Guanylate cyclase

Overview
NameGuanylate cyclase
Smed IDSMED30035633
Length (bp)3128
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Guanylate cyclase (SMED30035633) t-SNE clustered cells

Violin plots show distribution of expression levels for Guanylate cyclase (SMED30035633) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Guanylate cyclase (SMED30035633) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Guanylate cyclase (SMED30035633) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Guanylate cyclase vs. Ensembl Human
Match: GUCY2F (guanylate cyclase 2F, retinal [Source:HGNC Symbol;Acc:HGNC:4691])

HSP 1 Score: 596.66 bits (1537), Expect = 0.000e+0
Identity = 317/544 (58.27%), Postives = 403/544 (74.08%), Query Frame = 3
Query: 1053 SFSSGSLEGIL--DPNTAKYNGDFVHIKYLDLSH----ASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIY-GSENIYSAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELG-GYHLELRGKVELKGKGIVDSYWLIGKDGFLKPLPVAPPADSEDN--HGLASV 2654
            SFSSGSL      + N A Y GD+V +K   L       S+KS+  D   +++D+R+EN+NP +G + D    ++V E C RGSL+DI+ N++V LDW FK SL+ DLI+GM+Y+H  +  VH RLKS NCVVDGR+VLK+TDYG   + E+   SE   S ++LLWTAPELLR       GS  GD+YSF+IIMQE++ R  PF MM++ A EI+N+++KPPP+ RP V    APP  +Q+MK+ W+E AE RP+F+E+  Q K  NKGKK NI+D M +M+E+YS++LE+ +R RT+ELE E++KTE L+ +MLP  VA+SL  G  VEPE FD VT+YFSDIVGFTTISA+S P++VVDLLNDLYT+FDA I  +DVYKVETIGDAYMVASGLP RNG RHA EIA M+LD+LS  GTFK+RHMP++P+R+RIGLH+GP V GVVGLTMPRYCLFGDTVNTASRMES+G  +RIHVS  T  +L  L  GY +ELRG+ ELKGKG  +++WLIGK GF+KPLPV PP D +    HGL  V
Sbjct:  547 SFSSGSLTPATYENSNIAIYEGDWVWLKKFSLGDFGDLKSIKSRASDVFEMMKDLRHENINPLLGFFYDSGMFAIVTEFCSRGSLEDILTNQDVKLDWMFKSSLLLDLIKGMKYLHHREF-VHGRLKSRNCVVDGRFVLKVTDYGFNDILEMLRLSEEESSMEELLWTAPELLRAPRGSRLGSFAGDVYSFAIIMQEVMVRGTPFCMMDLPAQEIINRLKKPPPVYRPVVPPEHAPPECLQLMKQCWAEAAEQRPTFDEIFNQFKTFNKGKKTNIIDSMLRMLEQYSSNLEDLIRERTEELEIEKQKTEKLLTQMLPPSVAESLKKGCTVEPEGFDLVTLYFSDIVGFTTISAMSEPIEVVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPKRNGSRHAAEIANMSLDILSSVGTFKMRHMPEVPVRIRIGLHSGPVVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVSLSTVTILQNLSEGYEVELRGRTELKGKGTEETFWLIGKKGFMKPLPVPPPVDKDGQVGHGLQPV 1089          
BLAST of Guanylate cyclase vs. Ensembl Human
Match: GUCY2D (guanylate cyclase 2D, retinal [Source:HGNC Symbol;Acc:HGNC:4689])

HSP 1 Score: 556.214 bits (1432), Expect = 3.183e-180
Identity = 284/548 (51.82%), Postives = 391/548 (71.35%), Query Frame = 3
Query: 1062 SGSLEGILDPNTAKYNGDFVHIK-YLDLSHASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISS----------ISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGSENIYS----AKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDEL-GGYHLELRGKVELKGKGIVDSYWLIGKDGFLKPLPVAP---PADSEDNHGLA 2648
            SG  + +  PN   Y GD V +K +    H +++         ++++R+ENV   +G +L   +          +++V EHC RGSL+D++  + + LDW FK SL+ DLI+G+RY+H   +  H RLKS NC+VDGR+VLKITD+G   + E   ++ +      A+D LWTAPELLR   L   G+  GD++S +IIMQE++ R  P+ M+ +T +E++ ++R PPPLCRP V+  +AP   I +MK+ W+E  E+RPS +      K++NKG+K NI+D M +M+E+YS++LE+ +R RT+ELE E++KT+ L+ +MLP  VA++L  G PVEPE F++VT+YFSDIVGFTTISA+S P++VVDLLNDLYT+FDA I  +DVYKVETIGDAYMVASGLP RNG+RHA EIA M+LD+LS  GTF++RHMP++P+R+RIGLH+GPCV GVVGLTMPRYCLFGDTVNTASRMES+G  +RIHV+  T  +L  L  GY +ELRG+ ELKGKG  D++WL+G+ GF KP+P  P   P  S  NHG++
Sbjct:  541 SGPSQHLDSPNIGVYEGDRVWLKKFPGDQHIAIRPATKTAFSKLQELRHENVALYLGLFLARGAEGPAALWEGNLAVVSEHCTRGSLQDLLAQREIKLDWMFKSSLLLDLIKGIRYLHHRGV-AHGRLKSRNCIVDGRFVLKITDHGHGRLLE---AQKVLPEPPRAEDQLWTAPELLRDPALERRGTLAGDVFSLAIIMQEVVCRSAPYAMLELTPEEVVQRVRSPPPLCRPLVSMDQAPVECILLMKQCWAEQPELRPSMDHTFDLFKNINKGRKTNIIDSMLRMLEQYSSNLEDLIRERTEELELEKQKTDRLLTQMLPPSVAEALKTGTPVEPEYFEQVTLYFSDIVGFTTISAMSEPIEVVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPQRNGQRHAAEIANMSLDILSAVGTFRMRHMPEVPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNLSTVGILRALDSGYQVELRGRTELKGKGAEDTFWLVGRRGFNKPIPKPPDLQPGSS--NHGIS 1082          
BLAST of Guanylate cyclase vs. Ensembl Human
Match: NPR1 (natriuretic peptide receptor 1 [Source:HGNC Symbol;Acc:HGNC:7943])

HSP 1 Score: 498.049 bits (1281), Expect = 1.653e-158
Identity = 255/503 (50.70%), Postives = 342/503 (67.99%), Query Frame = 3
Query: 1095 TAKYNGDFVHIKYLDLSHASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEI--YGSENIYSAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGM--MNMTADEILNKI-RKPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELGGYHLELRGKVELKGKGIVDSYWLIGKDG 2588
            TA Y G+ V +K ++     L  K +  L+ +RD++NE++   +G   D  +I ++ E+C RGSL+DI++N+++ LDW F+ SL  D+++GM ++H   I  H  LKSSNCVVDGR+VLKITDYGL +  ++       +Y+ K  LWTAPELLR+      GSQ GD+YSF II+QEI  R   F +  ++++  EI+ ++ R   P  RP +           +M+R W+E+ + RP F+++   L+  N+    NI+D++   ME+Y+ +LEE V  RT     E++K E L+ ++LP  VA+ L  G+ V+ E+FD VTIYFSDIVGFT +SA S PMQVV LLNDLYT FDA ID +DVYKVETIGDAYMV SGLP+RNGR HA E+A MAL LL    +F+IRH P   LRLRIG+HTGP   GVVGL MPRYCLFGDTVNTASRMES+G A +IH+S  TK VL+E GG+ LELRG VE+KGKG V +YWL+G+ G
Sbjct:  556 TAYYKGNLVAVKRVNRKRIELTRKVLFELKHMRDVQNEHLTRFVGACTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAICSHGNLKSSNCVVDGRFVLKITDYGLESFRDLDPEQGHTVYAKK--LWTAPELLRMASPPVRGSQAGDVYSFGIILQEIALRSGVFHVEGLDLSPKEIIERVTRGEQPPFRPSLALQSHLEELGLLMQRCWAEDPQERPPFQQIRLTLRKFNRENSSNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGRLHACEVARMALALLDAVRSFRIRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSETKAVLEEFGGFELELRGDVEMKGKGKVRTYWLLGERG 1056          
BLAST of Guanylate cyclase vs. Ensembl Human
Match: NPR2 (natriuretic peptide receptor 2 [Source:HGNC Symbol;Acc:HGNC:7944])

HSP 1 Score: 489.574 bits (1259), Expect = 1.719e-155
Identity = 256/503 (50.89%), Postives = 343/503 (68.19%), Query Frame = 3
Query: 1092 NTAKYNGDFVHIKYLDLSHASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPT---VYEIYGSENIYSAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGM--MNMTADEILNKIRKPP-PLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELGGYHLELRGKVELKGKGIVDSYWLIGK 2582
            NT  + G+ V IK+++     L  + +  L+ +RD++  ++   IG  +D  +I +V E+C RGSL+DI++N ++NLDW F+ SL+ DL++GM ++H S I  H  LKSSNCVVD R+VLKITDYGL +     E   S  +Y+ K  LWTAPELL  + L   G QK D+YSF II+QEI  R  PF +  ++++  EI+ K+R    P  RP + +++     + +M+R W+++   RP F ++   ++  NK    +I+D++   ME+Y+ +LE+ V  RT     E++K E L+ ++LP  VA+ L  G+ V+ E+FD VTIYFSDIVGFT +SA S PMQVV LLNDLYT FDA ID +DVYKVETIGDAYMV SGLP RNG+RHA EIA MAL LL    +F+IRH P   LRLRIG+HTGP   GVVGL MPRYCLFGDTVNTASRMES+G A +IHVS  TK  LDELG + LELRG VE+KGKG + +YWL+G+
Sbjct:  539 NTGHFKGNVVAIKHVNKKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIISSHGSLKSSNCVVDSRFVLKITDYGLASFRSTAEPDDSHALYAKK--LWTAPELLSGNPLPTTGMQKADVYSFGIILQEIALRSGPFYLEGLDLSPKEIVQKVRNGQRPYFRPSIDRTQLNEELVLLMERCWAQDPAERPDFGQIKGFIRRFNKEGGTSILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWLLGE 1039          
BLAST of Guanylate cyclase vs. Ensembl Human
Match: GUCY2C (guanylate cyclase 2C [Source:HGNC Symbol;Acc:HGNC:4688])

HSP 1 Score: 399.053 bits (1024), Expect = 3.431e-121
Identity = 242/588 (41.16%), Postives = 338/588 (57.48%), Query Frame = 3
Query: 1098 AKYNGDFVHIKYLDLSHASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNK-----NVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGSENIYSAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMT-ADEILNKIRKPPPL--CRPQV---TQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDL----NKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELGGYHL-ELRGKVELKGKGIVDSYWLIGKDGFLKPLPVAPPADSEDNHGLASVLKPDVLESIKSQHDHQSNTNPQSPDKTVSKDSKTLVAKRSDETKINSTEKSST 2813
             KY+   V +K L  +  +   K    L  +  I   N+    G     + I  V E+C RGSL++++ +         +DWEFK+S++ D+ +GM Y+H+S+ +VH RLKS+NCVVD R V+KITD+G           +I   K  LWTAPE LR    +AN SQKGD+YS+ II QEII R   F  ++    +E + ++     +   RP +   T  E       ++K  W E+ E RP F+++   L  +    +  K  + +D + + ++ YS +LE  V  RT   + E+ + + L   +LPR+V +SL     VEPE ++EVTIYFSDIVGFTTI   S PM+VVD+LND+Y  FD  +D +DVYKVETIGDAYMVASGLP RNG RHA +IA MAL++LS  GTF++ H+P +P+ +RIG+H+GPC  GVVG+ MPRYCLFGDTVNTASRMES+G   RIHVS  T  +L       L E+RG+  LKG+G   +YWL G       LP  P    E+   L +     +  S+  Q    +    Q P +  S    TL     +  ++N+T+K ST
Sbjct:  506 CKYDKKRVILKDLKHNDGNFTEKQKIELNKLLQIDYYNLTKFYGTVKLDTMIFGVIEYCERGSLREVLNDTISYPDGTFMDWEFKISVLYDIAKGMSYLHSSKTEVHGRLKSTNCVVDSRMVVKITDFG---------CNSILPPKKDLWTAPEHLR----QANISQKGDVYSYGIIAQEIILRKETFYTLSCRDRNEKIFRVENSNGMKPFRPDLFLETAEEKELEVYLLVKNCWEEDPEKRPDFKKIETTLAKIFGLFHDQKNESYMDTLIRRLQLYSRNLEHLVEERTQLYKAERDRADRLNFMLLPRLVVKSLKEKGFVEPELYEEVTIYFSDIVGFTTICKYSTPMEVVDMLNDIYKSFDHIVDHHDVYKVETIGDAYMVASGLPKRNGNRHAIDIAKMALEILSFMGTFELEHLPGLPIWIRIGVHSGPCAAGVVGIKMPRYCLFGDTVNTASRMESTGLPLRIHVSGSTIAILKRTECQFLYEVRGETYLKGRGNETTYWLTGMKDQKFNLPTPPTV--ENQQRLQAEFSDMIANSL--QKRQAAGIRSQKPRRVASYKKGTL-----EYLQLNTTDKEST 1071          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-28 (Receptor-type guanylate cyclase gcy-28 [Source:UniProtKB/Swiss-Prot;Acc:Q86GV3])

HSP 1 Score: 429.483 bits (1103), Expect = 1.318e-131
Identity = 251/548 (45.80%), Postives = 346/548 (63.14%), Query Frame = 3
Query: 1050 KSFSSGSLEGILDPNT------AKYNGDFVHIK----------YLDLSHASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVY-------EIYGSENIYSAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMN--MTADEILNKIRKP-----PPLCRPQVTQS---EAPPAY----IQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKM-NIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELGGYHLELRGKVELKGKGIVDSYWLIG 2579
            KS S GS+E I   NT      A + G  V IK           LDLS A L       L+ ++D++++++    G  +D     +V E+C +GSL+DI++N+ + LD   K SL+ DL++G+ ++H S+I+ H RLKSSNCVVD R+VLK+TD+GL  ++       E  G    Y  K +LWTAPELLR  +    G+QKGDIYSF+II+ E++ R   F + N  ++ +EI+ ++RKP      PL RP V+++   E   A     + +M   WSE+   RP    + + ++ LN+  +  N+VD++ K ME+Y+ +LE  V  RT E   E+KK E L+ ++LP  +A +L+AG+ V+ ES+D VTIYFSDIVGFT++S+ S PMQVV LLNDLY  FD  +D + VYKVETIGDAYMV SGLP R    HA +IA M+L LL +   F IRH P   L+LRIG+H+G  V GVVG  MPRYCLFGDTVNT+SRMES+G   +IHVS  T  +L +  G+ LELRG VE+KGKG+  +YWL G
Sbjct:  665 KSGSGGSVETIAQNNTQIYTKTAIFKGVVVAIKKLNIDPKKYPRLDLSRAQLM-----ELKKMKDLQHDHITRFTGACIDFPHYCVVTEYCPKGSLEDILENEKIELDKLMKYSLLHDLVKGLFFLHNSEIRSHGRLKSSNCVVDSRFVLKVTDFGLHRLHCLEEINLEEIGEHAYY--KKMLWTAPELLRDSNAPPMGTQKGDIYSFAIILHEMMFRKGVFALENEDLSPNEIVQRVRKPVSEDQEPL-RPWVSETGEGEGDDALNDTLLSLMVACWSEDPHERPEVSSVRKAVRSLNRDNETSNLVDNLLKRMEQYANNLEGLVEERTQEYLAEKKKVEELLHQLLPPAIADTLIAGRAVQAESYDCVTIYFSDIVGFTSLSSQSTPMQVVTLLNDLYLAFDGVVDNFKVYKVETIGDAYMVVSGLPERRD-DHANQIAQMSLSLLHKVKNFVIRHRPHEQLKLRIGMHSGSVVAGVVGSKMPRYCLFGDTVNTSSRMESNGLPLKIHVSQQTYDILMQEAGFKLELRGSVEMKGKGMQTTYWLRG 1203          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-28 (Receptor-type guanylate cyclase gcy-28 [Source:UniProtKB/Swiss-Prot;Acc:Q86GV3])

HSP 1 Score: 429.098 bits (1102), Expect = 2.340e-131
Identity = 251/548 (45.80%), Postives = 346/548 (63.14%), Query Frame = 3
Query: 1050 KSFSSGSLEGILDPNT------AKYNGDFVHIK----------YLDLSHASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVY-------EIYGSENIYSAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMN--MTADEILNKIRKP-----PPLCRPQVTQS---EAPPAY----IQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKM-NIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELGGYHLELRGKVELKGKGIVDSYWLIG 2579
            KS S GS+E I   NT      A + G  V IK           LDLS A L       L+ ++D++++++    G  +D     +V E+C +GSL+DI++N+ + LD   K SL+ DL++G+ ++H S+I+ H RLKSSNCVVD R+VLK+TD+GL  ++       E  G    Y  K +LWTAPELLR  +    G+QKGDIYSF+II+ E++ R   F + N  ++ +EI+ ++RKP      PL RP V+++   E   A     + +M   WSE+   RP    + + ++ LN+  +  N+VD++ K ME+Y+ +LE  V  RT E   E+KK E L+ ++LP  +A +L+AG+ V+ ES+D VTIYFSDIVGFT++S+ S PMQVV LLNDLY  FD  +D + VYKVETIGDAYMV SGLP R    HA +IA M+L LL +   F IRH P   L+LRIG+H+G  V GVVG  MPRYCLFGDTVNT+SRMES+G   +IHVS  T  +L +  G+ LELRG VE+KGKG+  +YWL G
Sbjct:  686 KSGSGGSVETIAQNNTQIYTKTAIFKGVVVAIKKLNIDPKKYPRLDLSRAQLME-----LKKMKDLQHDHITRFTGACIDFPHYCVVTEYCPKGSLEDILENEKIELDKLMKYSLLHDLVKGLFFLHNSEIRSHGRLKSSNCVVDSRFVLKVTDFGLHRLHCLEEINLEEIGEHAYY--KKMLWTAPELLRDSNAPPMGTQKGDIYSFAIILHEMMFRKGVFALENEDLSPNEIVQRVRKPVSEDQEPL-RPWVSETGEGEGDDALNDTLLSLMVACWSEDPHERPEVSSVRKAVRSLNRDNETSNLVDNLLKRMEQYANNLEGLVEERTQEYLAEKKKVEELLHQLLPPAIADTLIAGRAVQAESYDCVTIYFSDIVGFTSLSSQSTPMQVVTLLNDLYLAFDGVVDNFKVYKVETIGDAYMVVSGLPERRD-DHANQIAQMSLSLLHKVKNFVIRHRPHEQLKLRIGMHSGSVVAGVVGSKMPRYCLFGDTVNTSSRMESNGLPLKIHVSQQTYDILMQEAGFKLELRGSVEMKGKGMQTTYWLRG 1224          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-28 (Receptor-type guanylate cyclase gcy-28 [Source:UniProtKB/Swiss-Prot;Acc:Q86GV3])

