identity = 99/219 (45.21%), Postives = 145/219 (66.21%), Query Frame = 3
Query:  144 GNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKERKQAAQLFAGKTGEQLMK-IQRIPIYNGKSKSVEVGSDSNIQEQVDIDSSKQVIMRPSSADMYALRASIQNATTMEEVDRLNFILNSGKYAG 797
            G KI +IENLG TLDQFD++D +DNEI + DGFP LKRL ++   NN+I +I + +   +PN+T L+ TNN+I EL ++DNLS  K L +++LL+NP+    +YR+YVI+K+PQVR+LDF +VK  ER++AA +F GK G QL K I +      +SK+   G+    +++            PS  D+ A++ +I NATT+ EV+RLN +L SG+  G
Sbjct:    5 GYKIPVIENLGATLDQFDTIDCSDNEIRKLDGFPLLKRLKTLLLNNNRICRIGEGIEHALPNLTELILTNNSITELGDLDNLSPCKHLTYISLLRNPVTNKRHYRMYVIYKIPQVRVLDFEKVKQSEREEAANMFKGKRGAQLAKDIAK------RSKTFVPGAGLPTEKKK---------AGPSPGDVEAIKNAIANATTLAEVERLNGLLQSGQIPG 208          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Xenopus
Match: CNTRL (centriolin [Source:NCBI gene;Acc:100270771])

HSP 1 Score: 72.0182 bits (175), Expect = 6.705e-13
Identity = 43/139 (30.94%), Postives = 73/139 (52.52%), Query Frame = 3
Query:  132 LDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKERKQAAQLF 548
            L+L  N I  IE L   + +   L+   N+I + + F +++ L  +N   N+I  I   + + + ++T L    N I  L+++  L   KDL  L+L  NP+  LP+YRLY +  L  +  LD   V ++ER++A + F
Sbjct:   88 LNLSHNLIEKIEKLEKQI-RLRELNLAYNKISKIEHFEHMQNLKKLNLAGNEIEHIPVWVGKKLKSLTALNLKENRISSLQDVSRLKPLKDLTTLSLSDNPVSNLPHYRLYTVFHLRSLNSLDAQPVTNQERQEAHERF 225          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Xenopus
Match: CNTRL (centriolin [Source:NCBI gene;Acc:100270771])

HSP 1 Score: 72.0182 bits (175), Expect = 6.801e-13
Identity = 43/139 (30.94%), Postives = 73/139 (52.52%), Query Frame = 3
Query:  132 LDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKERKQAAQLF 548
            L+L  N I  IE L   + +   L+   N+I + + F +++ L  +N   N+I  I   + + + ++T L    N I  L+++  L   KDL  L+L  NP+  LP+YRLY +  L  +  LD   V ++ER++A + F
Sbjct:   61 LNLSHNLIEKIEKLEKQI-RLRELNLAYNKISKIEHFEHMQNLKKLNLAGNEIEHIPVWVGKKLKSLTALNLKENRISSLQDVSRLKPLKDLTTLSLSDNPVSNLPHYRLYTVFHLRSLNSLDAQPVTNQERQEAHERF 198          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Xenopus
Match: CNTRL (centriolin [Source:NCBI gene;Acc:100270771])

HSP 1 Score: 72.0182 bits (175), Expect = 6.979e-13
Identity = 43/139 (30.94%), Postives = 73/139 (52.52%), Query Frame = 3
Query:  132 LDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKERKQAAQLF 548
            L+L  N I  IE L   + +   L+   N+I + + F +++ L  +N   N+I  I   + + + ++T L    N I  L+++  L   KDL  L+L  NP+  LP+YRLY +  L  +  LD   V ++ER++A + F
Sbjct:   99 LNLSHNLIEKIEKLEKQI-RLRELNLAYNKISKIEHFEHMQNLKKLNLAGNEIEHIPVWVGKKLKSLTALNLKENRISSLQDVSRLKPLKDLTTLSLSDNPVSNLPHYRLYTVFHLRSLNSLDAQPVTNQERQEAHERF 236          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Mouse
Match: Snrpa1 (small nuclear ribonucleoprotein polypeptide A' [Source:MGI Symbol;Acc:MGI:1916231])

HSP 1 Score: 223.402 bits (568), Expect = 7.960e-71
Identity = 115/246 (46.75%), Postives = 168/246 (68.29%), Query Frame = 3
Query:   63 MTKITLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKERKQAAQLFAGKTGEQLMK-IQRIPIYNGKSKSVEVGSDSNIQEQVDIDSSKQVIMRPSSADMYALRASIQNATTMEEVDRLNFILNSGKYAG 797
            M K+T ELIE + Q TN ++DRELDL+G KI +IENLG TLDQFD++DF+DNEI + DGFP L+RL ++   NN+I +I + L+Q +P +T L+ TNN++ EL ++D L+  K L +L++L+NP+    +YRLYVI+K+PQVR+LDF +VK KER++A ++F GK G QL K I R      +SK+   G+       +  D  K     PS+ D+ A++ +I NA+T+ EV+RL  +L SG+  G
Sbjct:    1 MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIAR------RSKTFNPGAG------LPTDKKKG---GPSAGDVEAIKNAIANASTLAEVERLKGLLQSGQIPG 231          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Mouse
Match: Snrpa1 (small nuclear ribonucleoprotein polypeptide A' [Source:MGI Symbol;Acc:MGI:1916231])

HSP 1 Score: 177.178 bits (448), Expect = 3.123e-54
Identity = 82/153 (53.59%), Postives = 117/153 (76.47%), Query Frame = 3
Query:   63 MTKITLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDK 521
            M K+T ELIE + Q TN ++DRELDL+G KI +IENLG TLDQFD++DF+DNEI + DGFP L+RL ++   NN+I +I + L+Q +P +T L+ TNN++ EL ++D L+  K L +L++L+NP+    +YRLYVI+K+PQVR+LDF +VK K
Sbjct:    1 MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLK 153          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Mouse
Match: Gm45213 (predicted gene 45213 [Source:MGI Symbol;Acc:MGI:5753789])

HSP 1 Score: 68.9366 bits (167), Expect = 3.351e-14
Identity = 30/49 (61.22%), Postives = 39/49 (79.59%), Query Frame = 3
Query:  144 GNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKI 290
            G KI +IENLG TLDQFD++DF+DNEI + DGFP L+RL ++   NN+I
Sbjct:   53 GYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRI 101          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Mouse
Match: Lrguk (leucine-rich repeats and guanylate kinase domain containing [Source:MGI Symbol;Acc:MGI:1921604])

HSP 1 Score: 61.6178 bits (148), Expect = 9.646e-10
Identity = 48/147 (32.65%), Postives = 75/147 (51.02%), Query Frame = 3
Query:   87 IENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKER 527
            +EN I  T+      L L GNKI  I+ LGT       L  ++N I    G   LK L +++ ++N+I  +    N  +  +  L   +N I+EL EI+ +     L  L LL+NPI T P Y  +VI+ L ++  LD  ++K +E+
Sbjct:  233 LENCISLTH------LSLAGNKITTIKGLGTL--PIKVLSLSNNMIETITGLEELKALQNLDLSHNQISSLQGLENHDLLEVINL--EDNKIKELSEIEYIENLPILRVLNLLRNPIQTKPEYWFFVIYMLLRLTELDQQKIKVEEK 369          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Mouse
Match: Lrguk (leucine-rich repeats and guanylate kinase domain containing [Source:MGI Symbol;Acc:MGI:1921604])