HSP 1 Score: 429.098 bits (1102), Expect = 4.308e-131
Identity = 251/548 (45.80%), Postives = 346/548 (63.14%), Query Frame = 3
Query: 1050 KSFSSGSLEGILDPNT------AKYNGDFVHIK----------YLDLSHASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVY-------EIYGSENIYSAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMN--MTADEILNKIRKP-----PPLCRPQVTQS---EAPPAY----IQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKM-NIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELGGYHLELRGKVELKGKGIVDSYWLIG 2579
            KS S GS+E I   NT      A + G  V IK           LDLS A L       L+ ++D++++++    G  +D     +V E+C +GSL+DI++N+ + LD   K SL+ DL++G+ ++H S+I+ H RLKSSNCVVD R+VLK+TD+GL  ++       E  G    Y  K +LWTAPELLR  +    G+QKGDIYSF+II+ E++ R   F + N  ++ +EI+ ++RKP      PL RP V+++   E   A     + +M   WSE+   RP    + + ++ LN+  +  N+VD++ K ME+Y+ +LE  V  RT E   E+KK E L+ ++LP  +A +L+AG+ V+ ES+D VTIYFSDIVGFT++S+ S PMQVV LLNDLY  FD  +D + VYKVETIGDAYMV SGLP R    HA +IA M+L LL +   F IRH P   L+LRIG+H+G  V GVVG  MPRYCLFGDTVNT+SRMES+G   +IHVS  T  +L +  G+ LELRG VE+KGKG+  +YWL G
Sbjct:  724 KSGSGGSVETIAQNNTQIYTKTAIFKGVVVAIKKLNIDPKKYPRLDLSRAQLM-----ELKKMKDLQHDHITRFTGACIDFPHYCVVTEYCPKGSLEDILENEKIELDKLMKYSLLHDLVKGLFFLHNSEIRSHGRLKSSNCVVDSRFVLKVTDFGLHRLHCLEEINLEEIGEHAYY--KKMLWTAPELLRDSNAPPMGTQKGDIYSFAIILHEMMFRKGVFALENEDLSPNEIVQRVRKPVSEDQEPL-RPWVSETGEGEGDDALNDTLLSLMVACWSEDPHERPEVSSVRKAVRSLNRDNETSNLVDNLLKRMEQYANNLEGLVEERTQEYLAEKKKVEELLHQLLPPAIADTLIAGRAVQAESYDCVTIYFSDIVGFTSLSSQSTPMQVVTLLNDLYLAFDGVVDNFKVYKVETIGDAYMVVSGLPERRD-DHANQIAQMSLSLLHKVKNFVIRHRPHEQLKLRIGMHSGSVVAGVVGSKMPRYCLFGDTVNTSSRMESNGLPLKIHVSQQTYDILMQEAGFKLELRGSVEMKGKGMQTTYWLRG 1262          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-22 (Receptor-type guanylate cyclase gcy-22 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTY1])

HSP 1 Score: 411.379 bits (1056), Expect = 2.242e-126
Identity = 214/476 (44.96%), Postives = 321/476 (67.44%), Query Frame = 3
Query: 1179 LRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGSENIYSAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTAD--EILNKIRK---PPPLCRPQV-TQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSP-FTKVVLDELGGYHLELRGKVELKGKGIVDSYWLIGKD 2585
             R +R++ N+N+   IG  LD  ++  ++ +C RGSL+D+I   ++ +DW FK SLM D+   + Y+H S I  H  L SS C+VD RW +K++ +GL  + +    E     +D L TAPE +R  +L    +++ DIYSF+II  E+IT+   + + N T D  E++ KI+K    PP  RP + T+ E   +   +++  W+EN + RP+ E++   +K +N  +  N++DH+F ++E+Y+++LE++V+ R  EL  E+K++++L+ RMLP+ VA+ L  G+ VEPE+FD VTI+FSD+V FTT+++   P+QVV+LLNDLYT FDA I+ +DVYKVETIGD Y+  SGLP RNG  HA EI++M+  LL    TF++ H+P   + +R+GLHTGP VTGVVG+TMPRYCLFGD+VNTASRMES+G   R+H+S    K + + +GGY  E RG+V +KGKG V ++WL+  D
Sbjct:  572 FRKMRNVDNDNLCKFIGLSLDSPTLISIWRYCSRGSLQDVIAKGSLQMDWFFKYSLMRDVADAIYYLHHSPIGPHGWLSSSTCLVDERWQVKVSFFGLSAIKQYEVKEQ----RDFLHTAPEHIRDTNLPI--TKEMDIYSFAIICSELITKKSAWDLENETFDIEELVYKIKKGGRSPP--RPSLETEDEHNGSMSLLVRDCWNENPDQRPTSEQIKTLMKSMNHNRSSNLMDHVFNVLEQYASNLEDEVQARMKELTEEKKRSDVLLYRMLPKQVAEKLKLGQSVEPETFDCVTIFFSDVVSFTTLASRCTPLQVVNLLNDLYTTFDAIIEQHDVYKVETIGDGYLCVSGLPHRNGNEHAKEISSMSFSLLKAIKTFRVPHLPKERINIRVGLHTGPVVTGVVGMTMPRYCLFGDSVNTASRMESNGKPGRVHISTECMKFLTEVIGGYQTEPRGEVIVKGKGAVQTHWLLTDD 1039          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-22 (Receptor-type guanylate cyclase gcy-22 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTY1])

HSP 1 Score: 411.379 bits (1056), Expect = 2.269e-126
Identity = 214/476 (44.96%), Postives = 321/476 (67.44%), Query Frame = 3
Query: 1179 LRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGSENIYSAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTAD--EILNKIRK---PPPLCRPQV-TQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSP-FTKVVLDELGGYHLELRGKVELKGKGIVDSYWLIGKD 2585
             R +R++ N+N+   IG  LD  ++  ++ +C RGSL+D+I   ++ +DW FK SLM D+   + Y+H S I  H  L SS C+VD RW +K++ +GL  + +    E     +D L TAPE +R  +L    +++ DIYSF+II  E+IT+   + + N T D  E++ KI+K    PP  RP + T+ E   +   +++  W+EN + RP+ E++   +K +N  +  N++DH+F ++E+Y+++LE++V+ R  EL  E+K++++L+ RMLP+ VA+ L  G+ VEPE+FD VTI+FSD+V FTT+++   P+QVV+LLNDLYT FDA I+ +DVYKVETIGD Y+  SGLP RNG  HA EI++M+  LL    TF++ H+P   + +R+GLHTGP VTGVVG+TMPRYCLFGD+VNTASRMES+G   R+H+S    K + + +GGY  E RG+V +KGKG V ++WL+  D
Sbjct:  576 FRKMRNVDNDNLCKFIGLSLDSPTLISIWRYCSRGSLQDVIAKGSLQMDWFFKYSLMRDVADAIYYLHHSPIGPHGWLSSSTCLVDERWQVKVSFFGLSAIKQYEVKEQ----RDFLHTAPEHIRDTNLPI--TKEMDIYSFAIICSELITKKSAWDLENETFDIEELVYKIKKGGRSPP--RPSLETEDEHNGSMSLLVRDCWNENPDQRPTSEQIKTLMKSMNHNRSSNLMDHVFNVLEQYASNLEDEVQARMKELTEEKKRSDVLLYRMLPKQVAEKLKLGQSVEPETFDCVTIFFSDVVSFTTLASRCTPLQVVNLLNDLYTTFDAIIEQHDVYKVETIGDGYLCVSGLPHRNGNEHAKEISSMSFSLLKAIKTFRVPHLPKERINIRVGLHTGPVVTGVVGMTMPRYCLFGDSVNTASRMESNGKPGRVHISTECMKFLTEVIGGYQTEPRGEVIVKGKGAVQTHWLLTDD 1043          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: CG34357 (gene:FBgn0085386 transcript:FBtr0474144)

HSP 1 Score: 609.372 bits (1570), Expect = 0.000e+0
Identity = 303/551 (54.99%), Postives = 405/551 (73.50%), Query Frame = 3
Query: 1098 AKYNGDFVHIKYLDLS-HASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYG-SENIYSAKDLLWTAPELLRVDHLRAN---------GSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELGGYHLELRGKVELKGKGIVDSYWLIGKDGFLKPLPVAPPADSEDNHGLASVLKPDVLESIKSQHDHQSNTNP 2717
            A+YNGD V +K ++++  A L++K +D L +   +R+EN+NP IG   D +  +MVF++C RGSL+D++    + LDW F+LSL+TDL+RGMRY+H S ++VH  L S NCVVD RWVLKITDYGL + YE  G      SAK+LLWTAPELLR   L  +         G+Q GD+YSF IIMQE++ R  P+ M++++ +EI+ KI+KPPPL RP V++  APP  I IM++ W+E  +MRP F  + ++ K LN G+K+N VD MF+M+EKYS +LEE +R RT++L+ E+KKTE L+ RMLP  VA+ L  G  V+PE F +VTIYFSDIVGFTTI+A  +P+QVVDLLNDLYT+FDATI+ Y+VYKVETIGDAYMV SGLP++    HA +IATMALDLL Q G F ++H+P +PL+LRIGLHTGPC  GVVGLTMPRYCLFGDTVNTASRMES+GS++RIH+S  T+  LD  GGY +E RG +++KGKG+++++WL+GK GF KPLP  PP    ++HGL   L  + +      +  +++TNP
Sbjct:  783 ARYNGDLVQLKEVNINGSAELRTKAMDLLVMAHGLRHENINPLIGWLSDPNRTAMVFDYCSRGSLQDVLIMDEIKLDWSFRLSLLTDLVRGMRYLHTSPLRVHGALTSRNCVVDARWVLKITDYGLNSFYESQGLPPRTRSAKELLWTAPELLRNMKLHQHHHQHGRIQLGTQLGDVYSFGIIMQEVVVRGEPYCMLSLSPEEIIVKIKKPPPLIRPSVSKGAAPPEAINIMRQCWAEQPDMRPDFNSVYERFKMLNHGRKVNFVDTMFQMLEKYSNNLEELIRERTEQLDIERKKTEQLLNRMLPSSVAEKLKMGLAVDPEEFSDVTIYFSDIVGFTTIAAHCSPVQVVDLLNDLYTIFDATINAYNVYKVETIGDAYMVVSGLPVKIP-DHAEQIATMALDLLHQSGRFNVKHLPGVPLQLRIGLHTGPCCAGVVGLTMPRYCLFGDTVNTASRMESTGSSWRIHMSQETRDRLDARGGYAIEPRGLIDIKGKGMMNTFWLLGKKGFDKPLPAPPPIG--ESHGLDESLIRNSITLKAQANKSRTSTNP 1330          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: CG34357 (gene:FBgn0085386 transcript:FBtr0335239)

HSP 1 Score: 608.986 bits (1569), Expect = 0.000e+0
Identity = 303/551 (54.99%), Postives = 405/551 (73.50%), Query Frame = 3
Query: 1098 AKYNGDFVHIKYLDLS-HASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYG-SENIYSAKDLLWTAPELLRVDHLRAN---------GSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELGGYHLELRGKVELKGKGIVDSYWLIGKDGFLKPLPVAPPADSEDNHGLASVLKPDVLESIKSQHDHQSNTNP 2717
            A+YNGD V +K ++++  A L++K +D L +   +R+EN+NP IG   D +  +MVF++C RGSL+D++    + LDW F+LSL+TDL+RGMRY+H S ++VH  L S NCVVD RWVLKITDYGL + YE  G      SAK+LLWTAPELLR   L  +         G+Q GD+YSF IIMQE++ R  P+ M++++ +EI+ KI+KPPPL RP V++  APP  I IM++ W+E  +MRP F  + ++ K LN G+K+N VD MF+M+EKYS +LEE +R RT++L+ E+KKTE L+ RMLP  VA+ L  G  V+PE F +VTIYFSDIVGFTTI+A  +P+QVVDLLNDLYT+FDATI+ Y+VYKVETIGDAYMV SGLP++    HA +IATMALDLL Q G F ++H+P +PL+LRIGLHTGPC  GVVGLTMPRYCLFGDTVNTASRMES+GS++RIH+S  T+  LD  GGY +E RG +++KGKG+++++WL+GK GF KPLP  PP    ++HGL   L  + +      +  +++TNP
Sbjct:  783 ARYNGDLVQLKEVNINGSAELRTKAMDLLVMAHGLRHENINPLIGWLSDPNRTAMVFDYCSRGSLQDVLIMDEIKLDWSFRLSLLTDLVRGMRYLHTSPLRVHGALTSRNCVVDARWVLKITDYGLNSFYESQGLPPRTRSAKELLWTAPELLRNMKLHQHHHQHGRIQLGTQLGDVYSFGIIMQEVVVRGEPYCMLSLSPEEIIVKIKKPPPLIRPSVSKGAAPPEAINIMRQCWAEQPDMRPDFNSVYERFKMLNHGRKVNFVDTMFQMLEKYSNNLEELIRERTEQLDIERKKTEQLLNRMLPSSVAEKLKMGLAVDPEEFSDVTIYFSDIVGFTTIAAHCSPVQVVDLLNDLYTIFDATINAYNVYKVETIGDAYMVVSGLPVKIP-DHAEQIATMALDLLHQSGRFNVKHLPGVPLQLRIGLHTGPCCAGVVGLTMPRYCLFGDTVNTASRMESTGSSWRIHMSQETRDRLDARGGYAIEPRGLIDIKGKGMMNTFWLLGKKGFDKPLPAPPPIG--ESHGLDESLIRNSITLKAQANKSRTSTNP 1330          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: CG34357 (gene:FBgn0085386 transcript:FBtr0303867)

HSP 1 Score: 608.986 bits (1569), Expect = 0.000e+0
Identity = 303/551 (54.99%), Postives = 405/551 (73.50%), Query Frame = 3
Query: 1098 AKYNGDFVHIKYLDLS-HASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYG-SENIYSAKDLLWTAPELLRVDHLRAN---------GSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELGGYHLELRGKVELKGKGIVDSYWLIGKDGFLKPLPVAPPADSEDNHGLASVLKPDVLESIKSQHDHQSNTNP 2717
            A+YNGD V +K ++++  A L++K +D L +   +R+EN+NP IG   D +  +MVF++C RGSL+D++    + LDW F+LSL+TDL+RGMRY+H S ++VH  L S NCVVD RWVLKITDYGL + YE  G      SAK+LLWTAPELLR   L  +         G+Q GD+YSF IIMQE++ R  P+ M++++ +EI+ KI+KPPPL RP V++  APP  I IM++ W+E  +MRP F  + ++ K LN G+K+N VD MF+M+EKYS +LEE +R RT++L+ E+KKTE L+ RMLP  VA+ L  G  V+PE F +VTIYFSDIVGFTTI+A  +P+QVVDLLNDLYT+FDATI+ Y+VYKVETIGDAYMV SGLP++    HA +IATMALDLL Q G F ++H+P +PL+LRIGLHTGPC  GVVGLTMPRYCLFGDTVNTASRMES+GS++RIH+S  T+  LD  GGY +E RG +++KGKG+++++WL+GK GF KPLP  PP    ++HGL   L  + +      +  +++TNP
Sbjct:  783 ARYNGDLVQLKEVNINGSAELRTKAMDLLVMAHGLRHENINPLIGWLSDPNRTAMVFDYCSRGSLQDVLIMDEIKLDWSFRLSLLTDLVRGMRYLHTSPLRVHGALTSRNCVVDARWVLKITDYGLNSFYESQGLPPRTRSAKELLWTAPELLRNMKLHQHHHQHGRIQLGTQLGDVYSFGIIMQEVVVRGEPYCMLSLSPEEIIVKIKKPPPLIRPSVSKGAAPPEAINIMRQCWAEQPDMRPDFNSVYERFKMLNHGRKVNFVDTMFQMLEKYSNNLEELIRERTEQLDIERKKTEQLLNRMLPSSVAEKLKMGLAVDPEEFSDVTIYFSDIVGFTTIAAHCSPVQVVDLLNDLYTIFDATINAYNVYKVETIGDAYMVVSGLPVKIP-DHAEQIATMALDLLHQSGRFNVKHLPGVPLQLRIGLHTGPCCAGVVGLTMPRYCLFGDTVNTASRMESTGSSWRIHMSQETRDRLDARGGYAIEPRGLIDIKGKGMMNTFWLLGKKGFDKPLPAPPPIG--ESHGLDESLIRNSITLKAQANKSRTSTNP 1330          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: CG42637 (gene:FBgn0261360 transcript:FBtr0302277)

HSP 1 Score: 483.797 bits (1244), Expect = 2.536e-149
Identity = 261/512 (50.98%), Postives = 353/512 (68.95%), Query Frame = 3
Query: 1092 NTAKYNGDFVHIKYLDLSHA-SLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGSENI---YSAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPP-----PLCRPQV---TQSEAPPAYI-QIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDEL-GGYHLELRGKVELKGKGIVDSYWLIGKD 2585
            +T +  G  V IK L       +  + +  +R++R++R++N+N  IG  ++ + I +V ++C +GSL DII+N+++ LD  F  SL+ DLI+GM YIH SQ+  H  LKSSNCVV  RW+L++TD+GL  + +   +E+I      ++ LW APELLR +H+  +GSQKGD+Y+F+IIM EI +R  PFG +N    EI++ ++K P     P  RP+V    ++E+ P Y+   ++  W+E+ E RP F  +  +LK +  GK  NI+D M +MMEKY+ +LE+ V  RT  L  E+ KTE L+ RMLP+ VA+ L  G+ VEP S+D VTIYFSDIVGFT +SA S P+QVV+ LNDLYT+FD  I  YDVYKVETIGDAYMV SGLPI+NG RHAGEIA+MAL+LL      +I H P+  L+LRIG+HTGP V GVVGLTMPRYCLFGDTVNTASRMES+G A +IH+S   K+ LD+L GGY  E RG V +KGKG V ++WL G +
Sbjct:  569 STGRLRGAVVRIKELKFPRKRDISREIMKEMRLLRELRHDNINSFIGASVEPTRILLVTDYCAKGSLYDIIENEDIKLDDLFIASLIHDLIKGMIYIHNSQLVYHGNLKSSNCVVTSRWMLQVTDFGLHELRQCAENESIGEHQHYRNQLWRAPELLR-NHI--HGSQKGDVYAFAIIMYEIFSRKGPFGQINFEPKEIVDYVKKLPLKGEDPF-RPEVESIIEAESCPDYVLACIRDCWAEDPEERPEFSVIRNRLKKMRGGKTKNIMDQMMEMMEKYANNLEDIVTERTRLLCEEKMKTEDLLHRMLPQSVAEKLTMGQGVEPVSYDLVTIYFSDIVGFTAMSAESTPLQVVNFLNDLYTVFDRIIRGYDVYKVETIGDAYMVVSGLPIKNGDRHAGEIASMALELLHAVKQHRIAHRPNETLKLRIGMHTGPVVAGVVGLTMPRYCLFGDTVNTASRMESNGEALKIHISNKCKLALDKLGGGYITEKRGLVNMKGKGDVVTWWLTGAN 1076          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: CG42637 (gene:FBgn0261360 transcript:FBtr0302279)

HSP 1 Score: 483.797 bits (1244), Expect = 2.536e-149
Identity = 261/512 (50.98%), Postives = 353/512 (68.95%), Query Frame = 3
Query: 1092 NTAKYNGDFVHIKYLDLSHA-SLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGSENI---YSAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPP-----PLCRPQV---TQSEAPPAYI-QIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDEL-GGYHLELRGKVELKGKGIVDSYWLIGKD 2585
            +T +  G  V IK L       +  + +  +R++R++R++N+N  IG  ++ + I +V ++C +GSL DII+N+++ LD  F  SL+ DLI+GM YIH SQ+  H  LKSSNCVV  RW+L++TD+GL  + +   +E+I      ++ LW APELLR +H+  +GSQKGD+Y+F+IIM EI +R  PFG +N    EI++ ++K P     P  RP+V    ++E+ P Y+   ++  W+E+ E RP F  +  +LK +  GK  NI+D M +MMEKY+ +LE+ V  RT  L  E+ KTE L+ RMLP+ VA+ L  G+ VEP S+D VTIYFSDIVGFT +SA S P+QVV+ LNDLYT+FD  I  YDVYKVETIGDAYMV SGLPI+NG RHAGEIA+MAL+LL      +I H P+  L+LRIG+HTGP V GVVGLTMPRYCLFGDTVNTASRMES+G A +IH+S   K+ LD+L GGY  E RG V +KGKG V ++WL G +
Sbjct:  569 STGRLRGAVVRIKELKFPRKRDISREIMKEMRLLRELRHDNINSFIGASVEPTRILLVTDYCAKGSLYDIIENEDIKLDDLFIASLIHDLIKGMIYIHNSQLVYHGNLKSSNCVVTSRWMLQVTDFGLHELRQCAENESIGEHQHYRNQLWRAPELLR-NHI--HGSQKGDVYAFAIIMYEIFSRKGPFGQINFEPKEIVDYVKKLPLKGEDPF-RPEVESIIEAESCPDYVLACIRDCWAEDPEERPEFSVIRNRLKKMRGGKTKNIMDQMMEMMEKYANNLEDIVTERTRLLCEEKMKTEDLLHRMLPQSVAEKLTMGQGVEPVSYDLVTIYFSDIVGFTAMSAESTPLQVVNFLNDLYTVFDRIIRGYDVYKVETIGDAYMVVSGLPIKNGDRHAGEIASMALELLHAVKQHRIAHRPNETLKLRIGMHTGPVVAGVVGLTMPRYCLFGDTVNTASRMESNGEALKIHISNKCKLALDKLGGGYITEKRGLVNMKGKGDVVTWWLTGAN 1076          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: gucy2d (guanylate cyclase 2D, retinal [Source:ZFIN;Acc:ZDB-GENE-011128-9])

HSP 1 Score: 595.89 bits (1535), Expect = 0.000e+0
Identity = 299/530 (56.42%), Postives = 395/530 (74.53%), Query Frame = 3
Query: 1092 NTAKYNGDFVHIKYLDLSHA------SLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGSENIY----SAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELG-GYHLELRGKVELKGKGIVDSYWLIGKDGFLKPLPVAPPADSEDNHGLA 2648
            N A + GD+V +K    + +      S ++ FV     +RD+R+EN+N  +G ++D     +V EHC RGSL+D++ N+ + LDW FK SL+ DLIRGM+Y+H   I +H RLKS NCVVDGR+VLK+TDYG     EI   +NI     + +D  WTAPE+LR   L+  G+  GD+YSFSIIMQE+I+R  PF M++M  +EI+ K+R PPPLCRP V+  EAP   IQ+MK+AWSE  E RP+FE++ +Q K +NKGKK NI+D M +M+E+YS++LE+ +R RT+ELE E++KT+ L+A+MLP+ VA +L  GKPV+PE F EVT+YFSDIVGFTTISALS P++VVDLLNDLYT FD  I  +DVYKVETIGDAYMVASG+P RNG RHA E+A M+LD+L   GTFK+RHMPD+ +++RIGLH+GP V GVVGL MPRYCLFGDTVNTASRMES+G  +RIHV+  T  VL+ L  GY ++ RG+ ELKGKG+ +++WL+G+DGF KPLP+ PP  +  NHG++
Sbjct:  579 NVAVFEGDWVWLKKCPCADSITEISESTQTIFVK----LRDMRHENLNLFLGLFMDTGIFGIVTEHCTRGSLEDLLNNEEMRLDWMFKSSLLLDLIRGMKYLHNRGI-IHGRLKSRNCVVDGRFVLKVTDYGFN---EILNCQNIILEDNAPEDQFWTAPEILRNPDLKKKGTYPGDVYSFSIIMQEVISRCAPFCMLDMPPEEIIEKVRSPPPLCRPTVSMDEAPLDVIQLMKQAWSEEPEQRPTFEDIFRQFKSMNKGKKTNIIDSMLRMLEQYSSNLEDLIRERTEELEVERQKTDALLAQMLPKSVALALKTGKPVKPEHFAEVTLYFSDIVGFTTISALSEPIEVVDLLNDLYTHFDGIIAIHDVYKVETIGDAYMVASGVPNRNGTRHAAEMANMSLDILHCIGTFKMRHMPDVKVKIRIGLHSGPVVAGVVGLKMPRYCLFGDTVNTASRMESTGLPYRIHVNQSTVDVLNSLKLGYKIDTRGRTELKGKGVEETFWLVGRDGFDKPLPI-PPDLTPGNHGIS 1099          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: gc2 (guanylyl cyclase 2 [Source:ZFIN;Acc:ZDB-GENE-011128-8])

HSP 1 Score: 594.734 bits (1532), Expect = 0.000e+0
Identity = 302/522 (57.85%), Postives = 384/522 (73.56%), Query Frame = 3
Query: 1092 NTAKYNGDFVHIKYLDL-SHASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGSENIYS-AKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELG-GYHLELRGKVELKGKGIVDSYWLIGKDGFLKPLPVAPPADS-EDNHGL 2645
            N A Y GD+  +K L   +  S+     D   +++D+R+EN+NP +G + D    ++V E C RGSL+D++ N +V LDW FK SL+ DLI+GM+Y+H   +  H RLKS NCVVDGR+VLKITDYG   V E      I   A+DLLWTAPE+LR  +   +G+  GD+YSFSIIMQE++ R  PF M+  T DEI+ K+RKPPP+CRP V+   AP   IQ+MK+ W+E  E RP+F+E+  Q K++NKGKK NI+D M +M+E+YS++LEE +R RT+ELE E++KTE L+ +MLP  VA++L  G  VEPE F+ V++YFSDIVGFTTISA S P++VVDLLNDLYT FDA I  +DVYKVETIGDAYMVASG+P+ NG RHA EIA MALD+LS  GTF++RHMPD+P+R+RIGLHTGPCV GVVGLTMPRYCLFGDTV TASRMES+G  +RIHV   T  +L EL  GY +ELR + ELKGK I ++YWL G+DGF KPLPV P   S +  HGL
Sbjct:  565 NVAIYEGDWAWMKRLPYGTFRSITPNTSDVFELMKDLRHENINPFLGFFHDCGVFAIVTEFCSRGSLEDLLVNDDVKLDWMFKSSLILDLIKGMKYLHHRNV-CHGRLKSRNCVVDGRFVLKITDYGYNEVLESQRFPYIEPPAEDLLWTAPEILRGSYPGLHGTHSGDVYSFSIIMQEVVMRGPPFCMLENTFDEIVQKVRKPPPMCRPIVSPDHAPMECIQLMKQCWNEQPEKRPTFDEIFDQFKNVNKGKKTNIIDSMLRMLEQYSSNLEELIRERTEELEIEKQKTEKLLTQMLPPSVAEALKLGTTVEPEHFESVSLYFSDIVGFTTISANSEPIEVVDLLNDLYTTFDAVIGNHDVYKVETIGDAYMVASGVPVPNGNRHAAEIANMALDILSAVGTFRMRHMPDVPVRIRIGLHTGPCVAGVVGLTMPRYCLFGDTVTTASRMESTGLPYRIHVHSSTVKILMELKLGYRVELRARTELKGKRIEETYWLTGRDGFTKPLPVPPVLKSGQMAHGL 1085          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: gc2 (guanylyl cyclase 2 [Source:ZFIN;Acc:ZDB-GENE-011128-8])

HSP 1 Score: 594.734 bits (1532), Expect = 0.000e+0
Identity = 302/522 (57.85%), Postives = 384/522 (73.56%), Query Frame = 3
Query: 1092 NTAKYNGDFVHIKYLDL-SHASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGSENIYS-AKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELG-GYHLELRGKVELKGKGIVDSYWLIGKDGFLKPLPVAPPADS-EDNHGL 2645
            N A Y GD+  +K L   +  S+     D   +++D+R+EN+NP +G + D    ++V E C RGSL+D++ N +V LDW FK SL+ DLI+GM+Y+H   +  H RLKS NCVVDGR+VLKITDYG   V E      I   A+DLLWTAPE+LR  +   +G+  GD+YSFSIIMQE++ R  PF M+  T DEI+ K+RKPPP+CRP V+   AP   IQ+MK+ W+E  E RP+F+E+  Q K++NKGKK NI+D M +M+E+YS++LEE +R RT+ELE E++KTE L+ +MLP  VA++L  G  VEPE F+ V++YFSDIVGFTTISA S P++VVDLLNDLYT FDA I  +DVYKVETIGDAYMVASG+P+ NG RHA EIA MALD+LS  GTF++RHMPD+P+R+RIGLHTGPCV GVVGLTMPRYCLFGDTV TASRMES+G  +RIHV   T  +L EL  GY +ELR + ELKGK I ++YWL G+DGF KPLPV P   S +  HGL
Sbjct:  565 NVAIYEGDWAWMKRLPYGTFRSITPNTSDVFELMKDLRHENINPFLGFFHDCGVFAIVTEFCSRGSLEDLLVNDDVKLDWMFKSSLILDLIKGMKYLHHRNV-CHGRLKSRNCVVDGRFVLKITDYGYNEVLESQRFPYIEPPAEDLLWTAPEILRGSYPGLHGTHSGDVYSFSIIMQEVVMRGPPFCMLENTFDEIVQKVRKPPPMCRPIVSPDHAPMECIQLMKQCWNEQPEKRPTFDEIFDQFKNVNKGKKTNIIDSMLRMLEQYSSNLEELIRERTEELEIEKQKTEKLLTQMLPPSVAEALKLGTTVEPEHFESVSLYFSDIVGFTTISANSEPIEVVDLLNDLYTTFDAVIGNHDVYKVETIGDAYMVASGVPVPNGNRHAAEIANMALDILSAVGTFRMRHMPDVPVRIRIGLHTGPCVAGVVGLTMPRYCLFGDTVTTASRMESTGLPYRIHVHSSTVKILMELKLGYRVELRARTELKGKRIEETYWLTGRDGFTKPLPVPPVLKSGQMAHGL 1085          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: gucy2d (guanylate cyclase 2D, retinal [Source:ZFIN;Acc:ZDB-GENE-011128-9])

HSP 1 Score: 593.578 bits (1529), Expect = 0.000e+0
Identity = 300/533 (56.29%), Postives = 395/533 (74.11%), Query Frame = 3
Query: 1092 NTAKYNGDFVHIKYLDLSHA------SLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGSENIY----SAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELG-GYHLELRGKVELKGKGIVDSYWLIGKDGFLKPLPVAP---PADSEDNHGLA 2648
            N A + GD+V +K    + +      S ++ FV     +RD+R+EN+N  +G ++D     +V EHC RGSL+D++ N+ + LDW FK SL+ DLIRGM+Y+H   I +H RLKS NCVVDGR+VLK+TDYG     EI   +NI     + +D  WTAPE+LR   L+  G+  GD+YSFSIIMQE+I+R  PF M++M  +EI+ K+R PPPLCRP V+  EAP   IQ+MK+AWSE  E RP+FE++ +Q K +NKGKK NI+D M +M+E+YS++LE+ +R RT+ELE E++KT+ L+A+MLP+ VA +L  GKPV+PE F EVT+YFSDIVGFTTISALS P++VVDLLNDLYT FD  I  +DVYKVETIGDAYMVASG+P RNG RHA E+A M+LD+L   GTFK+RHMPD+ +++RIGLH+GP V GVVGL MPRYCLFGDTVNTASRMES+G  +RIHV+  T  VL+ L  GY ++ RG+ ELKGKG+ +++WL+G+DGF KPLP+ P   P  S  NHG++
Sbjct:  592 NVAVFEGDWVWLKKCPCADSITEISESTQTIFVK----LRDMRHENLNLFLGLFMDTGIFGIVTEHCTRGSLEDLLNNEEMRLDWMFKSSLLLDLIRGMKYLHNRGI-IHGRLKSRNCVVDGRFVLKVTDYGFN---EILNCQNIILEDNAPEDQFWTAPEILRNPDLKKKGTYPGDVYSFSIIMQEVISRCAPFCMLDMPPEEIIEKVRSPPPLCRPTVSMDEAPLDVIQLMKQAWSEEPEQRPTFEDIFRQFKSMNKGKKTNIIDSMLRMLEQYSSNLEDLIRERTEELEVERQKTDALLAQMLPKSVALALKTGKPVKPEHFAEVTLYFSDIVGFTTISALSEPIEVVDLLNDLYTHFDGIIAIHDVYKVETIGDAYMVASGVPNRNGTRHAAEMANMSLDILHCIGTFKMRHMPDVKVKIRIGLHSGPVVAGVVGLKMPRYCLFGDTVNTASRMESTGLPYRIHVNQSTVDVLNSLKLGYKIDTRGRTELKGKGVEETFWLVGRDGFDKPLPIPPDLTPGAS--NHGIS 1114          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: gucy2d (guanylate cyclase 2D, retinal [Source:ZFIN;Acc:ZDB-GENE-011128-9])

HSP 1 Score: 593.578 bits (1529), Expect = 0.000e+0
Identity = 300/533 (56.29%), Postives = 395/533 (74.11%), Query Frame = 3
Query: 1092 NTAKYNGDFVHIKYLDLSHA------SLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGSENIY----SAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELG-GYHLELRGKVELKGKGIVDSYWLIGKDGFLKPLPVAP---PADSEDNHGLA 2648
            N A + GD+V +K    + +      S ++ FV     +RD+R+EN+N  +G ++D     +V EHC RGSL+D++ N+ + LDW FK SL+ DLIRGM+Y+H   I +H RLKS NCVVDGR+VLK+TDYG     EI   +NI     + +D  WTAPE+LR   L+  G+  GD+YSFSIIMQE+I+R  PF M++M  +EI+ K+R PPPLCRP V+  EAP   IQ+MK+AWSE  E RP+FE++ +Q K +NKGKK NI+D M +M+E+YS++LE+ +R RT+ELE E++KT+ L+A+MLP+ VA +L  GKPV+PE F EVT+YFSDIVGFTTISALS P++VVDLLNDLYT FD  I  +DVYKVETIGDAYMVASG+P RNG RHA E+A M+LD+L   GTFK+RHMPD+ +++RIGLH+GP V GVVGL MPRYCLFGDTVNTASRMES+G  +RIHV+  T  VL+ L  GY ++ RG+ ELKGKG+ +++WL+G+DGF KPLP+ P   P  S  NHG++
Sbjct:  594 NVAVFEGDWVWLKKCPCADSITEISESTQTIFVK----LRDMRHENLNLFLGLFMDTGIFGIVTEHCTRGSLEDLLNNEEMRLDWMFKSSLLLDLIRGMKYLHNRGI-IHGRLKSRNCVVDGRFVLKVTDYGFN---EILNCQNIILEDNAPEDQFWTAPEILRNPDLKKKGTYPGDVYSFSIIMQEVISRCAPFCMLDMPPEEIIEKVRSPPPLCRPTVSMDEAPLDVIQLMKQAWSEEPEQRPTFEDIFRQFKSMNKGKKTNIIDSMLRMLEQYSSNLEDLIRERTEELEVERQKTDALLAQMLPKSVALALKTGKPVKPEHFAEVTLYFSDIVGFTTISALSEPIEVVDLLNDLYTHFDGIIAIHDVYKVETIGDAYMVASGVPNRNGTRHAAEMANMSLDILHCIGTFKMRHMPDVKVKIRIGLHSGPVVAGVVGLKMPRYCLFGDTVNTASRMESTGLPYRIHVNQSTVDVLNSLKLGYKIDTRGRTELKGKGVEETFWLVGRDGFDKPLPIPPDLTPGAS--NHGIS 1116          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: slc8a3 (solute carrier family 8 (sodium/calcium exchanger), member 3 [Source:Xenbase;Acc:XB-GENE-954537])

HSP 1 Score: 606.29 bits (1562), Expect = 0.000e+0
Identity = 300/528 (56.82%), Postives = 399/528 (75.57%), Query Frame = 3
Query: 1092 NTAKYNGDFVHIK-YLDLSHASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGSENIYSAK----DLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELG-GYHLELRGKVELKGKGIVDSYWLIGKDGFLKPLPVAP---PADSEDNHGLA 2648
            N   + GD+V +K +    H  L+    +    +R++R+EN+N  +G + DI  I +V EHC RGSL+D+IQN+++ LDW FK SL+ DLI+G++++H  ++  H RLKS NCVVDGR+VLK+TD+G+    E+Y ++ + S +    DL WTAPELLR   L   G+ +GDIYSF+IIMQE+I R  P+ M+ +TADEI+ K+ +PPPLCRP V+  +APP  IQ+MK  WSE  E RP+ +++  Q K++N+G+K NI+D M +M+E+YS++LE+ +R RT+ELE E++KT+ L+ +MLP  VA++L  G PVEPE FDEVTIYFSDIVGFTTIS+LS+P++VVDLLNDLYT+FDA I  +DVYKVETIGDAYMVASGLP  NG RHA EIA M+LD+LS  G+FK+RHMPD+P+R+RIGLH+GPCV GVVGLTMPRYCLFGDTVNTASRMES+G  +R+HV+  T  +L  L  GY  E+RGK ELKGKG+ D+YWL+GK+GF KPLP  P   P  S  NHG++
Sbjct:  536 NIGVFEGDWVWLKKFPGEKHGDLRPATKNVFCKLRELRHENINLYLGLFDDIGVIGVVSEHCSRGSLEDLIQNQDMKLDWMFKSSLLLDLIKGLKFLHHRELP-HGRLKSRNCVVDGRFVLKLTDFGM---NELYDAQRLPSTQLQPEDLFWTAPELLRDATLCQRGTYRGDIYSFAIIMQEVIVRGPPYCMLEVTADEIIRKVLRPPPLCRPSVSLDQAPPECIQLMKLCWSEQPERRPTIDQIFDQFKNINRGRKTNIIDSMLRMLEQYSSNLEDLIRERTEELEVEKQKTDKLLTQMLPPSVAEALKTGTPVEPEYFDEVTIYFSDIVGFTTISSLSDPIEVVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPKTNGNRHAAEIANMSLDILSSVGSFKMRHMPDVPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRVHVNLSTVTILHSLKEGYRFEVRGKTELKGKGVEDTYWLVGKEGFTKPLPTPPDVLPGGS--NHGIS 1057          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: ENSXETT00000002786.1 (retinal guanylyl cyclase 2-like [Source:NCBI gene;Acc:100489435])