HSP 1 Score: 60.077 bits (144), Expect = 2.762e-9
Identity = 47/147 (31.97%), Postives = 75/147 (51.02%), Query Frame = 3
Query:   87 IENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKER 527
            +EN I  T+      L L GNKI  I+ LGT       L  ++N I    G   LK L +++ ++N+I  +    N  +  +  +   +N I+EL EI+ +     L  L LL+NPI T P Y  +VI+ L ++  LD  ++K +E+
Sbjct:  233 LENCISLTH------LSLAGNKITTIKGLGTL--PIKVLSLSNNMIETITGLEELKALQNLDLSHNQISSLQGLENHDL--LEVINLEDNKIKELSEIEYIENLPILRVLNLLRNPIQTKPEYWFFVIYMLLRLTELDQQKIKVEEK 369          
BLAST of U2 small nuclear ribonucleoprotein A' vs. UniProt/SwissProt
Match: sp|P57784|RU2A_MOUSE (U2 small nuclear ribonucleoprotein A' OS=Mus musculus OX=10090 GN=Snrpa1 PE=1 SV=2)

HSP 1 Score: 223.402 bits (568), Expect = 5.568e-70
Identity = 115/246 (46.75%), Postives = 168/246 (68.29%), Query Frame = 3
Query:   63 MTKITLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKERKQAAQLFAGKTGEQLMK-IQRIPIYNGKSKSVEVGSDSNIQEQVDIDSSKQVIMRPSSADMYALRASIQNATTMEEVDRLNFILNSGKYAG 797
            M K+T ELIE + Q TN ++DRELDL+G KI +IENLG TLDQFD++DF+DNEI + DGFP L+RL ++   NN+I +I + L+Q +P +T L+ TNN++ EL ++D L+  K L +L++L+NP+    +YRLYVI+K+PQVR+LDF +VK KER++A ++F GK G QL K I R      +SK+   G+       +  D  K     PS+ D+ A++ +I NA+T+ EV+RL  +L SG+  G
Sbjct:    1 MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIAR------RSKTFNPGAG------LPTDKKKG---GPSAGDVEAIKNAIANASTLAEVERLKGLLQSGQIPG 231          
BLAST of U2 small nuclear ribonucleoprotein A' vs. UniProt/SwissProt
Match: sp|Q4R8Y8|RU2A_MACFA (U2 small nuclear ribonucleoprotein A' OS=Macaca fascicularis OX=9541 GN=SNRPA1 PE=2 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 1.076e-69
Identity = 115/246 (46.75%), Postives = 167/246 (67.89%), Query Frame = 3
Query:   63 MTKITLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKERKQAAQLFAGKTGEQLMK-IQRIPIYNGKSKSVEVGSDSNIQEQVDIDSSKQVIMRPSSADMYALRASIQNATTMEEVDRLNFILNSGKYAG 797
            M K+T ELIE + Q TN ++DRELDL+G KI +IENLG TLDQFD++DF+DNEI + DGFP L+RL ++   NN+I +I + L+Q +P +T L+ TNN++ EL ++D L+  K L +L++L+NP+    +YRLYVI+K+PQVR+LDF +VK KER++A ++F GK G QL K I R      +SK+   G+       +  D  K     PS  D+ A++ +I NA+T+ EV+RL  +L SG+  G
Sbjct:    1 MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIAR------RSKTFNPGAG------LPTDKKKG---GPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPG 231          
BLAST of U2 small nuclear ribonucleoprotein A' vs. UniProt/SwissProt
Match: sp|P09661|RU2A_HUMAN (U2 small nuclear ribonucleoprotein A' OS=Homo sapiens OX=9606 GN=SNRPA1 PE=1 SV=2)

HSP 1 Score: 222.631 bits (566), Expect = 1.076e-69
Identity = 115/246 (46.75%), Postives = 167/246 (67.89%), Query Frame = 3
Query:   63 MTKITLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKERKQAAQLFAGKTGEQLMK-IQRIPIYNGKSKSVEVGSDSNIQEQVDIDSSKQVIMRPSSADMYALRASIQNATTMEEVDRLNFILNSGKYAG 797
            M K+T ELIE + Q TN ++DRELDL+G KI +IENLG TLDQFD++DF+DNEI + DGFP L+RL ++   NN+I +I + L+Q +P +T L+ TNN++ EL ++D L+  K L +L++L+NP+    +YRLYVI+K+PQVR+LDF +VK KER++A ++F GK G QL K I R      +SK+   G+       +  D  K     PS  D+ A++ +I NA+T+ EV+RL  +L SG+  G
Sbjct:    1 MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIAR------RSKTFNPGAG------LPTDKKKG---GPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPG 231          
BLAST of U2 small nuclear ribonucleoprotein A' vs. UniProt/SwissProt
Match: sp|Q9V4Q8|RU2A_DROME (Probable U2 small nuclear ribonucleoprotein A' OS=Drosophila melanogaster OX=7227 GN=U2A PE=1 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 1.069e-57
Identity = 102/254 (40.16%), Postives = 154/254 (60.63%), Query Frame = 3
Query:   63 MTKITLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKERKQAAQLFAGKTGEQLMK-IQR-----------IPIYNGKSKSVEVGSDSNIQEQVDIDSSKQVIMRPSSADMYALRASIQNATTMEEVDRLNFILNSGK 788
            M K+T ELI  S+Q  NP ++RELDL+G KI  IENLG TLDQFD++D +DN++ + D  P+L RL  +   NN+I++IS+ L + +PN+ +++ T NN+QEL +++ L  F  LE + LL NP+ T PNYR Y+ +K PQ+R+LDF ++K K+R+ A + F  K G+ ++K I R               NGK +  E G  +N Q                  DM  +R +I+ A+++ EV+RL+ IL SG+
Sbjct:    1 MVKLTPELINQSMQYINPCRERELDLRGYKIPQIENLGATLDQFDTIDLSDNDLRKLDNLPHLPRLKCLLLNNNRILRISEGLEEAVPNLGSIILTGNNLQELSDLEPLVGFTKLETICLLINPVSTKPNYREYMAYKFPQLRLLDFRKIKQKDRQAAQEFFRTKQGKDVLKEISRKSKMSAAAAIAAEAGNGKGRGSEGGRLANPQ------------------DMQRIREAIKRASSLAEVERLSQILQSGQ 236          
BLAST of U2 small nuclear ribonucleoprotein A' vs. UniProt/SwissProt
Match: sp|P43333|RU2A_ARATH (U2 small nuclear ribonucleoprotein A' OS=Arabidopsis thaliana OX=3702 GN=At1g09760 PE=2 SV=2)

HSP 1 Score: 188.734 bits (478), Expect = 1.307e-56
Identity = 105/247 (42.51%), Postives = 152/247 (61.54%), Query Frame = 3
Query:   63 MTKITLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKERKQAAQLFAGKTGEQLMKIQRIPIYNGKSKSVEVGSDSNIQEQVDIDSSKQVIMRPSSADMYALRASIQNATTMEEVDRLNFILNSGKY-AGF 800
            M K+T +LI  S    N +K+RELDL+GNKI +IENLG T DQFD++D +DNEI + + FPYL RL ++   NN+I +I+ +L +F+P + +LV TNN +  L EID L+    L++L+LL N I    NYRLYVIHKL  +R+LDF ++K KER +AA LF+ K  E+ +K         K    EV   S   E  +       ++ P++  + A++A+I N+ T+EE+ RL   L  G+  AG 
Sbjct:    1 MVKLTADLIWKSPHFFNAIKERELDLRGNKIPVIENLGATEDQFDTIDLSDNEIVKLENFPYLNRLGTLLINNNRITRINPNLGEFLPKLHSLVLTNNRLVNLVEIDPLASIPKLQYLSLLDNNITKKANYRLYVIHKLKSLRVLDFIKIKAKERAEAASLFSSKEAEEEVK---------KVSREEVKKVSETAENPETPK----VVAPTAEQILAIKAAIINSQTIEEIARLEQALKFGQVPAGL 234          
BLAST of U2 small nuclear ribonucleoprotein A' vs. TrEMBL
Match: A0A267G721 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023193g2 PE=4 SV=1)