HSP 1 Score: 605.52 bits (1560), Expect = 0.000e+0
Identity = 306/534 (57.30%), Postives = 399/534 (74.72%), Query Frame = 3
Query: 1029 KSLQMM*KSFSSGSLEGILDPNT-AKYNGDFVHIKYLDLS-HASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGSENIYS--AKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELGG-YHLELRGKVELKGKGIVDSYWLIGKDGFLKPLPVAP 2615
            KSL+ + +S S+ SL    + ++ A Y GD+V +K  +   +  L+      LR ++D+RNENVNP +G + D    ++V EHC RGSL+D+++N++V LDW FK SL+ DLI+GMRY+H      H RLKS NCVVDGR+VLKITDYG   V E   S   YS   ++L WTAPELLR   L   G+ KGD++SF+II+QE++ R  P+    ++A+EI+ K++KPPPLCRP V   +AP   IQ+MK+ WSE AE RP+F+E+  Q K +NKGKK NI+D M +M+E+YS++LE+ +R RT+ELE E++KTE L+++MLP  VA++L  G  VEPE FD VTIYFSDIVGFTTISALS P++VVDLLNDLYT+FDA +  +DVYKVETIGDAYMVASGLP RNG RH  EIA M+LD+LS  G+F++RHMPD+P+R+RIGLH+GPCV GVVGLTMPRYCLFGDTVNTASRMES+G  +RIHV+  T  +L  L   Y +ELRGK ELKGKG+ +++WL+GK+GF KPLP  P
Sbjct:  543 KSLKSLTRSLSAKSLGASHETSSVAIYEGDWVWLKKFEPGVYHELRQSTTSTLRKMKDLRNENVNPFLGFFSDCGIFAIVTEHCSRGSLEDLLRNEDVKLDWMFKSSLLLDLIKGMRYLHHRDFS-HGRLKSRNCVVDGRFVLKITDYGYNEVVETQKSPR-YSMPPEELFWTAPELLRDQALSRRGTFKGDVFSFAIILQEVVVRGPPYCTSGLSAEEIIRKVKKPPPLCRPAVAPDQAPLECIQLMKQCWSELAERRPTFDEIFDQFKTINKGKKTNIIDSMLRMLEQYSSNLEDLIRERTEELEVEKQKTEKLLSQMLPPSVAEALKTGGTVEPEYFDHVTIYFSDIVGFTTISALSEPIEVVDLLNDLYTLFDAVLCNHDVYKVETIGDAYMVASGLPKRNGNRHTAEIANMSLDILSSVGSFQMRHMPDVPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNQSTAAILRTLNERYKIELRGKTELKGKGVEETFWLVGKEGFSKPLPRPP 1074          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: ENSXETT00000002946.1 (retinal guanylyl cyclase 2-like [Source:NCBI gene;Acc:100489435])

HSP 1 Score: 605.134 bits (1559), Expect = 0.000e+0
Identity = 306/534 (57.30%), Postives = 399/534 (74.72%), Query Frame = 3
Query: 1029 KSLQMM*KSFSSGSLEGILDPNT-AKYNGDFVHIKYLDLS-HASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGSENIYS--AKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELGG-YHLELRGKVELKGKGIVDSYWLIGKDGFLKPLPVAP 2615
            KSL+ + +S S+ SL    + ++ A Y GD+V +K  +   +  L+      LR ++D+RNENVNP +G + D    ++V EHC RGSL+D+++N++V LDW FK SL+ DLI+GMRY+H      H RLKS NCVVDGR+VLKITDYG   V E   S   YS   ++L WTAPELLR   L   G+ KGD++SF+II+QE++ R  P+    ++A+EI+ K++KPPPLCRP V   +AP   IQ+MK+ WSE AE RP+F+E+  Q K +NKGKK NI+D M +M+E+YS++LE+ +R RT+ELE E++KTE L+++MLP  VA++L  G  VEPE FD VTIYFSDIVGFTTISALS P++VVDLLNDLYT+FDA +  +DVYKVETIGDAYMVASGLP RNG RH  EIA M+LD+LS  G+F++RHMPD+P+R+RIGLH+GPCV GVVGLTMPRYCLFGDTVNTASRMES+G  +RIHV+  T  +L  L   Y +ELRGK ELKGKG+ +++WL+GK+GF KPLP  P
Sbjct:  543 KSLKSLTRSLSAKSLGASHETSSVAIYEGDWVWLKKFEPGVYHELRQSTTSTLRKMKDLRNENVNPFLGFFSDCGIFAIVTEHCSRGSLEDLLRNEDVKLDWMFKSSLLLDLIKGMRYLHHRDFS-HGRLKSRNCVVDGRFVLKITDYGYNEVVETQKSPR-YSMPPEELFWTAPELLRDQALSRRGTFKGDVFSFAIILQEVVVRGPPYCTSGLSAEEIIRKVKKPPPLCRPAVAPDQAPLECIQLMKQCWSELAERRPTFDEIFDQFKTINKGKKTNIIDSMLRMLEQYSSNLEDLIRERTEELEVEKQKTEKLLSQMLPPSVAEALKTGGTVEPEYFDHVTIYFSDIVGFTTISALSEPIEVVDLLNDLYTLFDAVLCNHDVYKVETIGDAYMVASGLPKRNGNRHTAEIANMSLDILSSVGSFQMRHMPDVPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNQSTAAILRTLNERYKIELRGKTELKGKGVEETFWLVGKEGFSKPLPRPP 1074          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: ENSXETT00000002882.1 (retinal guanylyl cyclase 2-like [Source:NCBI gene;Acc:100489435])

HSP 1 Score: 604.749 bits (1558), Expect = 0.000e+0
Identity = 306/534 (57.30%), Postives = 399/534 (74.72%), Query Frame = 3
Query: 1029 KSLQMM*KSFSSGSLEGILDPNT-AKYNGDFVHIKYLDLS-HASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGSENIYS--AKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELGG-YHLELRGKVELKGKGIVDSYWLIGKDGFLKPLPVAP 2615
            KSL+ + +S S+ SL    + ++ A Y GD+V +K  +   +  L+      LR ++D+RNENVNP +G + D    ++V EHC RGSL+D+++N++V LDW FK SL+ DLI+GMRY+H      H RLKS NCVVDGR+VLKITDYG   V E   S   YS   ++L WTAPELLR   L   G+ KGD++SF+II+QE++ R  P+    ++A+EI+ K++KPPPLCRP V   +AP   IQ+MK+ WSE AE RP+F+E+  Q K +NKGKK NI+D M +M+E+YS++LE+ +R RT+ELE E++KTE L+++MLP  VA++L  G  VEPE FD VTIYFSDIVGFTTISALS P++VVDLLNDLYT+FDA +  +DVYKVETIGDAYMVASGLP RNG RH  EIA M+LD+LS  G+F++RHMPD+P+R+RIGLH+GPCV GVVGLTMPRYCLFGDTVNTASRMES+G  +RIHV+  T  +L  L   Y +ELRGK ELKGKG+ +++WL+GK+GF KPLP  P
Sbjct:  543 KSLKSLTRSLSAKSLGASHETSSVAIYEGDWVWLKKFEPGVYHELRQSTTSTLRKMKDLRNENVNPFLGFFSDCGIFAIVTEHCSRGSLEDLLRNEDVKLDWMFKSSLLLDLIKGMRYLHHRDFS-HGRLKSRNCVVDGRFVLKITDYGYNEVVETQKSPR-YSMPPEELFWTAPELLRDQALSRRGTFKGDVFSFAIILQEVVVRGPPYCTSGLSAEEIIRKVKKPPPLCRPAVAPDQAPLECIQLMKQCWSELAERRPTFDEIFDQFKTINKGKKTNIIDSMLRMLEQYSSNLEDLIRERTEELEVEKQKTEKLLSQMLPPSVAEALKTGGTVEPEYFDHVTIYFSDIVGFTTISALSEPIEVVDLLNDLYTLFDAVLCNHDVYKVETIGDAYMVASGLPKRNGNRHTAEIANMSLDILSSVGSFQMRHMPDVPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNQSTAAILRTLNERYKIELRGKTELKGKGVEETFWLVGKEGFSKPLPRPP 1074          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: slc8a3 (solute carrier family 8 (sodium/calcium exchanger), member 3 [Source:Xenbase;Acc:XB-GENE-954537])

HSP 1 Score: 604.749 bits (1558), Expect = 0.000e+0
Identity = 300/530 (56.60%), Postives = 397/530 (74.91%), Query Frame = 3
Query: 1092 NTAKYNGDFVHIK-YLDLSHASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGSENIYSAK----DLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELG-GYHLELRGKVELKGKGIVDSYWLIGKDGFLKPLPVAP---PADSEDNHGLASV 2654
            N   + GD+V +K +    H  L+    +    +R++R+EN+N  +G + DI  I +V EHC RGSL+D+IQN+++ LDW FK SL+ DLI+G++++H  ++  H RLKS NCVVDGR+VLK+TD+G+    E+Y ++ + S +    DL WTAPELLR   L   G+ +GDIYSF+IIMQE+I R  P+ M+ +TADEI+ K+ +PPPLCRP V+  +APP  IQ+MK  WSE  E RP+ +++  Q K++N+G+K NI+D M +M+E+YS++LE+ +R RT+ELE E++KT+ L+ +MLP  VA++L  G PVEPE FDEVTIYFSDIVGFTTIS+LS+P++VVDLLNDLYT+FDA I  +DVYKVETIGDAYMVASGLP  NG RHA EIA M+LD+LS  G+FK+RHMPD+P+R+RIGLH+GPCV GVVGLTMPRYCLFGDTVNTASRMES+G  +R+HV+  T  +L  L  GY  E+RGK ELKGKG+ D+YWL+GK+GF KPLP  P   P       GL SV
Sbjct:  519 NIGVFEGDWVWLKKFPGEKHGDLRPATKNVFCKLRELRHENINLYLGLFDDIGVIGVVSEHCSRGSLEDLIQNQDMKLDWMFKSSLLLDLIKGLKFLHHRELP-HGRLKSRNCVVDGRFVLKLTDFGM---NELYDAQRLPSTQLQPEDLFWTAPELLRDATLCQRGTYRGDIYSFAIIMQEVIVRGPPYCMLEVTADEIIRKVLRPPPLCRPSVSLDQAPPECIQLMKLCWSEQPERRPTIDQIFDQFKNINRGRKTNIIDSMLRMLEQYSSNLEDLIRERTEELEVEKQKTDKLLTQMLPPSVAEALKTGTPVEPEYFDEVTIYFSDIVGFTTISSLSDPIEVVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPKTNGNRHAAEIANMSLDILSSVGSFKMRHMPDVPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRVHVNLSTVTILHSLKEGYRFEVRGKTELKGKGVEDTYWLVGKEGFTKPLPTPPDVLPGAVSPFLGLISV 1044          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Gucy2f (guanylate cyclase 2f [Source:MGI Symbol;Acc:MGI:105119])

HSP 1 Score: 593.578 bits (1529), Expect = 0.000e+0
Identity = 310/541 (57.30%), Postives = 397/541 (73.38%), Query Frame = 3
Query: 1053 SFSSGSLEGIL--DPNTAKYNGDFVHIKYL---DLSH-ASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIY-GSENIYSAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELG-GYHLELRGKVELKGKGIVDSYWLIGKDGFLKPLPVAPPA--DSEDNHGL 2645
            SFSSGSL      + N A Y GD+V +K     D     S+KS   D   +++D+R+ENVNP +G + D    ++V E C R SL+DI+ N +V LDW FK SL+ DLI+GM+Y+H  +  +H RLKS NCVVDGR+VLK+TDYG   + E+   SE   S ++LLWTAPELLR       GS  GD+YSF+IIMQE++ R  PF MM++ A EI+++++ PPP+ RP V+   AP   +Q+MK+ W+E +E RP+F+E+  Q K  NKGKK NI+D M +M+E+YS++LE+ +R RT+ELE E++KTE L+ +MLP  VA+SL  G  VEPE FD VT+YFSDIVGFTTISA+S P++VVDLLNDLYT+FDA I  +DVYKVETIGDAYMVASGLP RNG RHA EIA M+LD+LS  GTFK+RHMP++P+R+RIGLH+GP V GVVGLTMPRYCLFGDTVNTASRMES+G  +RIHVS  T  +L  L  GY +ELRG+ ELKGKG  +++WL+GK GF KPLPV PP   D +  HGL
Sbjct:  547 SFSSGSLTPATYENSNIAIYEGDWVWLKKFPPGDFGDIKSIKSSASDVFEMMKDLRHENVNPLLGFFYDSGMFAIVSEFCSRRSLEDILTNDDVKLDWMFKSSLLLDLIKGMKYLHHREF-IHGRLKSRNCVVDGRFVLKVTDYGFNDILEMLRLSEEEPSEEELLWTAPELLRAPGGIRLGSFAGDVYSFAIIMQEVMVRGAPFCMMDLPAKEIIDRLKMPPPVYRPVVSPEYAPAECLQLMKQCWAEASEQRPTFDEIFNQFKTFNKGKKTNIIDSMLRMLEQYSSNLEDLIRERTEELEIEKQKTEKLLTQMLPLSVAESLKKGCTVEPEGFDLVTLYFSDIVGFTTISAMSEPIEVVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPKRNGSRHAAEIANMSLDILSSVGTFKMRHMPEVPVRIRIGLHSGPVVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVSLSTVTILQTLSEGYEVELRGRTELKGKGTEETFWLVGKKGFTKPLPVPPPVGKDGQVGHGL 1086          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Gucy2e (guanylate cyclase 2e [Source:MGI Symbol;Acc:MGI:105123])

HSP 1 Score: 565.459 bits (1456), Expect = 0.000e+0
Identity = 283/538 (52.60%), Postives = 387/538 (71.93%), Query Frame = 3
Query: 1092 NTAKYNGDFVHIK-YLDLSHASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISS----------ISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGSENIY----SAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDEL-GGYHLELRGKVELKGKGIVDSYWLIGKDGFLKPLPVAP---PADSEDNHGLA 2648
            N   Y GD+V +K +    H +++         +R++R+ENV   +G +L  ++          +++V EHC RGSL D++  + + LDW FK SL+ DLI+GMRY+H   +  H RLKS NCVVDGR+VLK+TD+G   + E   ++ +     SA+D LWTAPELLR   L   G+  GD++S +IIMQE++ R  P+ M+ +T +E++ ++R PPPLCRP V+  +AP   IQ+M + W+E+ E+RPS +      K +NKG+K NI+D M +M+E+YS++LE+ +R RT+ELE E++KT+ L+ +MLP  VA++L  G  VEPE F+EVT+YFSDIVGFTTISA+S P++VVDLLNDLYT+FDA I  +DVYKVETIGDAYMVASGLP RNG+RHA EIA M+LD+LS  G+F++RHMP++P+R+RIGLH+GPCV GVVGLTMPRYCLFGDTVNTASRMES+G  +RIHV+  T  +L  L  G+ +E RG+ ELKGKGI D+YWL+G+ GF KP+P  P   P  S  NHG++
Sbjct:  554 NVGLYEGDWVWLKKFPGEHHMAIRPATKTAFSKLRELRHENVALYLGLFLAGTADSPATPGEGILAVVSEHCARGSLHDLLAQREIKLDWMFKSSLLLDLIKGMRYLHHRGV-AHGRLKSRNCVVDGRFVLKVTDHGHGRLLE---AQRVLPEPPSAEDQLWTAPELLRDPSLERRGTLAGDVFSLAIIMQEVVCRSTPYAMLELTPEEVIQRVRSPPPLCRPLVSMDQAPMECIQLMTQCWAEHPELRPSMDLTFDLFKSINKGRKTNIIDSMLRMLEQYSSNLEDLIRERTEELEQEKQKTDRLLTQMLPPSVAEALKMGTSVEPEYFEEVTLYFSDIVGFTTISAMSEPIEVVDLLNDLYTLFDAIIGAHDVYKVETIGDAYMVASGLPQRNGQRHAAEIANMSLDILSAVGSFRMRHMPEVPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNMSTVRILRALDQGFQMECRGRTELKGKGIEDTYWLVGRLGFNKPIPKPPDLQPGAS--NHGIS 1085          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Gucy2e (guanylate cyclase 2e [Source:MGI Symbol;Acc:MGI:105123])

HSP 1 Score: 565.459 bits (1456), Expect = 0.000e+0
Identity = 283/538 (52.60%), Postives = 387/538 (71.93%), Query Frame = 3
Query: 1092 NTAKYNGDFVHIK-YLDLSHASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISS----------ISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGSENIY----SAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDEL-GGYHLELRGKVELKGKGIVDSYWLIGKDGFLKPLPVAP---PADSEDNHGLA 2648
            N   Y GD+V +K +    H +++         +R++R+ENV   +G +L  ++          +++V EHC RGSL D++  + + LDW FK SL+ DLI+GMRY+H   +  H RLKS NCVVDGR+VLK+TD+G   + E   ++ +     SA+D LWTAPELLR   L   G+  GD++S +IIMQE++ R  P+ M+ +T +E++ ++R PPPLCRP V+  +AP   IQ+M + W+E+ E+RPS +      K +NKG+K NI+D M +M+E+YS++LE+ +R RT+ELE E++KT+ L+ +MLP  VA++L  G  VEPE F+EVT+YFSDIVGFTTISA+S P++VVDLLNDLYT+FDA I  +DVYKVETIGDAYMVASGLP RNG+RHA EIA M+LD+LS  G+F++RHMP++P+R+RIGLH+GPCV GVVGLTMPRYCLFGDTVNTASRMES+G  +RIHV+  T  +L  L  G+ +E RG+ ELKGKGI D+YWL+G+ GF KP+P  P   P  S  NHG++
Sbjct:  554 NVGLYEGDWVWLKKFPGEHHMAIRPATKTAFSKLRELRHENVALYLGLFLAGTADSPATPGEGILAVVSEHCARGSLHDLLAQREIKLDWMFKSSLLLDLIKGMRYLHHRGV-AHGRLKSRNCVVDGRFVLKVTDHGHGRLLE---AQRVLPEPPSAEDQLWTAPELLRDPSLERRGTLAGDVFSLAIIMQEVVCRSTPYAMLELTPEEVIQRVRSPPPLCRPLVSMDQAPMECIQLMTQCWAEHPELRPSMDLTFDLFKSINKGRKTNIIDSMLRMLEQYSSNLEDLIRERTEELEQEKQKTDRLLTQMLPPSVAEALKMGTSVEPEYFEEVTLYFSDIVGFTTISAMSEPIEVVDLLNDLYTLFDAIIGAHDVYKVETIGDAYMVASGLPQRNGQRHAAEIANMSLDILSAVGSFRMRHMPEVPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNMSTVRILRALDQGFQMECRGRTELKGKGIEDTYWLVGRLGFNKPIPKPPDLQPGAS--NHGIS 1085          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Gucy2e (guanylate cyclase 2e [Source:MGI Symbol;Acc:MGI:105123])

HSP 1 Score: 565.459 bits (1456), Expect = 0.000e+0
Identity = 283/538 (52.60%), Postives = 387/538 (71.93%), Query Frame = 3
Query: 1092 NTAKYNGDFVHIK-YLDLSHASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISS----------ISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGSENIY----SAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDEL-GGYHLELRGKVELKGKGIVDSYWLIGKDGFLKPLPVAP---PADSEDNHGLA 2648
            N   Y GD+V +K +    H +++         +R++R+ENV   +G +L  ++          +++V EHC RGSL D++  + + LDW FK SL+ DLI+GMRY+H   +  H RLKS NCVVDGR+VLK+TD+G   + E   ++ +     SA+D LWTAPELLR   L   G+  GD++S +IIMQE++ R  P+ M+ +T +E++ ++R PPPLCRP V+  +AP   IQ+M + W+E+ E+RPS +      K +NKG+K NI+D M +M+E+YS++LE+ +R RT+ELE E++KT+ L+ +MLP  VA++L  G  VEPE F+EVT+YFSDIVGFTTISA+S P++VVDLLNDLYT+FDA I  +DVYKVETIGDAYMVASGLP RNG+RHA EIA M+LD+LS  G+F++RHMP++P+R+RIGLH+GPCV GVVGLTMPRYCLFGDTVNTASRMES+G  +RIHV+  T  +L  L  G+ +E RG+ ELKGKGI D+YWL+G+ GF KP+P  P   P  S  NHG++
Sbjct:  554 NVGLYEGDWVWLKKFPGEHHMAIRPATKTAFSKLRELRHENVALYLGLFLAGTADSPATPGEGILAVVSEHCARGSLHDLLAQREIKLDWMFKSSLLLDLIKGMRYLHHRGV-AHGRLKSRNCVVDGRFVLKVTDHGHGRLLE---AQRVLPEPPSAEDQLWTAPELLRDPSLERRGTLAGDVFSLAIIMQEVVCRSTPYAMLELTPEEVIQRVRSPPPLCRPLVSMDQAPMECIQLMTQCWAEHPELRPSMDLTFDLFKSINKGRKTNIIDSMLRMLEQYSSNLEDLIRERTEELEQEKQKTDRLLTQMLPPSVAEALKMGTSVEPEYFEEVTLYFSDIVGFTTISAMSEPIEVVDLLNDLYTLFDAIIGAHDVYKVETIGDAYMVASGLPQRNGQRHAAEIANMSLDILSAVGSFRMRHMPEVPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNMSTVRILRALDQGFQMECRGRTELKGKGIEDTYWLVGRLGFNKPIPKPPDLQPGAS--NHGIS 1085          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Gucy2d (guanylate cyclase 2d [Source:MGI Symbol;Acc:MGI:106030])

HSP 1 Score: 556.599 bits (1433), Expect = 1.986e-180
Identity = 286/521 (54.89%), Postives = 376/521 (72.17%), Query Frame = 3
Query: 1059 SSGSLEGILD-PNTAKYNGDFVHIKYLDLSHAS-LKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGSENIYSA-KDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELG-GYHLELRGKVELKGKGIVDSYWLIGKDGFLKPLPV 2609
            S+ SL   L+  N A Y G++V +K  +   A  L+   +  LR +R++R+ENV   +G ++     +MV EHC RGSL+D++QN+N+ LDW FK SL+ DLIRG+RY+H  +   H RLKS NCVVD R+VLKITD+G     E + S     A ++LLWTAPELLR        + KGD++S +II+QE++TRD P+    ++A+EI+ K+  PPPLCRP V+  + P   IQ+M+  W E  + RPS +++  Q K +N+GKK ++VD M +M+EKYS  LE+ V+ RT+ELE E++KTE L+++MLP  VA +L  G  VEPE FD+VTIYFSDIVGFTTISALS P++VV  LNDLYT+FDA +D +DVYKVETIGDAYMVASGLP RNG RHA EIA +ALD+LS  G F++RH PD+P+R+R GLH+GPCV GVVGLTMPRYCLFGDTVNTASRMES+G  +RIHVS  T   L  L  GY +++RG+ ELKGKG+ ++YWL GK GF +PLP 
Sbjct:  558 SARSLPAFLEHTNVALYQGEWVWLKKFEAGVAPDLRPSSLSFLRKLREMRHENVTAFLGLFVGPGVSAMVLEHCARGSLEDLLQNENLRLDWTFKASLLLDLIRGLRYLHHRRFP-HGRLKSRNCVVDTRFVLKITDHGYAEFLESHCSSRPQPAPEELLWTAPELLRGP---GKATFKGDVFSLAIILQEVLTRDPPYCSWGLSAEEIIRKVASPPPLCRPLVSPDQGPLECIQLMQLCWEEAPDDRPSLDQIYTQFKSINQGKKTSVVDSMLRMLEKYSESLEDLVQERTEELELERRKTERLLSQMLPPSVAHALKMGTTVEPEYFDQVTIYFSDIVGFTTISALSEPIEVVGFLNDLYTLFDAVLDSHDVYKVETIGDAYMVASGLPRRNGNRHAAEIANLALDILSYAGNFRMRHAPDVPIRVRAGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVSQSTVQALLSLDEGYKIDVRGQTELKGKGLEETYWLTGKVGFCRPLPT 1074          
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Match: sp|P51842|GUC2F_RAT (Retinal guanylyl cyclase 2 OS=Rattus norvegicus OX=10116 GN=Gucy2f PE=1 SV=1)

HSP 1 Score: 597.43 bits (1539), Expect = 0.000e+0
Identity = 311/543 (57.27%), Postives = 400/543 (73.66%), Query Frame = 3
Query: 1053 SFSSGSLEGIL--DPNTAKYNGDFVHIK------YLDLSHASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIY-GSENIYSAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELG-GYHLELRGKVELKGKGIVDSYWLIGKDGFLKPLPVAPPA--DSEDNHGL 2645
            SFSSGSL      + N A Y GD+V +K      + D+   S+KS   D   +++D+R+ENVNP +G + D    ++V E C R SL+DI+   +V LDW FK SL+ DLI+GM+Y+H  +  +H RLKS NCVVDGR+VLK+TDYG   + E+   SE   S ++LLWTAPELLR       GS  GD+YSF+IIMQE++ R  PF MM+++A E++++++ PPP+ RP V+   APP  +Q+MK+ W+E AE RP+F+E+  Q K  NKGKK NI+D M +M+E+YS++LE+ +R RT+ELE E++KTE L+ +MLP  VA+SL  G  VEPE FD VT+YFSDIVGFTTISA+S P++VVDLLNDLYT+FDA I  +DVYKVETIGDAYMVASGLP RNG RHA EIA M+LD+LS  GTFK+RHMP++P+R+RIGLHTGP V GVVGLTMPRYCLFGDTVNTASRMES+G  +RIHVS  T  +L  L  GY +ELRG+ ELKGKG  +++WL+GK GF KPLPV PP   D +  HGL
Sbjct:  547 SFSSGSLTPATYENSNIAIYQGDWVWLKKFPPGDFGDIK--SIKSSASDVFEMMKDLRHENVNPLLGFFYDSGMFAIVSEFCSRRSLEDILTQDDVKLDWMFKSSLLLDLIKGMKYLHHREF-IHGRLKSRNCVVDGRFVLKVTDYGFNNILEMLRLSEEEPSEEELLWTAPELLRAPGGIRLGSFAGDVYSFAIIMQEVMVRGAPFCMMDLSAKEVIDRLKMPPPVYRPVVSPEFAPPECLQLMKQCWAEAAEQRPTFDEIFNQFKTFNKGKKTNIIDSMLRMLEQYSSNLEDLIRERTEELEIEKQKTEKLLTQMLPPSVAESLKKGCTVEPEGFDLVTLYFSDIVGFTTISAMSEPIEVVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPKRNGSRHAAEIANMSLDILSSVGTFKMRHMPEVPVRIRIGLHTGPVVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVSLSTVTILRTLSEGYEVELRGRTELKGKGTEETFWLVGKKGFTKPLPVPPPVGKDGQVGHGL 1086          
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Match: sp|P51841|GUC2F_HUMAN (Retinal guanylyl cyclase 2 OS=Homo sapiens OX=9606 GN=GUCY2F PE=1 SV=2)

HSP 1 Score: 596.66 bits (1537), Expect = 0.000e+0
Identity = 317/544 (58.27%), Postives = 403/544 (74.08%), Query Frame = 3
Query: 1053 SFSSGSLEGIL--DPNTAKYNGDFVHIKYLDLSH----ASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIY-GSENIYSAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELG-GYHLELRGKVELKGKGIVDSYWLIGKDGFLKPLPVAPPADSEDN--HGLASV 2654
            SFSSGSL      + N A Y GD+V +K   L       S+KS+  D   +++D+R+EN+NP +G + D    ++V E C RGSL+DI+ N++V LDW FK SL+ DLI+GM+Y+H  +  VH RLKS NCVVDGR+VLK+TDYG   + E+   SE   S ++LLWTAPELLR       GS  GD+YSF+IIMQE++ R  PF MM++ A EI+N+++KPPP+ RP V    APP  +Q+MK+ W+E AE RP+F+E+  Q K  NKGKK NI+D M +M+E+YS++LE+ +R RT+ELE E++KTE L+ +MLP  VA+SL  G  VEPE FD VT+YFSDIVGFTTISA+S P++VVDLLNDLYT+FDA I  +DVYKVETIGDAYMVASGLP RNG RHA EIA M+LD+LS  GTFK+RHMP++P+R+RIGLH+GP V GVVGLTMPRYCLFGDTVNTASRMES+G  +RIHVS  T  +L  L  GY +ELRG+ ELKGKG  +++WLIGK GF+KPLPV PP D +    HGL  V
Sbjct:  547 SFSSGSLTPATYENSNIAIYEGDWVWLKKFSLGDFGDLKSIKSRASDVFEMMKDLRHENINPLLGFFYDSGMFAIVTEFCSRGSLEDILTNQDVKLDWMFKSSLLLDLIKGMKYLHHREF-VHGRLKSRNCVVDGRFVLKVTDYGFNDILEMLRLSEEESSMEELLWTAPELLRAPRGSRLGSFAGDVYSFAIIMQEVMVRGTPFCMMDLPAQEIINRLKKPPPVYRPVVPPEHAPPECLQLMKQCWAEAAEQRPTFDEIFNQFKTFNKGKKTNIIDSMLRMLEQYSSNLEDLIRERTEELEIEKQKTEKLLTQMLPPSVAESLKKGCTVEPEGFDLVTLYFSDIVGFTTISAMSEPIEVVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPKRNGSRHAAEIANMSLDILSSVGTFKMRHMPEVPVRIRIGLHSGPVVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVSLSTVTILQNLSEGYEVELRGRTELKGKGTEETFWLIGKKGFMKPLPVPPPVDKDGQVGHGLQPV 1089          
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Match: sp|Q5SDA5|GUC2F_MOUSE (Retinal guanylyl cyclase 2 OS=Mus musculus OX=10090 GN=Gucy2f PE=1 SV=1)

HSP 1 Score: 593.578 bits (1529), Expect = 0.000e+0
Identity = 310/541 (57.30%), Postives = 397/541 (73.38%), Query Frame = 3
Query: 1053 SFSSGSLEGIL--DPNTAKYNGDFVHIKYL---DLSH-ASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIY-GSENIYSAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELG-GYHLELRGKVELKGKGIVDSYWLIGKDGFLKPLPVAPPA--DSEDNHGL 2645
            SFSSGSL      + N A Y GD+V +K     D     S+KS   D   +++D+R+ENVNP +G + D    ++V E C R SL+DI+ N +V LDW FK SL+ DLI+GM+Y+H  +  +H RLKS NCVVDGR+VLK+TDYG   + E+   SE   S ++LLWTAPELLR       GS  GD+YSF+IIMQE++ R  PF MM++ A EI+++++ PPP+ RP V+   AP   +Q+MK+ W+E +E RP+F+E+  Q K  NKGKK NI+D M +M+E+YS++LE+ +R RT+ELE E++KTE L+ +MLP  VA+SL  G  VEPE FD VT+YFSDIVGFTTISA+S P++VVDLLNDLYT+FDA I  +DVYKVETIGDAYMVASGLP RNG RHA EIA M+LD+LS  GTFK+RHMP++P+R+RIGLH+GP V GVVGLTMPRYCLFGDTVNTASRMES+G  +RIHVS  T  +L  L  GY +ELRG+ ELKGKG  +++WL+GK GF KPLPV PP   D +  HGL
Sbjct:  547 SFSSGSLTPATYENSNIAIYEGDWVWLKKFPPGDFGDIKSIKSSASDVFEMMKDLRHENVNPLLGFFYDSGMFAIVSEFCSRRSLEDILTNDDVKLDWMFKSSLLLDLIKGMKYLHHREF-IHGRLKSRNCVVDGRFVLKVTDYGFNDILEMLRLSEEEPSEEELLWTAPELLRAPGGIRLGSFAGDVYSFAIIMQEVMVRGAPFCMMDLPAKEIIDRLKMPPPVYRPVVSPEYAPAECLQLMKQCWAEASEQRPTFDEIFNQFKTFNKGKKTNIIDSMLRMLEQYSSNLEDLIRERTEELEIEKQKTEKLLTQMLPLSVAESLKKGCTVEPEGFDLVTLYFSDIVGFTTISAMSEPIEVVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPKRNGSRHAAEIANMSLDILSSVGTFKMRHMPEVPVRIRIGLHSGPVVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVSLSTVTILQTLSEGYEVELRGRTELKGKGTEETFWLVGKKGFTKPLPVPPPVGKDGQVGHGL 1086          
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Match: sp|O02740|GUC2F_BOVIN (Retinal guanylyl cyclase 2 OS=Bos taurus OX=9913 GN=GUCY2F PE=1 SV=1)

HSP 1 Score: 592.038 bits (1525), Expect = 0.000e+0
Identity = 312/544 (57.35%), Postives = 400/544 (73.53%), Query Frame = 3
Query: 1053 SFSSGSLEGIL--DPNTAKYNGDFVHIKYLDLSH----ASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYE-IYGSENIYSAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELG-GYHLELRGKVELKGKGIVDSYWLIGKDGFLKPLPVAPPA--DSEDNHGLASV 2654
            SFSSGSL      + N A Y GD+V +K     +     S++S   D   +++D+R+EN+NP +G + D    ++V E C R SL+DI+ N++V LDW FK SL+ DLI+GM+Y+H  +   H RLKS NCVVDGR+VLK+TDYG   + E +  S+   SA++LLWTAPELLR        S  GD+YSF+IIMQE++ R  PF MM++ A EI+ +I+KPPP+ RP V    APP  +Q+MK+ W+E AE RP+F+E+  Q K  NKGKK NI+D M +M+E+YS++LE+ ++ RT+ELE E++KTE L+ +MLP  VA+SL  G  VEPE FD VT+YFSDIVGFTTISA+S P++VVDLLNDLYT+FDA I  +DVYKVETIGDAYMVASGLP RNG RHA EIA M+LD+LS  GTFK+RHMP++P+R+RIGLH+GP V GVVGLTMPRYCLFGDTVNTASRMES+G  +RIHVS  T  +L  LG GY +ELRG+ ELKGKG  +++WL+GK GF KPLPV PP   D +  HGL SV
Sbjct:  547 SFSSGSLTPATCENSNIAIYEGDWVWLKKFPSGNFGDIKSVESSASDIFEMMKDLRHENINPLVGFFYDSGVFAIVTEFCSRRSLEDILMNQDVKLDWMFKSSLLLDLIKGMKYLHHREF-AHGRLKSRNCVVDGRFVLKVTDYGFNDILETLRLSQEEPSAEELLWTAPELLRAPRGSRLRSFAGDVYSFAIIMQEVMVRGTPFCMMDLPAKEIIERIKKPPPVYRPVVPPEHAPPECLQLMKQCWAEAAEQRPTFDEIFNQFKTFNKGKKTNIIDSMLRMLEQYSSNLEDLIQERTEELEIEKQKTEKLLTQMLPPSVAESLKKGCTVEPEGFDLVTLYFSDIVGFTTISAMSEPIEVVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPKRNGMRHAAEIANMSLDILSSVGTFKMRHMPEVPVRIRIGLHSGPVVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVSHSTVTILRTLGEGYEVELRGRTELKGKGTEETFWLVGKKGFTKPLPVPPPVGKDGQVGHGLQSV 1089          
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Match: sp|P52785|GUC2E_MOUSE (Retinal guanylyl cyclase 1 OS=Mus musculus OX=10090 GN=Gucy2e PE=1 SV=2)