HSP 1 Score: 235.728 bits (600), Expect = 4.725e-72
Identity = 121/248 (48.79%), Postives = 169/248 (68.15%), Query Frame = 3
Query:   69 KITLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKERKQAAQLF-AGKTGEQLMKIQRIPIYNGKSKSVEVGSDSNIQEQVDIDSSKQVIMR--PSSADMYALRASIQNATTMEEVDRLNFILNSGKYAGFA 803
            K+T ELI+NS+Q TNPL DRELDL+G K+AL+ENL  TLDQFD++D TDNEI + DGFP+L RLA++   NNK+++I   L+  +P ++TL+ TNN +QEL +++ L+  K L FL+LLKNP+ +  NYRL+V+HKLP +R LDF R+ D ER+QAA LF +G  G+    +      N KSK  +  +           +S  V     P+SAD+ A+R +I+ A T++EVDRLN +L +G YAGFA
Sbjct:   14 KLTPELIQNSVQTTNPLGDRELDLRGYKVALLENLSATLDQFDTIDLTDNEIRKLDGFPHLPRLANLMLNNNKVMRIGDGLSSSLPRLSTLLLTNNCLQELADLEPLTALKRLRFLSLLKNPVCSRRNYRLHVVHKLPSLRFLDFRRITDAERRQAAALFTSGGVGD----VADKSAANLKSKPAKTFTPGAPVPAAAAAASAPVSAAGGPTSADLLAVREAIRRANTLDEVDRLNRLLTTGNYAGFA 257          
BLAST of U2 small nuclear ribonucleoprotein A' vs. TrEMBL
Match: H0ZF70 (LRRcap domain-containing protein OS=Taeniopygia guttata OX=59729 GN=SNRPA1 PE=4 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 1.783e-71
Identity = 119/251 (47.41%), Postives = 170/251 (67.73%), Query Frame = 3
Query:   63 MTKITLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKERKQAAQLFAGKTGEQLMK-IQRIPIYNGKSKSVEVGSDSNIQEQVDIDSSKQVIMRPSSADMYALRASIQNATTMEEVDRLNFILNSGKYAGFASAP 812
            M K+T ELIE + Q TN ++DRELDL+G KI +IENLG TLDQFD++DF+DNEI + DGFP L+RL ++   NN+I +I ++L Q +P++T L+ TNNNI EL E+D LS  K L +L++L+NP+    +YRLY+IHK+PQVR+LDF +VK KER++A ++F GK G QL K I R      ++K+   G+       +  D  K     PS  D+ A++A+I NA+T+ EV+RL  +L +G+  G    P
Sbjct:    1 MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLMNNNRICRIGENLEQALPSLTELILTNNNIAELGELDPLSSIKSLTYLSVLRNPVTNKKHYRLYLIHKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIAR------RAKTFNPGAG------LPTDKKK---TGPSPGDVEAIKAAIANASTLAEVERLKGLLQAGQIPGRERKP 236          
BLAST of U2 small nuclear ribonucleoprotein A' vs. TrEMBL
Match: A0A218V0C2 (U2 small nuclear ribonucleoprotein A OS=Lonchura striata domestica OX=299123 GN=SNRPA1 PE=4 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 1.783e-71
Identity = 119/251 (47.41%), Postives = 170/251 (67.73%), Query Frame = 3
Query:   63 MTKITLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKERKQAAQLFAGKTGEQLMK-IQRIPIYNGKSKSVEVGSDSNIQEQVDIDSSKQVIMRPSSADMYALRASIQNATTMEEVDRLNFILNSGKYAGFASAP 812
            M K+T ELIE + Q TN ++DRELDL+G KI +IENLG TLDQFD++DF+DNEI + DGFP L+RL ++   NN+I +I ++L Q +P++T L+ TNNNI EL E+D LS  K L +L++L+NP+    +YRLY+IHK+PQVR+LDF +VK KER++A ++F GK G QL K I R      ++K+   G+       +  D  K     PS  D+ A++A+I NA+T+ EV+RL  +L +G+  G    P
Sbjct:    1 MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLMNNNRICRIGENLEQALPSLTELILTNNNIAELGELDPLSSIKSLTYLSVLRNPVTNKKHYRLYLIHKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIAR------RAKTFNPGAG------LPTDKKK---TGPSPGDVEAIKAAIANASTLAEVERLKGLLQAGQIPGRERKP 236          
BLAST of U2 small nuclear ribonucleoprotein A' vs. TrEMBL
Match: A0A093GJG3 (U2 small nuclear ribonucleoprotein A OS=Dryobates pubescens OX=118200 GN=N307_12602 PE=4 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 1.924e-71
Identity = 119/246 (48.37%), Postives = 168/246 (68.29%), Query Frame = 3
Query:   63 MTKITLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKERKQAAQLFAGKTGEQLMK-IQRIPIYNGKSKSVEVGSDSNIQEQVDIDSSKQVIMRPSSADMYALRASIQNATTMEEVDRLNFILNSGKYAG 797
            M K+T ELIE + Q TN ++DRELDL+G KI +IENLG TLDQFD++DF+DNEI + DGFP L+RL ++   NN+I +I ++L Q +P++T L+ TNNNI EL E+D LS  K L +L++L+NP+    +YRLYVIHK+PQVR+LDF +VK KER++A ++F GK G QL K I R      ++K+   G+       +  D  K     PS  D+ A++ +I NATT+ EV+RL  +L +G+  G
Sbjct:    1 MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLMNNNRICRIGENLEQALPSLTELILTNNNIAELGELDPLSTIKSLTYLSILRNPVTNKKHYRLYVIHKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIAR------RTKTFTPGAG------LPTDKKK---TGPSPGDVEAIKTAIANATTLAEVERLKGLLQAGQIPG 231          
BLAST of U2 small nuclear ribonucleoprotein A' vs. TrEMBL
Match: A0A267G754 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023193g4 PE=4 SV=1)

HSP 1 Score: 233.802 bits (595), Expect = 1.928e-71
Identity = 120/248 (48.39%), Postives = 169/248 (68.15%), Query Frame = 3
Query:   69 KITLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKERKQAAQLF-AGKTGEQLMKIQRIPIYNGKSKSVEVGSDSNIQEQVDIDSSKQVIMR--PSSADMYALRASIQNATTMEEVDRLNFILNSGKYAGFA 803
            K+T ELI+NS+Q TNPL DRELDL+G K+AL+ENL  TLDQFD++D TDNEI + DGFP+L RLA++   NNK+++I   L+  +P ++TL+ TNN +QEL +++ L+  K L FL+LLKNP+ +  NYRL+V+HKLP +R LDF R+ D ER+QAA LF +G  G+    +      + KSK  +  +           +S  V     P+SAD+ A+R +I+ A T++EVDRLN +L +G YAGFA
Sbjct:   13 KLTPELIQNSVQTTNPLGDRELDLRGYKVALLENLSATLDQFDTIDLTDNEIRKLDGFPHLPRLANLMLNNNKVMRIGDGLSSSLPRLSTLLLTNNCLQELADLEPLTALKRLRFLSLLKNPVCSRRNYRLHVVHKLPSLRFLDFRRITDAERRQAAALFTSGGVGD----VADKSAASLKSKPAKTFTPGAPVPAAAAAASAPVSAAGGPTSADLLAVREAIRRANTLDEVDRLNRLLTTGNYAGFA 256          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Cavefish
Match: snrpa1 (small nuclear ribonucleoprotein polypeptide A' [Source:ZFIN;Acc:ZDB-GENE-041114-82])

HSP 1 Score: 128.257 bits (321), Expect = 1.271e-34
Identity = 70/169 (41.42%), Postives = 108/169 (63.91%), Query Frame = 3
Query:  294 KISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKERKQAAQLFAGKTGEQLMK-IQRIPIYNGKSKSVEVGSDSNIQEQVDIDSSKQVIMRPSSADMYALRASIQNATTMEEVDRLNFILNSGKYAG 797
            ++ ++L Q +PN+  LV T+NNIQEL ++D L+  K L  L+LL+NP+    +YRLYVI+KLPQ+R+LDF +VK KER++A  +F GK G QL K I +      ++K+   G+       +  D  K     PS+AD+ A++ +I NAT++ EV+RL  +L +G+  G
Sbjct:   19 RVGENLEQSLPNLKELVLTSNNIQELGDLDPLASVKTLTLLSLLRNPVTNKKHYRLYVINKLPQIRVLDFQKVKLKERQEAETMFKGKRGAQLAKDIAK------RTKTFTPGAG------IQADRKK---TGPSAADVEAIKNAIANATSLAEVERLKGLLQAGQIPG 172          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Cavefish
Match: snrpa1 (small nuclear ribonucleoprotein polypeptide A' [Source:ZFIN;Acc:ZDB-GENE-041114-82])

HSP 1 Score: 102.834 bits (255), Expect = 9.734e-27
Identity = 46/76 (60.53%), Postives = 61/76 (80.26%), Query Frame = 3
Query:   63 MTKITLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKI 290
            M K++ ELIE + Q TNP++DRELDL+G KI ++ENLG TLDQFD++DF+DNEI + DGFP LKRL ++   NN+I
Sbjct:    1 MVKLSAELIEQAAQYTNPVRDRELDLRGYKIPVLENLGATLDQFDTIDFSDNEIRKLDGFPLLKRLKTVLMNNNRI 76          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Cavefish
Match: drc3 (dynein regulatory complex subunit 3 [Source:ZFIN;Acc:ZDB-GENE-061103-349])

HSP 1 Score: 57.3806 bits (137), Expect = 1.034e-8
Identity = 42/135 (31.11%), Postives = 69/135 (51.11%), Query Frame = 3
Query:  132 LDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKERKQA 536
            L L  N I  I+ L   L     LD + N+I   +G   L +L +++ +NN+I  I K     + ++  L    N I ++  +  L  FK+L  L L +NPI    NY+++V+  LP +  LDF  V ++ R++A
Sbjct:   70 LQLNNNSIEKIQGL-EKLTNLLWLDLSFNKIKMIEGLEALVKLQTLSLSNNQIPAIEK--MDTLEHLEILSLGENVISQIDNVIYLRRFKNLRSLNLARNPICQETNYKIFVVAYLPDLVYLDFRLVDEQTRERA 201          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Cavefish
Match: LRRC9 (leucine-rich repeat-containing protein 9-like [Source:NCBI gene;Acc:103026999])

HSP 1 Score: 55.8398 bits (133), Expect = 5.588e-8
Identity = 44/167 (26.35%), Postives = 71/167 (42.51%), Query Frame = 3
Query:  126 RELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNIT----------------------TLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIV-TLPNYRLYVIHKLPQVRILDFSRVKDKERKQAAQLFAGK 557
            R      N+++ IE L       + L    N I   DG   L+RL  ++  +N++  +   +   +PN+                        L   NNNI   R+I +L     L  L L  NP+V  L +YR+YV+  LP ++ LD + V+  E + A  +F G+
Sbjct:  912 RWASFNNNELSHIEGL-EHCPLLEELSLNHNNISSLDGVCKLQRLTRLSVNSNQLQCLDGSVLDHLPNLHFLSAERNLIPSLHGVQRSRSLFELYVGNNNISTSRDIYHLKVLTSLIILDLYGNPLVEKLESYRIYVVFHLPSLKALDGTAVEVTECENAKDVFGGR 1077          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Cavefish
Match: LRRC9 (leucine-rich repeat-containing protein 9-like [Source:NCBI gene;Acc:103026999])

HSP 1 Score: 55.8398 bits (133), Expect = 5.904e-8
Identity = 44/167 (26.35%), Postives = 71/167 (42.51%), Query Frame = 3
Query:  126 RELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNIT----------------------TLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIV-TLPNYRLYVIHKLPQVRILDFSRVKDKERKQAAQLFAGK 557
            R      N+++ IE L       + L    N I   DG   L+RL  ++  +N++  +   +   +PN+                        L   NNNI   R+I +L     L  L L  NP+V  L +YR+YV+  LP ++ LD + V+  E + A  +F G+
Sbjct:  912 RWASFNNNELSHIEGL-EHCPLLEELSLNHNNISSLDGVCKLQRLTRLSVNSNQLQCLDGSVLDHLPNLHFLSAERNLIPSLHGVQRSRSLFELYVGNNNISTSRDIYHLKVLTSLIILDLYGNPLVEKLESYRIYVVFHLPSLKALDGTAVEVTECENAKDVFGGR 1077          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Sea Lamprey
Match: cep97 (centrosomal protein 97 [Source:ZFIN;Acc:ZDB-GENE-031030-11])

HSP 1 Score: 71.633 bits (174), Expect = 6.562e-14
Identity = 53/173 (30.64%), Postives = 81/173 (46.82%), Query Frame = 3
Query:   78 LELIENSIQRTNPLKD----RELDLKGNKIALIENL-GTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNP-IVTLPN-----YRLYVIHKLPQVRILDFSRVKDKERKQAAQLFAGKTG 563
            L L  NSI     LKD    + L+L GN I  IE+L G T      +D +DN I        L  L ++    N +  +        P +  L    N I +L E+ +LSC + LE L+++KNP +++ P+     +R YV+     +R+LD   V  KE  +A  L++   G
Sbjct:   84 LNLPRNSIPAIEGLKDLCHLQWLNLAGNSIKTIEHLNGCT--SLTYVDLSDNNISHLGDMSKLSNLRTLLLHGNMVTSLRTAPTHLPPQLGILSLAENEITDLTEMSHLSCLRSLEQLSVMKNPCMLSAPSAPACDHRPYVLSWCLTLRVLDGHVVTQKESLKAEWLYSQGRG 254          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Sea Lamprey
Match: LRRC49 (leucine rich repeat containing 49 [Source:HGNC Symbol;Acc:HGNC:25965])

HSP 1 Score: 63.5438 bits (153), Expect = 2.916e-11
Identity = 51/164 (31.10%), Postives = 80/164 (48.78%), Query Frame = 3
Query:  132 LDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFL---ALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKERKQAAQLFAGKTGEQLMKIQRIPIYNGKSK 614
            LDL GN+I  IENL + L +   L+   N+I   D    L  LA +N   N I  + K+++  +P++  L  + NNI      D + C ++   L   AL  NP+     YR   +  + Q+R LD  RV ++ER+ A+ L A K  E+  +  +  I   K +
Sbjct:  123 LDLHGNQIVRIENL-SHLSELRVLNLAGNQITHVDSLRGLHSLAELNLRRNNISSM-KEVD-CLPSLQRLFLSYNNIANF---DGIVCLREAPSLCEVALDGNPLAQEACYRQTALRHMGQLRQLDMKRVTEEERRLAS-LLARKQEEKKREFHKQAIQKEKRR 279          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Sea Lamprey
Match: lrrc6 (leucine rich repeat containing 6 [Source:NCBI gene;Acc:432388])