HSP 1 Score: 565.459 bits (1456), Expect = 0.000e+0
Identity = 283/538 (52.60%), Postives = 387/538 (71.93%), Query Frame = 3
Query: 1092 NTAKYNGDFVHIK-YLDLSHASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISS----------ISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGSENIY----SAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDEL-GGYHLELRGKVELKGKGIVDSYWLIGKDGFLKPLPVAP---PADSEDNHGLA 2648
            N   Y GD+V +K +    H +++         +R++R+ENV   +G +L  ++          +++V EHC RGSL D++  + + LDW FK SL+ DLI+GMRY+H   +  H RLKS NCVVDGR+VLK+TD+G   + E   ++ +     SA+D LWTAPELLR   L   G+  GD++S +IIMQE++ R  P+ M+ +T +E++ ++R PPPLCRP V+  +AP   IQ+M + W+E+ E+RPS +      K +NKG+K NI+D M +M+E+YS++LE+ +R RT+ELE E++KT+ L+ +MLP  VA++L  G  VEPE F+EVT+YFSDIVGFTTISA+S P++VVDLLNDLYT+FDA I  +DVYKVETIGDAYMVASGLP RNG+RHA EIA M+LD+LS  G+F++RHMP++P+R+RIGLH+GPCV GVVGLTMPRYCLFGDTVNTASRMES+G  +RIHV+  T  +L  L  G+ +E RG+ ELKGKGI D+YWL+G+ GF KP+P  P   P  S  NHG++
Sbjct:  554 NVGLYEGDWVWLKKFPGEHHMAIRPATKTAFSKLRELRHENVALYLGLFLAGTADSPATPGEGILAVVSEHCARGSLHDLLAQREIKLDWMFKSSLLLDLIKGMRYLHHRGV-AHGRLKSRNCVVDGRFVLKVTDHGHGRLLE---AQRVLPEPPSAEDQLWTAPELLRDPSLERRGTLAGDVFSLAIIMQEVVCRSTPYAMLELTPEEVIQRVRSPPPLCRPLVSMDQAPMECIQLMTQCWAEHPELRPSMDLTFDLFKSINKGRKTNIIDSMLRMLEQYSSNLEDLIRERTEELEQEKQKTDRLLTQMLPPSVAEALKMGTSVEPEYFEEVTLYFSDIVGFTTISAMSEPIEVVDLLNDLYTLFDAIIGAHDVYKVETIGDAYMVASGLPQRNGQRHAAEIANMSLDILSAVGSFRMRHMPEVPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNMSTVRILRALDQGFQMECRGRTELKGKGIEDTYWLVGRLGFNKPIPKPPDLQPGAS--NHGIS 1085          
BLAST of Guanylate cyclase vs. TrEMBL
Match: A0A3Q0KKX9 (Guanylate cyclase OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 841.262 bits (2172), Expect = 0.000e+0
Identity = 404/570 (70.88%), Postives = 486/570 (85.26%), Query Frame = 3
Query: 1074 EGILDPNTAKYNGDFVHIKYLDLSHASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGSENIYSAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELGGYHLELRGKVELKGKGIVDSYWLIGKDGFLKPLPVAPPADSEDNHGLASVLKPDVLESIKSQHDHQSNTNPQSPDKTVSKDSKTLVAKRSDET 2783
            +GI D N A+YN   ++IK L+L++A+LKSKF+DH+R++R+IRNENVNP IGCY+DIS++ +VF+HC RGSLKDII+  ++NLDWEFKLSL+TD+++GMRYIH+  IK H  LKS+NC VDGRWV+KITDYGLP ++ IYG+      ++ LWTAPE LR +     GS KGD+YSFSI+MQEIITRD P+GM+ +TA EIL+K+RKPPPLCRP+V+QSEAPPAY++ MKRAW+E+  MRP+FEE+ QQL+ LN+GKK+NIVDHMFKMMEKYSADLE+QVRVRT+ELETE+KKTELLIARMLP +VA++L++GKPV PE+FDEVTIYFSDIVGFTTISALS P QVVDLLNDLYTMFD+TIDFYDVYKVETIGDAYMV SGLPIRNG+ HAGEIATMALDLLSQCGTF IRHMPD+PLRLRIGLH+G CV GVVGLTMPRYCLFGDTVNTASRMES+GSAFRIHVSP TK +LD LGGYHL+LRGKVELKGKG+VDS+WLIGKD F KPLP  PP    DNHGLAS+LKP+ ++++  ++   SN   +S +K  + D  T   +  D T
Sbjct:  639 DGIEDTNVARYNNSLIYIKRLELNNAALKSKFLDHVRLLREIRNENVNPLIGCYVDISALCLVFDHCTRGSLKDIIKKDSINLDWEFKLSLITDVVKGMRYIHSCPIKKHGWLKSTNCCVDGRWVVKITDYGLPEIFGIYGTNRKMKDEEWLWTAPEHLREETNIYTGSPKGDVYSFSIVMQEIITRDEPYGMLGLTASEILSKVRKPPPLCRPKVSQSEAPPAYLEFMKRAWAESPVMRPTFEEIYQQLRQLNQGKKINIVDHMFKMMEKYSADLEDQVRVRTEELETEKKKTELLIARMLPPVVAETLMSGKPVCPEAFDEVTIYFSDIVGFTTISALSTPFQVVDLLNDLYTMFDSTIDFYDVYKVETIGDAYMVVSGLPIRNGQLHAGEIATMALDLLSQCGTFVIRHMPDVPLRLRIGLHSGSCVAGVVGLTMPRYCLFGDTVNTASRMESTGSAFRIHVSPTTKSILDILGGYHLQLRGKVELKGKGLVDSFWLIGKDNFNKPLPDPPPLTEGDNHGLASLLKPEEIKAMAEKNKLDSN---ESVEKLKNDDIHTHEKQTHDNT 1205          
BLAST of Guanylate cyclase vs. TrEMBL
Match: A0A094ZE64 (Guanylate cyclase OS=Schistosoma haematobium OX=6185 GN=MS3_00162 PE=3 SV=1)

HSP 1 Score: 838.18 bits (2164), Expect = 0.000e+0
Identity = 401/566 (70.85%), Postives = 488/566 (86.22%), Query Frame = 3
Query: 1074 EGILDPNTAKYNGDFVHIKYLDLSHASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGSENIYSAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELGGYHLELRGKVELKGKGIVDSYWLIGKDGFLKPLPVAPPADSEDNHGLASVLKPDVLESIKSQHDHQSNTNPQSPDKTVSKDSKTLVAKR 2771
            +GI D N A+Y+   ++IK L+L++A+LKSKF+DH+R++R+IRNENVNP IGCY+DIS++ ++F+HC RGSLKDII+ +++NLDWEFKLSL+TD+++GMRYIH+S IK H  LKS+NC VDGRWV+KITDYGL  ++ IYG++     ++ LWTAPE LR +    +GS KGD+YSFSI+MQEIITRD P+GM+ ++A EIL+K+RKPPPLCRP+V+QSEAPPAY++ MKRAW+E+  MRP+FEE+ QQL+ LN+GKK+NIVDHMFKMMEKYSADLE+QVRVRT+ELETE+KKTELLIARMLP +VA++L++GKPV PE+FDEVTIYFSDIVGFTTISALS P QVVDLLNDLYTMFD+TIDFYDVYKVETIGDAYMV SGLPIRNG+ HAGEIATMALDLLSQCGTF IRHMPD+PLRLRIGLH+G CV GVVGLTMPRYCLFGDTVNTASRMES+GSAFRIHVSP TK +LD LGGYHL+LRGKVELKGKG+VDS+WLIGKD F KPLP  PP    DNHGLAS+LKP   E IK+  +     + +S +K  ++D +T V ++
Sbjct:  292 DGIEDTNVARYSNSLIYIKRLELNNAALKSKFLDHVRLLREIRNENVNPLIGCYVDISALCLIFDHCTRGSLKDIIKKESINLDWEFKLSLITDVVKGMRYIHSSPIKKHGWLKSTNCCVDGRWVVKITDYGLTEIFGIYGTKRKMKDEEWLWTAPEHLREETNIYSGSSKGDVYSFSIVMQEIITRDEPYGMLGLSASEILSKVRKPPPLCRPKVSQSEAPPAYLEFMKRAWAESPIMRPTFEEIYQQLRQLNQGKKINIVDHMFKMMEKYSADLEDQVRVRTEELETEKKKTELLIARMLPPVVAETLMSGKPVCPEAFDEVTIYFSDIVGFTTISALSTPFQVVDLLNDLYTMFDSTIDFYDVYKVETIGDAYMVVSGLPIRNGQLHAGEIATMALDLLSQCGTFVIRHMPDVPLRLRIGLHSGSCVAGVVGLTMPRYCLFGDTVNTASRMESTGSAFRIHVSPTTKSILDILGGYHLQLRGKVELKGKGLVDSFWLIGKDNFNKPLPDPPPLTEGDNHGLASLLKP---EEIKAMAEKNKADSIESVEKLKNEDMQTHVEEK 854          
BLAST of Guanylate cyclase vs. TrEMBL
Match: A0A183JWZ2 (Guanylate cyclase OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS7237 PE=3 SV=1)

HSP 1 Score: 825.469 bits (2131), Expect = 0.000e+0
Identity = 402/590 (68.14%), Postives = 490/590 (83.05%), Query Frame = 3
Query: 1074 EGILDPNTAKYNGDFVHIKYLDLSHASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGSENIYSAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELGGYHLELRGKVELKGKGIVDSYWLIGKDGFLKPLPVAPP-ADSEDNHGLASVLKPDVLESIK-------SQHDHQSNTNPQSPDKTVSKDSKTLVAKRSDETKINS--TEKSST 2813
            +GI D N A Y+   ++IK L+LS+A+LKSKF+DH+R++R+IRNENVNP IGCY+DIS++ +VF+HC RGSLKDII+ +++NLDWEFKLSL+TD+++GMRYIH+S IK H  LKS+NC VDGRWV+KITDYGL  ++ IYG++     ++ LWTAPE LR +    +GSQKGD+YSFSI+MQEIITRD P+GM+ ++A EIL+K+RKPPPLCRP+V+QSEAPPAY++ MKRAW+E+  MRP+FEE+ QQL+ LN+GKK+NIVDHMFKMMEKYSADLE+QVRVRT+ELETE+KKTELLIARMLP +VA++L++GKPV PE+FDEVTIYFSDIVGFTTISALS P QVVDLLNDLYTMFD+TIDFYDVYKVETIGDAYMV SGLPIRNG+ HAGEIATMALDLLS+CGTF IRHMPD+PLRLRIGLH+G CV GVVGLTMPRYCLFGDTVNTASRMES+GSAFRIHVSP TK +LD LGGYHL+LRGKVELKGKG+VDS+WLIGKD F KPLP  PP  + E+   +A   K D +ES++         H+ +      SP +  S  S     + SD+   +S  TE++ T
Sbjct:  639 DGIEDTNVASYSNSLIYIKRLELSNAALKSKFLDHVRLLREIRNENVNPLIGCYVDISALCLVFDHCTRGSLKDIIKKESINLDWEFKLSLITDVVKGMRYIHSSPIKKHGWLKSTNCCVDGRWVVKITDYGLTEIFGIYGTKRKMKDEEWLWTAPEHLREETNIYSGSQKGDVYSFSIVMQEIITRDEPYGMLGLSASEILSKVRKPPPLCRPKVSQSEAPPAYLEFMKRAWAESPVMRPTFEEIYQQLRQLNQGKKLNIVDHMFKMMEKYSADLEDQVRVRTEELETEKKKTELLIARMLPPVVAETLMSGKPVCPEAFDEVTIYFSDIVGFTTISALSTPFQVVDLLNDLYTMFDSTIDFYDVYKVETIGDAYMVVSGLPIRNGQLHAGEIATMALDLLSECGTFVIRHMPDVPLRLRIGLHSGSCVAGVVGLTMPRYCLFGDTVNTASRMESTGSAFRIHVSPTTKSILDILGGYHLQLRGKVELKGKGLVDSFWLIGKDNFNKPLPDPPPLIEPEEIKAMAEKNKADSIESVEKLKNEDMQTHEEEKTHGNNSPRRKSSSYSVHFTGENSDQPNRSSQNTERNKT 1228          
BLAST of Guanylate cyclase vs. TrEMBL
Match: A0A504YKG0 (Guanylate cyclase OS=Fasciola gigantica OX=46835 GN=FGIG_04782 PE=3 SV=1)

HSP 1 Score: 822.387 bits (2123), Expect = 0.000e+0
Identity = 391/537 (72.81%), Postives = 467/537 (86.96%), Query Frame = 3
Query: 1074 EGILDPNTAKYNGDFVHIKYLDLSHASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGSENIYSAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELGGYHLELRGKVELKGKGIVDSYWLIGKDGFLKPLPVAPPADSEDNHGLASVLKPDVLESIK 2684
            +GI D NTA+YN   V++K L+L++A+LKSKF+D +R +R+IRNEN+N  IGCY+DISS+ +V+EHC RGSL DII  +++NLDWEFKLSL+TD+++GMR++HAS  + H  LKSSNC VDGRWV+KITDYGLP +Y IYG E     K+LLWTAPE LR       GSQKGD+YSF+I+MQE+I R  P+GM+++T  E+L+K+R+PPPLCRP+V+QSEAPPAYI+ MKRAW+E+  MRPSFEE++QQL+ LN+GKK+NIVDHMFK+MEKYSADLE+QVR RT+ELETE+KKTELLIARMLP +VA+SL++GKPV PE+FDEVTIYFSDIVGFTTISALS P+QVVDLLNDLY+MFDATID+YDVYKVETIGDAYMV SGLP RNGR HAGE ATMALDLLSQCGTF IRHMPD+PLRLRIGLH+G CV GVVGLTMPRYCLFGDTVNTASRMES+GSAFRIHVSP TK +LDELGGYHL LRGKVELKGKG VDS+WL+GKDGF KPLP  P  +  DNHGLAS++ PD L+++K
Sbjct:  597 DGISDTNTARYNNGLVYVKRLNLTNATLKSKFLDQVRTLREIRNENINQMIGCYVDISSLCLVYEHCSRGSLLDIINKESINLDWEFKLSLITDVVKGMRFLHASPARKHGWLKSSNCCVDGRWVVKITDYGLPDIYGIYGEERKVEDKELLWTAPEHLRESPDAHFGSQKGDVYSFAIVMQELICRSTPYGMLDLTPSEVLSKVRRPPPLCRPKVSQSEAPPAYIECMKRAWAESPVMRPSFEEIHQQLRTLNQGKKINIVDHMFKIMEKYSADLEDQVRERTEELETEKKKTELLIARMLPPVVAESLMSGKPVRPEAFDEVTIYFSDIVGFTTISALSTPLQVVDLLNDLYSMFDATIDYYDVYKVETIGDAYMVVSGLPTRNGRLHAGETATMALDLLSQCGTFVIRHMPDMPLRLRIGLHSGSCVAGVVGLTMPRYCLFGDTVNTASRMESTGSAFRIHVSPTTKEILDELGGYHLVLRGKVELKGKGEVDSFWLVGKDGFTKPLPDPPAVNEGDNHGLASLINPDELKALK 1133          

HSP 2 Score: 72.7886 bits (177), Expect = 4.171e-9
Identity = 86/352 (24.43%), Postives = 153/352 (43.47%), Query Frame = 2
Query:   29 RLLTNYTWSRILIVYDS---------TVEWRDRAYYLAYQLKTLNFTTAISTRINVSLALQSLSFKPQACLILANTSSVISLLNQLWTNYSTIFDGSMAFIFYDQYSFALDSVRLWENLFSSANGSYQNLP-----FQSLLIIAAHPKDSNYSTSIT--ESFYNKQIQIGLAIAMVYGAEST-NKSTFQSTNIS---FKPLPNSGITI-------VTDSLG------HPIVDFYVFDVVT----PSFKLLP---VFYMKYPQYSIEIINSISWPNGVGPTPDNCFLKTCSTNLGFTAEQGLYLLAAFLIAGAVGLLIFYIIRYYNQKKQMKRGPNKIILFPEDIEFVKSVKT 964
            +LL  Y WS ++IVY             E  D    +AY  + +  TT  S+ +NVSL L     K    ++L    +V   L  L +  S    GS+  + +D   FA D   +W+ L +       N+P      Q+LLI+  HP    Y T+++  E  + +++ + L   + +  ++  ++S   +TN +   F  L  + + I       V    G         +DF +  VV      S +LL       +++P Y ++  N +  P       +   L TC+ + G      L  ++      A  L+ F++ R+Y ++K  + GPNK+IL+P+D+ FV+  ++
Sbjct:  214 QLLKRYKWSNVIIVYQQEPGSNMRYLASELADGINRIAYPQQHVTGTTGWSSAVNVSLVLAVQKSKVATFILLGQLKTVADFLLSL-SALSNNPLGSVPIVAFDSMLFAQDVQLVWKALVT-------NIPKLADLSQNLLILVPHP----YKTTLSNDEKIFKEKMFLALDFLVGFAVQTVRHRSQTPNTNATDGLFASLGGATLRIPLTTGMSVASKFGANGMSVDGAIDFSLLHVVALKSADSTRLLNYSNSATVQWPSYIVQTSNPV--PFAAQTAKNLTTLPTCTPDNGIV--MALIFMSILTAVIAFALVAFFLSRWYRRRKMYREGPNKLILYPDDLVFVRPSRS 549          
BLAST of Guanylate cyclase vs. TrEMBL
Match: A0A4E0R4E8 (Guanylate cyclase OS=Fasciola hepatica OX=6192 GN=D915_007187 PE=3 SV=1)

HSP 1 Score: 820.076 bits (2117), Expect = 0.000e+0
Identity = 390/537 (72.63%), Postives = 466/537 (86.78%), Query Frame = 3
Query: 1074 EGILDPNTAKYNGDFVHIKYLDLSHASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGSENIYSAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELGGYHLELRGKVELKGKGIVDSYWLIGKDGFLKPLPVAPPADSEDNHGLASVLKPDVLESIK 2684
            +GI D NTA+YN   V++K L+L++A+LKSKF+D +R +R+IRNEN+N  IGCY+DISS+ +V+EHC RGSL DII  +++ LDWEFKLSL+TD+++GMR++HAS  + H  LKSSNC VDGRWV+KITDYGLP +Y IYG E     K+LLWTAPE LR       GSQKGD+YSF+I+MQE+I R  P+GM+++T  E+L+K+R+PPPLCRP+V+QSEAPPAYI+ MKRAW+E+  MRPSFEE++QQL+ LN+GKK+NIVDHMFK+MEKYSADLE+QVR RT+ELETE+KKTELLIARMLP +VA+SL++GKPV PE+FDEVTIYFSDIVGFTTISALS P+QVVDLLNDLY+MFDATID+YDVYKVETIGDAYMV SGLP RNGR HAGE ATMALDLLSQCGTF IRHMPD+PLRLRIGLH+G CV GVVGLTMPRYCLFGDTVNTASRMES+GSAFRIHVSP TK +LDELGGYHL LRGKVELKGKG VDS+WL+GKDGF KPLP  P  +  DNHGLAS++ PD L+++K
Sbjct:  597 DGISDTNTARYNNGLVYVKRLNLTNATLKSKFLDQVRTLREIRNENINQMIGCYVDISSLCLVYEHCSRGSLLDIINKESITLDWEFKLSLITDVVKGMRFLHASPARKHGWLKSSNCCVDGRWVVKITDYGLPDIYGIYGEERKVEDKELLWTAPEHLRESPDAHFGSQKGDVYSFAIVMQELICRSTPYGMLDLTPSEVLSKVRRPPPLCRPKVSQSEAPPAYIECMKRAWAESPVMRPSFEEIHQQLRTLNQGKKINIVDHMFKIMEKYSADLEDQVRERTEELETEKKKTELLIARMLPPVVAESLMSGKPVRPEAFDEVTIYFSDIVGFTTISALSTPLQVVDLLNDLYSMFDATIDYYDVYKVETIGDAYMVVSGLPTRNGRLHAGETATMALDLLSQCGTFVIRHMPDMPLRLRIGLHSGSCVAGVVGLTMPRYCLFGDTVNTASRMESTGSAFRIHVSPTTKEILDELGGYHLVLRGKVELKGKGEVDSFWLVGKDGFTKPLPDPPAVNEGDNHGLASLINPDELKALK 1133          

HSP 2 Score: 74.7146 bits (182), Expect = 1.260e-9
Identity = 87/353 (24.65%), Postives = 156/353 (44.19%), Query Frame = 2
Query:   29 RLLTNYTWSRILIVYDS---------TVEWRDRAYYLAYQLKTLNFTTAISTRINVSLALQSLSFKPQACLILANTSSVISLLNQLWTNYSTIFDGSMAFIFYDQYSFALDSVRLWENLFSSANGSYQNLP-----FQSLLIIAAHPKDSNYSTSIT--ESFYNKQIQIGLAIAMVYGAEST-NKSTFQSTNIS---FKPLPNSGITI-------VTDSLG------HPIVDFYVFDVVT----PSFKLLP---VFYMKYPQYSIEIINSISWPNGVGPTPDNCF-LKTCSTNLGFTAEQGLYLLAAFLIAGAVGLLIFYIIRYYNQKKQMKRGPNKIILFPEDIEFVKSVKT 964
            +LL  Y WS ++IVY             E  D    +AY  + +  TT  S+ +NVSL L   + K    ++L    +V   L  L T  +    GS+  + +D   FA D   +W+ L +       N P      ++LLI+  HP    Y T+++  E  +N ++ + L   + +  ++  ++S   +TN +   F  L  + + I       V    G         +DF +  VV      S +LL       +++P Y+++  N + +      T +N   L TC+ + G      L  ++      A  L+ F++ R+Y ++K  + GPNK+IL+P+D+ FV+  ++
Sbjct:  214 QLLKRYKWSNVIIVYQQEPGSNMRYLASELADGINRIAYPQRHVRGTTGWSSAVNVSLVLPVQTSKVATFILLGQLKTVADFLLSLSTLSNNPL-GSVPIVAFDSMLFAQDVQLVWKALVT-------NTPKLADLSKNLLILVPHP----YKTTLSNDEKTFNGKMFLALDFLVGFAVQTVRHRSQTPNTNATDGLFASLSGATLRIPLTTGMSVASKFGANGVSLDGAIDFSLLHVVALKSADSTRLLNYSNSATVQWPSYTLQTSNPVPF---AAQTANNVTTLPTCTPDNGIV--MALIFMSILTAVIAFALVAFFLSRWYRRRKMYREGPNKLILYPDDLVFVRPSRS 549          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: ENSAMXT00000020840.2 (retinal guanylyl cyclase 2 [Source:NCBI gene;Acc:103026799])