HSP 1 Score: 56.225 bits (134), Expect = 5.477e-9
Identity = 43/138 (31.16%), Postives = 66/138 (47.83%), Query Frame = 3
Query:  129 ELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKERKQAAQ 542
            EL L   +I  +++L        +L   +N I R +    LK L  IN   N + +I ++L Q   ++  L  T N + EL  ++ L     LE L L+ NP      YR YV+  LPQ++ LD   ++  ER +A Q
Sbjct:   22 ELSLHQQQIERLQHLDVWCRHLKTLYLHNNVIPRIENLSRLKELEYINLALNNVERI-ENL-QGCESLQKLDLTVNFVGELSSVETLRHNPLLEELFLVGNPCADFEGYRPYVVATLPQLKRLDGQEIERSERIRAHQ 157          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Sea Lamprey
Match: lrrc51 (leucine rich repeat containing 51 [Source:ZFIN;Acc:ZDB-GENE-060929-962])

HSP 1 Score: 49.6766 bits (117), Expect = 1.060e-7
Identity = 30/93 (32.26%), Postives = 49/93 (52.69%), Query Frame = 3
Query:  258 LASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKERKQA 536
            LA I+ + N++  I + L + +  +  L    N +  L  +  L   + L  L L  NPI T  +YR YV+  LP ++ LDFS V +++R+ A
Sbjct:   37 LAWIDLSFNQLSDIPQVLCE-LQELRVLYLHGNTVSRLSNVSTLVPLRHLRSLTLHGNPIETENHYRYYVLSALPSLKSLDFSAVTNQDRQTA 128          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Sea Lamprey
Match: LRRC9 (leucine rich repeat containing 9 [Source:HGNC Symbol;Acc:HGNC:19848])

HSP 1 Score: 48.521 bits (114), Expect = 2.018e-6
Identity = 36/146 (24.66%), Postives = 69/146 (47.26%), Query Frame = 3
Query:  129 ELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFD--GFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIV-TLPNYRLYVIHKLPQVRILDFSRVKDKERKQAAQLFAGK 557
            EL +  N++  +  L   + +  +L    NE+   +  G   + RLA ++  +N++  ++    Q   ++  L   +N++   R++  +     L  L L  NP+  T+  YRL+VI  LP ++ LD + V+  E   A   F G+
Sbjct:  385 ELSVDHNRLGTLHGL-HHMTKLVTLSIDCNELVGLEDAGLEGMPRLARLSAASNRLASLAGL--QRCSSLAELYVASNHLASSRDVYRIKGLTSLVILDLHGNPLASTMEQYRLFVIFHLPALKALDGNAVEVAECDSARDTFGGR 527          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Yeast
Match: LEA1 (Component of U2 snRNP complex; disruption causes reduced U2 snRNP levels; physically interacts with Msl1p; putative homolog of human U2A' snRNP protein [Source:SGD;Acc:S000006134])

HSP 1 Score: 56.9954 bits (136), Expect = 7.687e-10
Identity = 54/223 (24.22%), Postives = 103/223 (46.19%), Query Frame = 3
Query:  126 RELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIP-NITTLVFTNNNIQELREIDNLS-CFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKERKQAAQLFAGKTGEQLMKIQRIPIYNG-KSKSVEVGSDSNIQEQVDIDSSKQVIMRPSSADMYALRASIQNATTMEEVDRLNFILNSG 785
            R+L L+ +  ++  +L         LD T+N++           + ++    N IV++     + +P N+  L  +NN+I+   ++  L    + L+ L L+ N +  L NYR +V+  +P +  LDF  V  +ERK A        G+ L  +      NG + K++E+         +++  SK  + R +      L+  +  AT++EE+ RL  +L+ G
Sbjct:   32 RDLQLETDSESMPSSLKHLTKPTHILDLTNNDLIMIPDLSRRDDIHTLLLGRNNIVEVD---GRLLPMNVQNLTLSNNSIRRFEDLQRLRRAPRTLKNLTLIGNQVCHLANYREHVLRLVPHLETLDFQNVTAEERKSAMSFPRQADGDTLGPVNTAIRDNGSRDKTMEI---------MNLVVSKMTVERRNE-----LKKQLAEATSLEEIARLEKLLSGG 237          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Yeast
Match: MEX67 (Poly(A)RNA binding protein involved in nuclear mRNA export; component of the nuclear pore; ortholog of human TAP [Source:SGD;Acc:S000006090])

HSP 1 Score: 46.9802 bits (110), Expect = 2.969e-6
Identity = 35/110 (31.82%), Postives = 55/110 (50.00%), Query Frame = 3
Query:  240 FPYLKRLAS---------INFTNNKIVKIS--KDLNQFIPNITTLVFTNNNIQELREIDNL-SCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKERKQ 533
            FP + +LAS         +N  +N++  IS    L Q  PN+  L   NN I   R ++   + FKDL  L +  NPI T   YR  ++   P++ +LD   V+D+++ Q
Sbjct:  149 FPAMMKLASTEKSLIVESVNLADNQLKDISAISTLAQTFPNLKNLCLANNQIFRFRSLEVWKNKFKDLRELLMTNNPITTDKLYRTEMLRLFPKLVVLDNVIVRDEQKLQ 258          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Nematostella
Match: EDO45144 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTT8])

HSP 1 Score: 189.889 bits (481), Expect = 1.942e-58
Identity = 101/244 (41.39%), Postives = 158/244 (64.75%), Query Frame = 3
Query:   69 KITLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKERKQAAQLFAGKTGEQLMKIQRI-PIYNGKSKSVEVGSDSNIQEQVDIDSSKQVIMRPSSADMYALRASIQNATTMEEVDRLNFILNSGKYAG 797
            K+T EL+    Q TN +KDRELDL+G KI++IEN+G TLDQFD++DF+DN+I + +GFP LKRL +I   NN++ ++++ L + +PN+ +++ TNN +QEL++++ L   K L +L+LL+NP+   P+YRL+VI+ LPQ+R+LDF R+K +ER  A ++F+GK      K +   P  N  +K VE                 Q    P S D+ A++A+I NA +++EV  L  +L +G+  G
Sbjct:    2 KLTAELMLQCPQFTNAVKDRELDLRGCKISVIENMGATLDQFDTIDFSDNDIRKIEGFPLLKRLKTILLNNNRVCRVAEGLGECLPNLESIILTNNAMQELKDLEPLESVKSLRYLSLLRNPVTNKPHYRLFVINSLPQLRVLDFQRIKMRERDAAKRMFSGKKAPPSSKPKTFTPGENPPAKRVE-----------------QKPPPPPSRDVAAIKAAIANAKSLDEVQGLERLLKAGQVPG 228          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Nematostella
Match: EDO49856 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7REV6])

HSP 1 Score: 60.077 bits (144), Expect = 4.216e-10
Identity = 40/151 (26.49%), Postives = 76/151 (50.33%), Query Frame = 3
Query:  132 LDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKERKQAAQLFAGKTGEQLMKIQ 584
            L+L+GNK  L+   G  L+    L    N I + +G   L+ L  ++  +N+I  + +  ++ + N+  L    N+I   +E+  L C   L  L L++NP+    +YR+ V+  L ++  LD     + ER++A +++  +  E+L   Q
Sbjct:  170 LELRGNK--LMTTTGMNLENLRELYLAANTIRKVEGLDRLEHLTKLHLRDNQIDSL-EGFSENMKNLQYLNLRGNSISSNKEVQKLKCLPLLRALVLMENPVSDEDDYRIEVLIALRRLERLDKDEYTEDERQEAEEIYNQRQEEELAAQQ 317          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Nematostella
Match: EDO36714 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHU6])

HSP 1 Score: 56.225 bits (134), Expect = 2.582e-9
Identity = 47/160 (29.38%), Postives = 68/160 (42.50%), Query Frame = 3
Query:  126 RELDLKGNKIALIENLGTTLDQF---DSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIV-TLPNYRLYVIHKLPQVRILDFSRVKDKERKQAAQLFAGKTGEQLMKIQRIP 593
            + L L G     I +LGT L  F    +LD + N I    G   L+ L ++N   N                        NI  L+++  L    +L+ L L  NP+    P+YRLY++H LP ++ LD   V+D ER+ A   F   T EQ  +    P
Sbjct:    4 KSLSLPGTYHEKITSLGTALKSFTRLKNLDLSRNAIQSLQGVESLQLLETLNLYYN------------------------NISYLQDLSALKYLTNLKELDLRLNPVTKNEPDYRLYIVHLLPSLKRLDDRSVRDSERRAAIMHF---TSEQASEFTESP 136          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Nematostella
Match: EDO45771 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSA0])

HSP 1 Score: 55.4546 bits (132), Expect = 2.204e-8
Identity = 40/135 (29.63%), Postives = 72/135 (53.33%), Query Frame = 3
Query:  132 LDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKERKQA 536
            LDL GN+I+ IENL + L +   L+   NEI +      ++ LA +N   NKI  + +++++ + N+  L  + N I    +I+ L+    +  L+L  NP  +   Y+  V+  +  +R LD  R+ ++ER+ A
Sbjct:  120 LDLHGNRISKIENL-SHLTELRVLNLAGNEILKVCNISGMRSLAELNLRRNKICTV-EEVDR-LSNLQRLFLSFNCISRFEDINCLTRSTSITELSLDGNPFASDVTYKQTVLKSVTCLRQLDMKRITEEERRIA 251          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Nematostella
Match: EDO38071 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDZ3])

HSP 1 Score: 53.5286 bits (127), Expect = 6.553e-8
Identity = 42/139 (30.22%), Postives = 64/139 (46.04%), Query Frame = 3
Query:  132 LDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKERKQAAQLF 548
            L L  N I  IE L   ++    LD + N I   +G   L +L  +   NN+I KI       + N+      NN++++L  +  L  FK+L  L L  NP      Y+ YVI  LP +  LDF  + +  R+ A + +
Sbjct:   70 LQLDNNIIEKIEGLDMLVN-LQWLDLSFNNIEVIEGLDKLTKLKDLTLYNNRITKIEN--MDSLTNLHVFSIGNNSLKQLDNVIYLRRFKNLRTLNLSFNPFCEDSKYKEYVIAHLPDLVYLDFRLIDETAREAATERY 205          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Medaka
Match: LRRC9 (leucine-rich repeat-containing protein 9 [Source:NCBI gene;Acc:101159959])

HSP 1 Score: 58.9214 bits (141), Expect = 5.171e-9
Identity = 47/151 (31.13%), Postives = 76/151 (50.33%), Query Frame = 3
Query:  111 NPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNIT--TLVFTNNNIQELREIDNLSCFKDLEFLAL-----LKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKERKQAAQ 542
            N  K  +L L  N+I  I+NL   ++  + L   +N I +  G   L+ L  +N  +N I KI   L+   PN++   L  + N I   +E+  L+    L+ LAL       NP+  L NY  +V++ +P ++ LD   V DK+ K+AA+
Sbjct:  137 NCQKLEKLYLYNNQICEIQNLDLQVN-LEVLWLNNNCITKIQGLDMLQNLKELNLADNLIEKIGNSLD---PNVSLEILNLSGNQISSFKELAQLAHLPRLKELALKDPMSTPNPVCLLCNYATHVLYHIPGLQQLDSYNVSDKQVKEAAE 283          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Medaka
Match: lrrc51 (leucine-rich repeat-containing protein 51 [Source:NCBI gene;Acc:101170946])

HSP 1 Score: 55.0694 bits (131), Expect = 1.126e-8
Identity = 35/92 (38.04%), Postives = 51/92 (55.43%), Query Frame = 3
Query:  252 KRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKER 527
            KRLA ++ + NKI  I   L + +  +  L    N+I+ L E+D L   + L  + L  NPI T   YR +VI  LPQ++ +DFS V  +ER
Sbjct:   69 KRLAWLDISFNKITHIDPILCR-LHELRVLYLHGNSIRVLSEVDRLGELQHLHSITLHGNPIETNKTYRNHVIFALPQLKSMDFSAVTSQER 159          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Medaka
Match: cep72 (centrosomal protein 72 [Source:NCBI gene;Acc:101162781])

HSP 1 Score: 57.3806 bits (137), Expect = 1.374e-8
Identity = 50/170 (29.41%), Postives = 74/170 (43.53%), Query Frame = 3
Query:   63 MTKITLELIENSIQRTNP-LKD-RELDLKGNKIALIENLGTTLDQF---DSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIV-TLPNYRLYVIHKLPQVRILDFSRVKDKERKQAAQLFAG 554
            +T I+ + I + +Q  +P L D R L L G     I +LG  L+ F    SLD + N +   +G  +LK+L                          L+  +N I  L E+  L     L  L L  NP+    P+Y  Y++H LP +R LD   V++ ERK A   F+ 
Sbjct:    6 LTTISEQWIRDRLQLKHPCLGDVRSLSLPGTLEEKIGHLGNALNNFIRLKSLDLSYNALVSVEGLQHLKKLER------------------------LILYHNCIPSLEEVKTLFQLPVLRELDLRLNPLTKNCPHYWAYIVHALPSLRKLDSCSVRETERKVAIMQFSS 151          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Medaka
Match: cep72 (centrosomal protein 72 [Source:NCBI gene;Acc:101162781])

HSP 1 Score: 56.9954 bits (136), Expect = 1.485e-8
Identity = 50/170 (29.41%), Postives = 74/170 (43.53%), Query Frame = 3
Query:   63 MTKITLELIENSIQRTNP-LKD-RELDLKGNKIALIENLGTTLDQF---DSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIV-TLPNYRLYVIHKLPQVRILDFSRVKDKERKQAAQLFAG 554
            +T I+ + I + +Q  +P L D R L L G     I +LG  L+ F    SLD + N +   +G  +LK+L                          L+  +N I  L E+  L     L  L L  NP+    P+Y  Y++H LP +R LD   V++ ERK A   F+ 
Sbjct:    6 LTTISEQWIRDRLQLKHPCLGDVRSLSLPGTLEEKIGHLGNALNNFIRLKSLDLSYNALVSVEGLQHLKKLER------------------------LILYHNCIPSLEEVKTLFQLPVLRELDLRLNPLTKNCPHYWAYIVHALPSLRKLDSCSVRETERKVAIMQFSS 151          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Medaka
Match: anp32e (acidic nuclear phosphoprotein 32 family member E [Source:NCBI gene;Acc:101170937])

HSP 1 Score: 53.9138 bits (128), Expect = 5.681e-8
Identity = 52/169 (30.77%), Postives = 79/169 (46.75%), Query Frame = 3
Query:   69 KITLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDF---TDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKERKQAAQLFAGKTGE 566
            +ITLEL     +  +P +  EL L  ++ A  E  G T D+F  L+F    +  +      P L +L  +  ++N +    + L +  PN+T L  + N I+EL  ++ L   K L+ L L    I +L +YR  V   LPQV  LD     D+E  +A    A   GE
Sbjct:    6 RITLEL-----RNRSPAEIVELVLDNSRSADGEVEGLT-DEFTELEFLSMVNVGLSSLTKLPPLPKLRKLELSDNNLSGSLETLAEKCPNLTYLNLSGNKIKELSTLEALQNLKSLQSLDLFNCEITSLEDYRESVFELLPQVTYLDGF---DQEDNEAPDSEADDEGE 165          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Planmine SMEST
Match: SMESG000014464.1 (SMESG000014464.1)