HSP 1 Score: 603.594 bits (1555), Expect = 0.000e+0
Identity = 302/524 (57.63%), Postives = 397/524 (75.76%), Query Frame = 3
Query: 1092 NTAKYNGDFVHIKYLDLSH-ASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGSENIYS---AKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELG-GYHLELRGKVELKGKGIVDSYWLIGKDGFLKPLPVAPPAD-SEDNHGL 2645
            N A Y GD+V +K L   +  S+  K  D   +++DIR+EN+NP +G + D    +MV E C RGSL+D+++N++V LDW FK SL+ DLI+GM+Y+H   +  H RLKS NCVVDGR+VLK+TDYG   V +       Y+   A+DLLWTAPELLR  H     + +GD+YS SIIMQE++ R  PF M++++A+EI+ +++KPPPLCRP V+   AP   IQ++K+ W+E A+ RP+F+E  ++ +++NKG+K NI+D M +M+E+YS++LEE +R RT+ELE E++KTE L+ +MLP  VA++L  G  VEPE FD V++YFSDIVGFTTISA S P++VVDLLNDLYT+FDA I  +DVYKVETIGDAYMVASGLP+ NG RHA EIA+M+LD+LS  GTFK+RHMPD+P+R+RIGLHTGPCV GVVGLTMPRYCLFGDTVNTASRMES+G  +RIHVS  T  +L EL  GY +ELRGK ELKGKG+ ++Y+L+GK+GF KPLPV P     +  HGL
Sbjct:  548 NVAIYEGDWVWLKRLPYGNFGSVNPKTSDVFELMKDIRHENLNPFMGYFHDRGVFAMVTEFCSRGSLEDLLRNEDVKLDWMFKSSLLLDLIKGMKYLHHRGV-CHGRLKSRNCVVDGRFVLKVTDYGYNEVLQ--AQRFPYTEPKAEDLLWTAPELLRASHPGQAATPEGDVYSLSIIMQEVVLRGPPFFMLHLSAEEIIQRVKKPPPLCRPMVSPDYAPMECIQLIKQCWNEQADRRPTFDETFEEFRNINKGRKTNIIDSMLRMLEQYSSNLEELIRERTEELEIEKQKTEKLLTQMLPPSVAEALKVGGTVEPEYFDSVSLYFSDIVGFTTISANSEPIEVVDLLNDLYTLFDAIIGNHDVYKVETIGDAYMVASGLPVPNGNRHAAEIASMSLDILSAVGTFKMRHMPDVPVRIRIGLHTGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGMPYRIHVSHTTVKILIELNEGYKIELRGKTELKGKGMDETYFLVGKEGFTKPLPVPPELKPGQRAHGL 1068          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: gucy2f (retinal guanylyl cyclase 2-like [Source:NCBI gene;Acc:103038783])

HSP 1 Score: 602.438 bits (1552), Expect = 0.000e+0
Identity = 294/522 (56.32%), Postives = 389/522 (74.52%), Query Frame = 3
Query: 1092 NTAKYNGDFVHIKYLDLSH-ASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGS-ENIYSAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELG-GYHLELRGKVELKGKGIVDSYWLIGKDGFLKPLPVAPPADSEDNHGLA 2648
            N A Y GD+V +K  +      +K         ++D+RNENVNP +G + D    ++V E+C RGSL+D+++N +V LDW FK SL+ DLI+GM+Y+H  +   H RLKS NCVVDGR+VLKITDYG   + E   +    +   DL WTAPELLR       G+ KGD+YSF+II+QE++ R  P+ M+ ++A+EI+ K++KPPP+CRP V   +AP   IQ+MK+ WSE  + RPSF+E+  Q K +NKGKK NI+D M +M+E+YS++LE+ +R RT+ELE E+++TE L+  MLP+ VA++L  G  VEPE FDEVTIYFSDIVGFTTIS+LS+P++VVDLLNDLYT+FDA +  +DVYKVETIGDAYMVASGLP RNG +HA EIA M+L++LS  G+FK+RHMP++P+R+RIG+H+G CV GVVGLTMPRYCLFGDTVNTASRMES+G  +RIHV+  T  +L+ L  GY +E+RGK ELKGKGI ++YWL+GK  F KPLP  P   + DNHGL+
Sbjct:  564 NVAVYEGDWVWLKKFEEGQFKEVKQSTTKIFTKMKDLRNENVNPFLGFFSDCEMFAVVTEYCSRGSLQDLLRNDDVKLDWMFKSSLLLDLIKGMKYLHHREFP-HGRLKSRNCVVDGRFVLKITDYGFNELLESQKAPRKEFPPGDLFWTAPELLRDPESSRRGTYKGDVYSFAIILQEVVVRGPPYCMLGLSAEEIIRKVKKPPPMCRPTVAPDQAPLECIQLMKQCWSEQPDRRPSFDEIFDQFKLINKGKKTNIIDSMLRMLEQYSSNLEDLIRERTEELEVEKQRTEKLLTEMLPQSVAEALKTGATVEPEYFDEVTIYFSDIVGFTTISSLSDPIEVVDLLNDLYTLFDAVLSNHDVYKVETIGDAYMVASGLPKRNGNKHAAEIANMSLNILSSVGSFKMRHMPEVPVRIRIGIHSGSCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNISTVKILNSLNEGYKIEVRGKTELKGKGIEETYWLVGKANFAKPLPKPPEIKAGDNHGLS 1084          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: gucy2f (retinal guanylyl cyclase 2-like [Source:NCBI gene;Acc:103038783])

HSP 1 Score: 594.734 bits (1532), Expect = 0.000e+0
Identity = 291/518 (56.18%), Postives = 385/518 (74.32%), Query Frame = 3
Query: 1092 NTAKYNGDFVHIKYLDLSH-ASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGS-ENIYSAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELG-GYHLELRGKVELKGKGIVDSYWLIGKDGFLKPLPVAPPADSEDN 2636
            N A Y GD+V +K  +      +K         ++D+RNENVNP +G + D    ++V E+C RGSL+D+++N +V LDW FK SL+ DLI+GM+Y+H  +   H RLKS NCVVDGR+VLKITDYG   + E   +    +   DL WTAPELLR       G+ KGD+YSF+II+QE++ R  P+ M+ ++A+EI+ K++KPPP+CRP V   +AP   IQ+MK+ WSE  + RPSF+E+  Q K +NKGKK NI+D M +M+E+YS++LE+ +R RT+ELE E+++TE L+  MLP+ VA++L  G  VEPE FDEVTIYFSDIVGFTTIS+LS+P++VVDLLNDLYT+FDA +  +DVYKVETIGDAYMVASGLP RNG +HA EIA M+L++LS  G+FK+RHMP++P+R+RIG+H+G CV GVVGLTMPRYCLFGDTVNTASRMES+G  +RIHV+  T  +L+ L  GY +E+RGK ELKGKGI ++YWL+GK  F KPLP  P   + DN
Sbjct:  564 NVAVYEGDWVWLKKFEEGQFKEVKQSTTKIFTKMKDLRNENVNPFLGFFSDCEMFAVVTEYCSRGSLQDLLRNDDVKLDWMFKSSLLLDLIKGMKYLHHREFP-HGRLKSRNCVVDGRFVLKITDYGFNELLESQKAPRKEFPPGDLFWTAPELLRDPESSRRGTYKGDVYSFAIILQEVVVRGPPYCMLGLSAEEIIRKVKKPPPMCRPTVAPDQAPLECIQLMKQCWSEQPDRRPSFDEIFDQFKLINKGKKTNIIDSMLRMLEQYSSNLEDLIRERTEELEVEKQRTEKLLTEMLPQSVAEALKTGATVEPEYFDEVTIYFSDIVGFTTISSLSDPIEVVDLLNDLYTLFDAVLSNHDVYKVETIGDAYMVASGLPKRNGNKHAAEIANMSLNILSSVGSFKMRHMPEVPVRIRIGIHSGSCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNISTVKILNSLNEGYKIEVRGKTELKGKGIEETYWLVGKANFAKPLPKPPEIKAGDN 1080          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: gc2 (retinal guanylyl cyclase 2 [Source:NCBI gene;Acc:103025043])

HSP 1 Score: 592.423 bits (1526), Expect = 0.000e+0
Identity = 294/515 (57.09%), Postives = 382/515 (74.17%), Query Frame = 3
Query: 1092 NTAKYNGDFVHIK-YLDLSHASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGSENIY-SAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDEL-GGYHLELRGKVELKGKGIVDSYWLIGKDGFLKPLPVAPPADS 2627
            N A Y GD+  +K + D +   +     +   ++RDIR+ENVNP +G + D    ++V E C RGSL+D++ N +V LDW FK SL+ DLI+GM+Y+H   +  H RLKS NC+VDGR+VLK+TDY    + E    + +  SA++LLWTAPELLR      NG+  GD+YSFSI+MQE++ R  PF M++++A+EIL KIRKPPPLCRP V    AP   IQ+MK+ W+E  E RP+FEE+  Q K++NKGKK NI+D M +M+E+YS++LEE +R RT+ELE E++KTE L+ +MLP  VA++L  G  VEPE ++ VTIYFSDIVGFTTISA S P++VVDLLNDLY+ FD  I  +DVYKVETIGDAYMVASGLP+ NG RHA EIA MALD+LS  GTFK+RHMPD+P+R+RIG+HTG CV GVVGLTMPRYCLFGDTVNTASRME++G+  RIH+   T  +L E+  GY ++L G+ E+KGKG  ++YWLIG+DGF KPLP+ P   S
Sbjct:  572 NVAVYEGDWAWLKRFPDGTFQGINPSTTELFELMRDIRHENVNPFMGLFHDCGVFAIVTEFCSRGSLEDLLLNDDVKLDWMFKSSLLLDLIKGMKYLHHRNV-CHGRLKSRNCLVDGRFVLKVTDYAYNKLLEAQKFQYVEPSAEELLWTAPELLRGSFPGQNGTFPGDVYSFSIVMQEVVARGPPFCMLDLSAEEILQKIRKPPPLCRPTVYPDHAPVECIQLMKQCWNEQPENRPTFEEIFDQFKNINKGKKTNIIDSMLRMLEQYSSNLEELIRERTEELEVEKQKTEKLLTQMLPPSVAEALKLGTTVEPEYYECVTIYFSDIVGFTTISANSEPIEVVDLLNDLYSTFDEIIANHDVYKVETIGDAYMVASGLPVPNGNRHAAEIANMALDILSAVGTFKMRHMPDVPVRIRIGIHTGSCVAGVVGLTMPRYCLFGDTVNTASRMEATGTPHRIHIHSSTVQILREMKAGYKVQLCGRTEIKGKGTEETYWLIGRDGFTKPLPIPPELKS 1085          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: npr1a (natriuretic peptide receptor 1a [Source:ZFIN;Acc:ZDB-GENE-060503-539])

HSP 1 Score: 481.871 bits (1239), Expect = 9.755e-153
Identity = 253/512 (49.41%), Postives = 345/512 (67.38%), Query Frame = 3
Query: 1068 SLEGILD--PNTAKYNGDFVHIKYLDLSHASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVY-EIYGSE-NIYSAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMN--MTADEILNKIRKPP-PLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELGGYHLELRGKVELKGKGIVDSYWLIGK 2582
            +LEG +     T  Y G+   IKY++     L  K +  L+ +RD++NE++N  IG  +D  +I ++ E+C RGSL+D+++ +++ LDW F+ SL+ D+++GM ++H S I  H  LKSSNC+VD R+VLKITDYGL +   E Y  + + Y A+ L WTAPEL+R ++ +  G+QKGD+YSF II+QE+      F + +   +  EI+  + +   P  RP +          Q+M+R WSE+   RP F ++   L   N+G   NI+D++   ME+Y+ +LEE V  RT     E++K E L+ ++LP  VA+ L  G+ V+ E+FD VTIYFSDIVGFT +SA S PMQVV LLNDLYT FDA ID +DVYKVETIGDAYMV SGLP+RNG+ H GEIA M+L LL    +F+IRH PD+ LRLRIG+HTGP   GVVGL MPRYCLFGDTVNTASRMES+G A +IHVS  T+ VL E   + LELRG +E+KGKG + +YWL+G+
Sbjct:  537 TLEGNVQIYAKTCYYKGNITAIKYVNKKRIELTRKVLFELKHMRDVQNEHLNRFIGACIDAPNICILTEYCPRGSLQDLMEIESITLDWMFRYSLINDIVKGMAFLHNSVIVSHGNLKSSNCLVDSRFVLKITDYGLASFRKESYLEDTHAYYARKL-WTAPELMRDENRQPCGTQKGDVYSFGIILQELALLKGVFYLDSPPFSPKEIVEHVAEGRWPYLRPLLCTQSHSEELGQLMQRCWSEDVNERPDFNQIKVMLHKNNRGYGSNILDNLLSRMEQYANNLEELVEERTQAYHEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTAMSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHTGEIARMSLALLEAVYSFRIRHRPDLQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHVSEATRAVLQEFNCFQLELRGDIEMKGKGRMRTYWLLGE 1047          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: NPR1 (natriuretic peptide receptor 1 [Source:HGNC Symbol;Acc:HGNC:7943])