HSP 1 Score: 515.383 bits (1326), Expect = 0.000e+0
Identity = 253/255 (99.22%), Postives = 255/255 (100.00%), Query Frame = 3
Query:   63 MTKITLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKERKQAAQLFAGKTGEQLMKIQRIPIYNGKSKSVEVGSDSNIQEQVDIDSSKQVIMRPSSADMYALRASIQNATTMEEVDRLNFILNSGKYAGFASAPRQMRG 827
            MTKITLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVI+KLPQVRILDFSRVKDKERKQAAQLFAGKTGEQLMKIQRIPIYNGKSKSVEVGSDSNIQEQVDIDSSKQVIMRPSSADMYALRA+IQNATTMEEVDRLNFILNSGKYAGFASAPRQMRG
Sbjct:    1 MTKITLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIYKLPQVRILDFSRVKDKERKQAAQLFAGKTGEQLMKIQRIPIYNGKSKSVEVGSDSNIQEQVDIDSSKQVIMRPSSADMYALRAAIQNATTMEEVDRLNFILNSGKYAGFASAPRQMRG 255          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Planmine SMEST
Match: SMESG000023275.1 (SMESG000023275.1)

HSP 1 Score: 52.373 bits (124), Expect = 1.150e-7
Identity = 36/106 (33.96%), Postives = 55/106 (51.89%), Query Frame = 3
Query:  258 LASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKERK--QAAQLFAGKTGEQ 569
            L  I+F+ N +  IS  +  F  N+  L    N I E+ E+D L+   +L  L+L  NPI    NY  YV+ ++P++  LDF+ +   +RK  Q  Q    KTG +
Sbjct:   95 LTWIDFSCNSLTTISDKILSF-ANLKLLNLHGNKITEITEVDKLNSLPNLLKLSLHGNPIENEKNYFYYVLGRIPKLINLDFTGISPGDRKTAQTFQTMIFKTGNR 199          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Planmine SMEST
Match: SMESG000006866.1 (SMESG000006866.1)

HSP 1 Score: 54.299 bits (129), Expect = 1.417e-7
Identity = 52/196 (26.53%), Postives = 91/196 (46.43%), Query Frame = 3
Query:  132 LDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKERKQAAQLFAG-----------KTGEQL--MKIQRIPIYNGKSKSVEVGSDSNIQEQVDIDSSKQV 680
            L ++ + I  IE L   L     L  ++N+I R DG   L  L  ++   N++  I     +    +T + F+ N    + EI  L   KDL  L + +NP+  + +YRLY++ +L  + ILD   V   E+K A + F             +T +QL  MK  ++ +    +K  +   D N +++ +I+  KQ+
Sbjct:   55 LSIRFHAIEKIEKLDK-LCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKDLLDLDVSENPVAAIAHYRLYIVMRLKYLLILDNREVLADEKKIAIEQFEENELDRMSSRLLETEKQLEEMKENQLKLQKDHAKQDQYQKDLNKKQKSNIEQIKQL 249          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Planmine SMEST
Match: SMESG000041551.1 (SMESG000041551.1)

HSP 1 Score: 53.5286 bits (127), Expect = 1.974e-7
Identity = 43/151 (28.48%), Postives = 74/151 (49.01%), Query Frame = 3
Query:  132 LDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIP-NITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLP------NYRLYVIHKLPQVRILDFSRVKDKERKQAAQLFAGKTG 563
            L+L  N+I  IE+L   L Q   LD +DN I +     +L +L +     N+I  + + ++ F+  +I  L    N I +L EI  L    +L+ L++ +NP +         +YR Y+I+    ++ILD   + +KE+  A  L+    G
Sbjct:   91 LNLSNNRIKNIEHLEGNL-QLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYR-IDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEINEKEKLIAEWLYTQGKG 239          
BLAST of U2 small nuclear ribonucleoprotein A' vs. Planmine SMEST
Match: SMESG000058220.1 (SMESG000058220.1)

HSP 1 Score: 52.373 bits (124), Expect = 2.999e-7
Identity = 47/141 (33.33%), Postives = 60/141 (42.55%), Query Frame = 3
Query:  129 ELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNIQELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRVKDKERKQAAQLFA 551
            EL L    I  IENL     +   L    N I R +    LK+L  IN   N I  I    N    ++  L  T N +  L  I NL    + E L L  NP  +   YR YVI  LPQ++ LD   +   ER  A Q ++
Sbjct:   25 ELSLHQQDIDKIENLDKWCRELKILYLQSNLISRIENVSRLKKLEYINLALNNIEIIENLEN--CESLKKLDLTVNFVGILTSIGNLKNLYNFEELYLTGNPCQSYDGYREYVITTLPQLQTLDGVEITKSERISAFQKYS 163          
The following BLAST results are available for this feature:
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SNRPA12.241e-7046.75small nuclear ribonucleoprotein polypeptide A' [So... [more]
SNRPA14.549e-5453.59small nuclear ribonucleoprotein polypeptide A' [So... [more]
SNRPA14.549e-5453.59small nuclear ribonucleoprotein polypeptide A' [So... [more]
SNRPA11.547e-2541.13small nuclear ribonucleoprotein polypeptide A' [So... [more]
CNTRL1.420e-929.93centriolin [Source:HGNC Symbol;Acc:HGNC:1858][more]
back to top
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mog-21.642e-5039.26Probable U2 small nuclear ribonucleoprotein A' [S... [more]
mog-21.642e-5039.26Probable U2 small nuclear ribonucleoprotein A' [S... [more]
back to top
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
U2A1.066e-5840.16gene:FBgn0033210 transcript:FBtr0088941[more]
Cep975.177e-1028.21gene:FBgn0031575 transcript:FBtr0077504[more]
tilB6.683e-930.00gene:FBgn0014395 transcript:FBtr0077345[more]
TbCMF466.617e-731.21gene:FBgn0032163 transcript:FBtr0079898[more]
CG141856.677e-729.01gene:FBgn0036936 transcript:FBtr0074818[more]
back to top
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snrpa11.352e-6645.12small nuclear ribonucleoprotein polypeptide A' [So... [more]
snrpa18.837e-5153.59small nuclear ribonucleoprotein polypeptide A' [So... [more]
lrrc513.767e-1239.13leucine rich repeat containing 51 [Source:ZFIN;Acc... [more]
cep722.581e-1029.73centrosomal protein 72 [Source:NCBI gene;Acc:55348... [more]
lrrc231.546e-729.19leucine rich repeat containing 23 [Source:ZFIN;Acc... [more]
back to top
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SNRPA14.132e-6746.34small nuclear ribonucleoprotein polypeptide A' [So... [more]
SNRPA11.266e-5545.21small nuclear ribonucleoprotein polypeptide A' [So... [more]
CNTRL6.705e-1330.94centriolin [Source:NCBI gene;Acc:100270771][more]
CNTRL6.801e-1330.94centriolin [Source:NCBI gene;Acc:100270771][more]
CNTRL6.979e-1330.94centriolin [Source:NCBI gene;Acc:100270771][more]
back to top
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Snrpa17.960e-7146.75small nuclear ribonucleoprotein polypeptide A' [So... [more]
Snrpa13.123e-5453.59small nuclear ribonucleoprotein polypeptide A' [So... [more]
Gm452133.351e-1461.22predicted gene 45213 [Source:MGI Symbol;Acc:MGI:57... [more]
Lrguk9.646e-1032.65leucine-rich repeats and guanylate kinase domain c... [more]
Lrguk2.762e-931.97leucine-rich repeats and guanylate kinase domain c... [more]
back to top
BLAST of U2 small nuclear ribonucleoprotein A' vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P57784|RU2A_MOUSE5.568e-7046.75U2 small nuclear ribonucleoprotein A' OS=Mus muscu... [more]
sp|Q4R8Y8|RU2A_MACFA1.076e-6946.75U2 small nuclear ribonucleoprotein A' OS=Macaca fa... [more]
sp|P09661|RU2A_HUMAN1.076e-6946.75U2 small nuclear ribonucleoprotein A' OS=Homo sapi... [more]
sp|Q9V4Q8|RU2A_DROME1.069e-5740.16Probable U2 small nuclear ribonucleoprotein A' OS=... [more]
sp|P43333|RU2A_ARATH1.307e-5642.51U2 small nuclear ribonucleoprotein A' OS=Arabidops... [more]
back to top
BLAST of U2 small nuclear ribonucleoprotein A' vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267G7214.725e-7248.79Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
H0ZF701.783e-7147.41LRRcap domain-containing protein OS=Taeniopygia gu... [more]
A0A218V0C21.783e-7147.41U2 small nuclear ribonucleoprotein A OS=Lonchura s... [more]
A0A093GJG31.924e-7148.37U2 small nuclear ribonucleoprotein A OS=Dryobates ... [more]
A0A267G7541.928e-7148.39Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snrpa11.271e-3441.42small nuclear ribonucleoprotein polypeptide A' [So... [more]
snrpa19.734e-2760.53small nuclear ribonucleoprotein polypeptide A' [So... [more]
drc31.034e-831.11dynein regulatory complex subunit 3 [Source:ZFIN;A... [more]
LRRC95.588e-826.35leucine-rich repeat-containing protein 9-like [Sou... [more]
LRRC95.904e-826.35leucine-rich repeat-containing protein 9-like [Sou... [more]
back to top
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cep976.562e-1430.64centrosomal protein 97 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
LRRC492.916e-1131.10leucine rich repeat containing 49 [Source:HGNC Sym... [more]
lrrc65.477e-931.16leucine rich repeat containing 6 [Source:NCBI gene... [more]
lrrc511.060e-732.26leucine rich repeat containing 51 [Source:ZFIN;Acc... [more]
LRRC92.018e-624.66leucine rich repeat containing 9 [Source:HGNC Symb... [more]
back to top
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
LEA17.687e-1024.22Component of U2 snRNP complex; disruption causes r... [more]
MEX672.969e-631.82Poly(A)RNA binding protein involved in nuclear mRN... [more]
back to top
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO451441.942e-5841.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498564.216e-1026.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO367142.582e-929.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO457712.204e-829.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380716.553e-830.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of U2 small nuclear ribonucleoprotein A' vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LRRC95.171e-931.13leucine-rich repeat-containing protein 9 [Source:N... [more]
lrrc511.126e-838.04leucine-rich repeat-containing protein 51 [Source:... [more]
cep721.374e-829.41centrosomal protein 72 [Source:NCBI gene;Acc:10116... [more]
cep721.485e-829.41centrosomal protein 72 [Source:NCBI gene;Acc:10116... [more]
anp32e5.681e-830.77acidic nuclear phosphoprotein 32 family member E [... [more]
back to top
BLAST of U2 small nuclear ribonucleoprotein A' vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014464.10.000e+099.22SMESG000014464.1[more]
SMESG000023275.11.150e-733.96SMESG000023275.1[more]
SMESG000006866.11.417e-726.53SMESG000006866.1[more]
SMESG000041551.11.974e-728.48SMESG000041551.1[more]
SMESG000058220.12.999e-733.33SMESG000058220.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035650 ID=SMED30035650|Name=U2 small nuclear ribonucleoprotein A'|organism=Schmidtea mediterranea sexual|type=transcript|length=1143bp
AGTAAATTTTAAGATTTAAAGTAATTTTTACCATCATTATTTTTTTATTT
TAAAGATTTGAAATGACTAAAATAACTCTTGAATTAATTGAAAATTCAAT
CCAGCGTACTAATCCATTGAAAGACCGAGAATTAGACTTAAAAGGAAATA
AAATAGCGCTTATTGAAAATCTTGGAACTACTTTAGATCAGTTTGATTCA
TTAGATTTTACAGATAATGAAATTCACAGATTTGATGGGTTTCCATACTT
AAAAAGATTGGCAAGTATTAATTTTACAAATAACAAAATTGTGAAAATCT
CAAAAGATCTGAATCAATTTATTCCCAACATCACAACTCTTGTTTTCACT
AACAACAATATACAAGAATTAAGAGAAATTGACAATTTGTCTTGTTTTAA
GGATTTGGAATTTTTAGCATTGTTGAAGAATCCAATTGTAACTCTACCTA
ATTATCGACTGTATGTCATTCATAAATTGCCACAAGTAAGAATTTTAGAT
TTCTCACGAGTCAAAGATAAAGAACGTAAACAAGCGGCGCAATTATTTGC
CGGAAAAACTGGTGAGCAATTAATGAAGATCCAAAGGATTCCGATTTACA
ATGGAAAATCCAAATCAGTGGAAGTTGGCAGCGATTCAAACATCCAAGAG
CAAGTTGACATCGACAGTTCCAAGCAGGTCATAATGAGACCCTCATCGGC
AGACATGTATGCGCTTCGAGCGTCAATCCAGAACGCGACCACCATGGAGG
AGGTCGACAGGCTGAATTTCATCCTTAATTCTGGCAAATATGCAGGTTTT
GCATCGGCTCCTCGTCAAATGCGCGGCTGAGATGAATATAATATAGTTTT
CTGTTTATTGAGTTCATTAGCATGTAAATAATTGAATTGTTGTCTTTGCC
TTTATTTGATTGGAGGATTTTGAGTGGAATATTTGAATGATTTTCATTAT
ATTTCATTGGGGGACTCGGTTAATTTGATCGATATTGATTGTGTTATTAG
ATATCCTAGATTTTGGATCATCTTTTCATTTAGGTTGAGATTCTTTTTAA
TTGGATCTTATTTTTTATTGTAATAGGTCACGTTTTCAATTGATTCTAAT
TTAGAGATTCCGTTAAGGAATCCCTCGCGTGGCAAGAGGGGAG
back to top

protein sequence of SMED30035650-orf-1

>SMED30035650-orf-1 ID=SMED30035650-orf-1|Name=SMED30035650-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=256bp
MTKITLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFT
DNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVFTNNNI
QELREIDNLSCFKDLEFLALLKNPIVTLPNYRLYVIHKLPQVRILDFSRV
KDKERKQAAQLFAGKTGEQLMKIQRIPIYNGKSKSVEVGSDSNIQEQVDI
DSSKQVIMRPSSADMYALRASIQNATTMEEVDRLNFILNSGKYAGFASAP
RQMRG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005654nucleoplasm
GO:0016604nuclear body
GO:0071005U2-type precatalytic spliceosome
GO:0071007U2-type catalytic step 2 spliceosome
GO:0005634nucleus
GO:0005681spliceosomal complex
GO:0005686U2 snRNP
GO:0016607nuclear speck
GO:0030529intracellular ribonucleoprotein complex
GO:0071013catalytic step 2 spliceosome
Vocabulary: biological process
TermDefinition
GO:0007283spermatogenesis
GO:0000398mRNA splicing, via spliceosome
GO:0006397mRNA processing
GO:0008380RNA splicing
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR003603U2A'_phosphoprotein32A_C
IPR032675LRR_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0030620U2 snRNA binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePFAMPF14580LRR_9coord: 1..172
e-value: 2.8E-68
score: 228.8
NoneNo IPR availablePANTHERPTHR10552U2 SMALL NUCLEAR RIBONUCLEOPROTEIN Acoord: 1..243
NoneNo IPR availablePANTHERPTHR10552:SF6U2 SMALL NUCLEAR RIBONUCLEOPROTEIN A'coord: 1..243
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 14..153
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 1..175
e-value: 9.2E-42
score: 143.9