HSP 1 Score: 477.633 bits (1228), Expect = 1.211e-158
Identity = 247/506 (48.81%), Postives = 338/506 (66.80%), Query Frame = 3
Query: 1107 NGDFVHIKYLDLSHASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVY---EIYGSENIYSAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMM--NMTADEILNKIRKPP-PLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELN---QQLKDLNKGKK----MNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELGGYHLELRGKVELKGKGIVDSYWLIGKD 2585
             G+ V I +++     L  + +  L+ +RD++NE++   +G  +D+ +I ++ E+C RGSL+DI++N++++LDW F+ SLM D+++GM Y+H+S I  H  LKSSNCVVD R+VLKITDYGL +V    +   S N +  +  LWTAPELLR++ +   G+QKGD+YSF+II+QEI  R  PF +   ++TA EI+ +++    P  RP V           +M+R W+E +  RP F ++    Q+    + G +      I+D++   ME+Y+ +LEE V  RT     E+ K E L+ ++LP  VA+ L  G+ V  E+FD VTIY SDIVGFT +SA S PMQVV  LNDLYT FDA ID +DVYKVETIGDAYMV SGLP+ NG RHA E+A MAL LLS    F IRH P   L LRIG+HTGP   GVVGL MPRYCLFGDTVNTASRME+ G A RIH+S  TK +LDE GG+ ++L G V++KGKG + +YWL+G++
Sbjct:    1 QGNLVEIPFINRKKIELTRQMLFELKHMRDVQNEHLTRFVGACIDVPNICIITEYCPRGSLQDILENESISLDWMFRYSLMHDIVKGMLYLHSSVIGSHGNLKSSNCVVDSRFVLKITDYGLSSVRAHSKADSSANYFEKR--LWTAPELLRLEEVAPRGTQKGDVYSFAIILQEIALRSGPFYLEANHLTAKEIVQRVKLGEWPYLRPTVDPGGHSEELGHLMQRCWAEESTERPDFHQIKILLQKFSSQDDGPESPPAFTILDNLLSRMEQYANNLEELVEERTQAYLEEKGKAEALLYQILPHSVAEQLKRGETVPAEAFDSVTIYLSDIVGFTAMSAQSTPMQVVAFLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVHNGTRHAIEVARMALALLSAVRCFHIRHRPAQRLLLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMEAKGEAHRIHLSSTTKAILDEYGGFVVQLHGDVDIKGKGTMRTYWLLGEN 504          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006352.1 (pep scaffold:Pmarinus_7.0:GL477176:19246:83539:-1 gene:ENSPMAG00000005587.1 transcript:ENSPMAT00000006352.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 487.263 bits (1253), Expect = 5.622e-158
Identity = 255/502 (50.80%), Postives = 343/502 (68.33%), Query Frame = 3
Query: 1095 TAKYNGDFVHIKYLDLSHASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLK-DIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGSENIYS--AKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGM--MNMTADEILNKIRKPP-PLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELGGYHLELRGKVELKGKGIVDSYWLIGK 2582
            T  Y G+ V IK ++     L  + +  L+ +RD+ NE++   +G  +D  +I +V E+C RGSL+ DI++N+++ LDW F+ SL+ D+++GM ++H S I  H  LKSSNCVVD R+VLKITDYGL +       E+++S  AK L WTAPELLR++H    G+QKGD+YS  II+QEI  R+  F +  M+++  EI+ K++    P  RP   +S        +M+R W+E+   RP F ++   +   NK    NI+D++   ME+Y+ +LEE V  RT     E++K E L+ ++LP  VA+ L  G+ V+ E+FD VTIYFSDIVGFT++SA S PMQVV LLNDLYT FDA ID +DVYKVETIGDAYMV SGLP+RNG+ +A EIA M+L LL    TFKIRH  +  L+LRIG+HTGP   GVVGL MPR+CLFGDTVNTASRMES+G A +IHVS  TK VLDE G + LELRG VE+KGKG + +YWL+G+
Sbjct:  320 TGYYRGNLVAIKPINKKKIELTREVLFELKHMRDVLNEHLTRFVGACIDPPNICIVTEYCPRGSLQQDILENESITLDWVFRYSLINDIVKGMLFLHNSVIGSHGSLKSSNCVVDSRFVLKITDYGLASFRSCSECEDMHSLYAKKL-WTAPELLRLEHPPPQGTQKGDVYSLGIILQEIALRNGTFYVEGMDLSPKEIVQKVKNGQRPYFRPSTDESCHIEELGLLMQRCWAEDPAERPDFSQIKMLIHKFNKENSTNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAETLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSLSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLNAKEIARMSLALLDAVKTFKIRHRQEDKLKLRIGIHTGPVCAGVVGLKMPRFCLFGDTVNTASRMESNGEALKIHVSQTTKEVLDEFGCFRLELRGDVEMKGKGKMRTYWLLGE 820          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008976.1 (pep scaffold:Pmarinus_7.0:GL476454:105373:131710:-1 gene:ENSPMAG00000008096.1 transcript:ENSPMAT00000008976.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 399.438 bits (1025), Expect = 5.817e-126
Identity = 233/509 (45.78%), Postives = 340/509 (66.80%), Query Frame = 3
Query: 1104 YNGDFVHIKYLDLSHA-SLKS-KFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEI-YGSE-------NIYSA-KDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRD--VPFGMMNMTADEILNKIR---KPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELGGYHLELRGKVELKGKGIVDSYWLIGK 2582
            Y G+ V +K+L+ +H   LKS +F   +R   ++ +EN+    G  +++ ++ +V ++C +GSLKD+++  +  LDW FK S   D++ GM ++H S IK H  LK S C++D R  +K+T +G   ++E  YG +       N+ S   +L WTAPELLR++ L  NG+ KGD++SF+I+M+E+I  +   P+  +++   +I++++R     PPL RP +T+    P    ++++ W E+A+ RP F  +++ L+  +    MNI+D+M   +EKY+  LEE V  RT +LE+E+KKT+ L++ +LP +V   L AGK V+PE ++ VTI+F DIVGFT +SA+S P++V++LLNDLY + D  I  YDVYKVETIGDAYMVASGLP+RNG RH  EIATM+L  LS    F+IRH+P   L+LRIG+++GP V GVVG TMPRYCLFGDTVN ASRMES+G    IHVS  T  +L ++GGY L  RG + LKGKG   +YWL GK
Sbjct:  217 YQGNQVALKFLERTHPPDLKSNRFALKMR---EMLHENLVIFFGVCVELPNVCIVTQYCRKGSLKDVLKTSDFELDWMFKTSFAHDIVNGMIFLHKSPIKSHGNLKPSTCLLDSRLQIKLTGFG---IWEFRYGKKGKTLDINNLGSFFIELYWTAPELLRMEDLPVNGTPKGDVFSFAILMREVIYHEDEGPYVGIHLEPKDIIDQVRDGIAVPPL-RPLLTE-RCEPRIQALIRQCWDESADRRPDFSSVSRMLRLASPEGDMNILDNMVSKLEKYANHLEEVVDDRTAQLESEKKKTDRLLSSLLPGIVVDQLKAGKTVQPEQYELVTIFFCDIVGFTAMSAISTPLEVINLLNDLYNLLDDIIKEYDVYKVETIGDAYMVASGLPVRNGVRHVEEIATMSLHFLSSIMNFRIRHLPQEQLKLRIGINSGPVVAGVVGNTMPRYCLFGDTVNVASRMESTGFPLHIHVSEATTNLLKQIGGYFLVERGTINLKGKGNQLTYWLKGK 717          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008942.1 (pep scaffold:Pmarinus_7.0:GL476454:59555:94399:-1 gene:ENSPMAG00000008084.1 transcript:ENSPMAT00000008942.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 407.912 bits (1047), Expect = 1.881e-125
Identity = 232/515 (45.05%), Postives = 341/515 (66.21%), Query Frame = 3
Query: 1104 YNGDFVHIKYLDLSHA-SLKSK-FVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEI-YGSE------NIYSAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRD--VPFGMMNMTADEILNKIRK---PPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELGGYHLELRGKVELKGKGIVDSYWLIGKDGFLKPLP 2606
            Y G+ V +K+L  +    LKSK  +  L+++R++R+EN+    G  +++ +I +V ++C +GSLKD+++  +  LD  FK S   D++ GM ++H S IK H  LK S C++D R  +K+T +G   ++E  +G +      N     +L WT+PELLR++    NG+ KGD++SF ++M+E+I  +   P+  ++M   EI++++R+    PPL RP +T+    P    +++R W E+ + RP F  + + L+  +     +I+D+M   +EKY+  LEE V  RT +LE+E+KKT+ L++ +LP +V + L AGK V+PE F++VTI+F DIVGFT +SA+S+P++V+ LLNDLY + D  I  YDVYKVETIGDAYMVASGLP+RNG RH  EI+ M+L  LS    F+IRH+P   L++RIG+++G  V GVVG TMPRYCLFGDTVN ASRMES+G   RIHVS  T  +L  +GGY L  RG ++LKGKG   +YWL GK GF  PLP
Sbjct:  551 YQGNQVALKFLQRTRPPDLKSKTLLKELQMLRELRHENLVVFFGVCVEMPNICIVTQYCRKGSLKDVLKTSDFELDLMFKTSFAYDIVNGMIFLHKSPIKSHGNLKPSTCLLDSRLQIKLTGFG---IWEFRHGKKGKIMDVNNQDIAELFWTSPELLRMEIFPVNGTPKGDVFSFGVLMREMIYHEDEGPYVGVDMEPKEIIDQVREGKCSPPL-RPLLTE-RCEPRIQALIQRCWDESPDRRPDFHSIARMLRSASPEGHRSILDNMVSKLEKYANHLEEVVEDRTAQLESEKKKTDRLLSSLLPSVVVEQLKAGKTVQPEHFEQVTIFFCDIVGFTAMSAISSPLEVITLLNDLYNLLDDIIKEYDVYKVETIGDAYMVASGLPVRNGVRHVEEISIMSLHFLSSIINFRIRHLPKEQLKIRIGVNSGSVVAGVVGNTMPRYCLFGDTVNVASRMESTGYPLRIHVSESTASLLKSIGGYELVERGAIQLKGKGSQLTYWLNGKFGFHMPLP 1060          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008986.1 (pep scaffold:Pmarinus_7.0:GL476454:105373:128493:-1 gene:ENSPMAG00000008096.1 transcript:ENSPMAT00000008986.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 393.275 bits (1009), Expect = 9.399e-125
Identity = 223/481 (46.36%), Postives = 322/481 (66.94%), Query Frame = 3
Query: 1188 IRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGL--------PTVYEIYGSENIY--SAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMM--NMTADEILNKIR---KPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLN-KGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELGGYHLELRGKVELKGKGIVDSYWLIGK 2582
            +R++ +EN+    G  +++ ++ +V ++C +GSLKD+++  +  LDW FK S   D++ GM ++H S IK H  LK S C++D R  +K+T +G+            +I   E+ +  S+K+L WTAPELLR++ L  NG+ KGD++SF+I+M+E   R+ P       +   +I++++R     PPL RP +T+    P    ++++ W E+A+ RP F  +++ L+  + +G  MNI+D+M   +EKY+  LEE V  RT +LE+E+KKT+ L++ +LP +V   L AGK V+PE ++ VTI+F DIVGFT +SA+S P++V++LLNDLY + D  I  YDVYKVETIGDAYMVASGLP+RNG RH  EIATM+L  LS    F+IRH+P   L+LRIG+++GP V GVVG TMPRYCLFGDTVN ASRMES+G    IHVS  T  +L ++GGY L  RG + LKGKG   +YWL GK
Sbjct:  150 MREMLHENLVIFFGVCVELPNVCIVTQYCRKGSLKDVLKTSDFELDWMFKTSFAHDIVNGMIFLHKSPIKSHGNLKPSTCLLDSRLQIKLTGFGIWEFRYGKKGKTLDINKQEDAWALSSKELYWTAPELLRMEDLPVNGTPKGDVFSFAILMRESTPREWPTATRANRVPFPDIIDQVRDGIAVPPL-RPLLTE-RCEPRIQALIRQCWDESADRRPDFSSVSRMLRLASPEGLHMNILDNMVSKLEKYANHLEEVVDDRTAQLESEKKKTDRLLSSLLPGIVVDQLKAGKTVQPEQYELVTIFFCDIVGFTAMSAISTPLEVINLLNDLYNLLDDIIKEYDVYKVETIGDAYMVASGLPVRNGVRHVEEIATMSLHFLSSIMNFRIRHLPQEQLKLRIGINSGPVVAGVVGNTMPRYCLFGDTVNVASRMESTGFPLHIHVSEATTNLLKQIGGYFLVERGTINLKGKGNQLTYWLKGK 628          
BLAST of Guanylate cyclase vs. Ensembl Yeast
Match: CLA4 (Cdc42p-activated signal transducing kinase; member of the PAK (p21-activated kinase) family, along with Ste20p and Skm1p; involved in septin ring assembly, vacuole inheritance, cytokinesis, sterol uptake regulation; phosphorylates Cdc3p and Cdc10p; CLA4 has a paralog, SKM1, that arose from the whole genome duplication [Source:SGD;Acc:S000005242])

HSP 1 Score: 67.0106 bits (162), Expect = 1.219e-11
Identity = 50/186 (26.88%), Postives = 92/186 (49.46%), Query Frame = 3
Query: 1110 GDFVHIKYLDLSHASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISS-ISMVFEHCGRGSLKDIIQNKNVNLDWEFKLS------LMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGSENIYSAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPF 1646
            GD V IK + LS    K   V+ + +++D R++N+   +  YL     + +V E    GSL DII+N   N +    L+      ++ +  +G++++H   I +H  +KS N ++D R  +KITD+G         S+         W APE+++    +    +K D++S  I+  E++  + P+
Sbjct:  588 GDKVAIKQMVLSKQPRKELIVNEILVMKDSRHKNIVNFLEAYLRTDDDLWVVMEFMEGGSLTDIIENSPTNDNSHSPLTEPQIAYIVRETCQGLKFLHDKHI-IHRDIKSDNVLLDTRARVKITDFGFCARLTDKRSKRATMVGTPYWMAPEVVK----QREYDEKIDVWSLGIMTIEMLEGEPPY 768          
BLAST of Guanylate cyclase vs. Ensembl Yeast
Match: CDC5 (Polo-like kinase; controls targeting and activation of Rho1p at cell division site via Rho1p guanine nucleotide exchange factors; regulates Spc72p; also functions in adaptation to DNA damage during meiosis; regulates the shape of the nucleus and expansion of the nuclear envelope during mitosis; similar to Xenopus Plx1 and S. pombe Plo1p; human homologs PLK1, PLK3 can each complement yeast cdc5 thermosensitive mutants [Source:SGD;Acc:S000004603])

HSP 1 Score: 65.4698 bits (158), Expect = 2.857e-11
Identity = 48/182 (26.37%), Postives = 91/182 (50.00%), Query Frame = 3
Query: 1140 LSHASLKS-----KFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTV--------YEIYGSENIYSAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPF 1646
            ++ AS+KS     K +  ++I + + + N+   I C+ D S++ ++ E C  GSL ++++ + V  + E +    T +   ++Y+H+ ++ +H  LK  N   D  + LKI D+GL  V        Y I G+ N        + APE+L   H  +  S + DI+S  +++  ++    PF
Sbjct:  112 VAKASIKSEKTRKKLLSEIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPEVRF-FTTQICGAIKYMHSRRV-IHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPN--------YIAPEVLMGKH--SGHSFEVDIWSLGVMLYALLIGKPPF 281          
BLAST of Guanylate cyclase vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 62.3882 bits (150), Expect = 2.770e-10
Identity = 54/236 (22.88%), Postives = 103/236 (43.64%), Query Frame = 3
Query: 1179 LRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGSENIYSAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEIL----NKIRKPPP---------LCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKK 1847
            + +++++ + N+    G       + ++ E+C  GSL+ +I   +  L      + +T  + G++Y+H   + +H  +K++N ++     +K+ D+G+ T   I  S  +  A  L W APE+L         S   DI+S    + E++T++ P+   N+T   I     N    PP          L +  V      P   Q++K  W  + E        N ++  LNK K+
Sbjct:   71 ISLLKNLNHNNIVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHGEGV-IHRDIKAANILLSADNTVKLADFGVST---IVNSSALTLAGTLNWMAPEILG----NRGASTLSDIWSLGATVVEMLTKNPPYH--NLTDANIYYAVENDTYYPPSSFSEPLKDFLSKCFVKNMYKRPTADQLLKHVWINSTE--------NVKVDKLNKFKE 288          
BLAST of Guanylate cyclase vs. Ensembl Yeast
Match: SPS1 (Putative protein serine/threonine kinase; localizes to the nucleus and cytoplasm; required for efficient spore packaging, prospore membrane development and closure and localization of enzymes involved in spore wall synthesis; interacts with and required for Ssp1p phosphorylation and turnover; member of the GCKIII subfamily of STE20 kinases; multiply phosphorylated on S/T residues; interacts with 14-3-3 proteins, Bmh1p and Bmh2p; expressed at the end of meiosis [Source:SGD;Acc:S000002931])

HSP 1 Score: 58.9214 bits (141), Expect = 2.211e-9
Identity = 52/205 (25.37%), Postives = 104/205 (50.73%), Query Frame = 3
Query: 1113 DFVHIKYLDLSHASLKSKFV-DHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLS-LMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGSENIYSAKDLLWTAPELLRVDHLRANG-SQKGDIYSFSIIMQEIITRDVPFGMMN-MTADEILNKIRKPPPLCRP 1715
            + V IK ++L H+    + +   +  + ++++  +   I   L+  S+ +V E+CG GS  D+++   VN   E K+S ++ ++  G++Y+H  Q K+H  +K++N +++   ++K+ D+G+          + +      W APE++  +    +G ++K DI+S  I   E++    P    + M     L K RKPP L  P
Sbjct:   42 EIVAIKVVNLEHSDEDIELLAQEIFFLAELKSPLITNYIATMLEDVSMWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLH-EQRKIHRDIKAANILLNEEGMVKLGDFGVSGHIRSTLKRDTFVGTP-YWMAPEVVCCE---VDGYNEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPK-RKPPKLQGP 240          
BLAST of Guanylate cyclase vs. Ensembl Yeast
Match: SKM1 (Member of the PAK family of serine/threonine protein kinases; similar to Ste20p; involved in down-regulation of sterol uptake; proposed to be a downstream effector of Cdc42p during polarized growth; SKM1 has a paralog, CLA4, that arose from the whole genome duplication [Source:SGD;Acc:S000005473])

HSP 1 Score: 56.9954 bits (136), Expect = 1.207e-8
Identity = 44/188 (23.40%), Postives = 90/188 (47.87%), Query Frame = 3
Query: 1110 GDFVHIKYLDLSHASLKSKFVDHLRIIRDIRNENVNPCIGCYL-DISSISMVFEHCGRGSLKDIIQ--------NKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGSENIYSAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPF 1646
            G+ V IK + LS    K   ++ L ++ D R EN+   +  Y+ D   + ++ E+   G L DI+           +  L+      ++ +  +G++++H  +I +H  +KS N +++ + ++KITD+G         S+         W APE++     +    +K D++S  I++ E+I  + P+
Sbjct:  400 GERVAIKQIRLSEQPKKQLIMNELLVMNDSRQENIVNFLEAYIIDDEELWVIMEYMEGGCLTDILDAVARSNTGEHSSPLNENQMAYIVKETCQGLKFLHNKKI-IHRDIKSDNILLNSQGLVKITDFGFCVELTEKRSKRATMVGTPYWMAPEIVN----QKGYDEKVDVWSLGIMLIEMIEGEPPY 582          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO34275 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7SPS9])

HSP 1 Score: 511.146 bits (1315), Expect = 3.202e-171
Identity = 264/507 (52.07%), Postives = 358/507 (70.61%), Query Frame = 3
Query: 1104 YNGDFVHIKYLDLSHASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGL------PTVYEIYGSENIYSAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTAD--EILNKI-RKPPPLCRPQVTQS--EAP--PAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELGGYHLELRGKVELKGKGIVDSYWLIGKD 2585
            Y  + V IK ++     L  +    ++++R +R+EN+    G  ++  +I ++ ++C +GSL+DI++N+++ LD  F  SL+TD+++GM Y+H+++I+ H RLKS NCVVDGRWVLKITDYGL        + E  G   +Y  K  LWTAPELLR    R  G+QKGD+YSF II+QE++TR  PF +   T +  +I+ K+ R   P  RP+++    E P     + + K  W EN + RP FEE+ + ++ L  GK+ NI+D+M  ++EKY+ +LE  V  RT +L  E++KTE L+ RMLP  VA+ L+ GK V  E+FDEV+I+FSDIVGFT++S+ S P+QVVDLLNDLYT+FD  I+ YDVYKVETIGDAYMV SGLPIRNG +HAGEIATMAL +L +  +FKIRH P+  L+LRIG+H+G CV GVVG  MPRYCLFGDTVNTASRMES+G A +IH+SP TK +LDELGGYH++ RGKV LKGKG   +YWL+G D
Sbjct:   14 YKSNMVAIKRINKRQIELTREIKYEMKLMRTVRHENLVTFTGACVEPPNICILLQYCPKGSLQDILENEDIKLDSMFVNSLLTDIVKGMAYLHSTEIRSHGRLKSPNCVVDGRWVLKITDYGLNKFKSNQDISEEEGEYAMYYRK--LWTAPELLRAADPRPRGTQKGDVYSFGIIVQELLTRSGPFDLSYYTNEPSDIIEKVTRVESPPFRPKLSTIVLEGPTVAGIVDLAKWCWEENPDHRPDFEEIRKTVRKLPMGKQSNIMDNMVNLLEKYANNLESLVEERTSQLADEKRKTENLLNRMLPPSVAKDLVHGKQVTAENFDEVSIFFSDIVGFTSLSSESTPLQVVDLLNDLYTLFDEIINNYDVYKVETIGDAYMVVSGLPIRNGHQHAGEIATMALHMLREIDSFKIRHRPNDKLKLRIGIHSGSCVAGVVGKKMPRYCLFGDTVNTASRMESNGEALKIHISPSTKRILDELGGYHIQKRGKVFLKGKGTWITYWLVGSD 518          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO30985 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7SZ80])

HSP 1 Score: 488.804 bits (1257), Expect = 4.653e-162
Identity = 259/492 (52.64%), Postives = 336/492 (68.29%), Query Frame = 3
Query: 1179 LRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGSENIYSA-KDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPP-PLCRPQVTQ-SEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDL--NKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCG-TFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELGGYHLELRGKVELKGKGIVDSYWLIG-----KDGFLKPLPVAPPA 2621
            ++ +RDIR++N+N  IG  +   ++ +V ++C RGSL+DI++N +V LD  F  SL++D+++GM Y+H S I+ H  LKSSNC+VD RWVLKITDYGLP +        I +  +DLLW APE+LR+      G+ KGD+YSFSII+QE  TRD P+    M    I+ K+RK   P  RP V    +       +MK+ W+E+ ++RP F E+ + ++ +    G K NI D+M  MME Y+ +LE  V  RTD+L  E++KT+ L+  +LPR VA+ L  GK VE ESF+EVTIYFSDIVGFT++SA S PMQVV  LNDLYT+FD  I  YDVYKVETIGDAYMVASGLPIRNGRRHAGEIA MAL L+      F +RH P+  L+LR+G HTGP V GVVG TM RYCLFGDTVNTASRMES+G   RIH+S  TK VLDELG + ++ RGKV LKGKG V+++WL+      +    + LP   PA
Sbjct:   23 MKQMRDIRHDNLNQFIGACVGPPNVCIVMQYCSRGSLQDILENDDVKLDLVFIASLLSDIVKGMEYLHNSDIRSHGNLKSSNCLVDSRWVLKITDYGLPLLRSRSKKSTIETNWRDLLWVAPEILRIPSRPPKGTHKGDVYSFSIILQEFHTRDGPYSANYMEPKAIIEKVRKSEFPPYRPIVANLIDGAEELRDLMKQCWAEDPDLRPDFTEIKKTVRRIVDKSGMKKNIFDNMVNMMEIYADNLENLVAQRTDQLVDEKRKTDALLESILPRPVAEQLKKGKAVEAESFNEVTIYFSDIVGFTSLSAESTPMQVVTFLNDLYTIFDDIIQEYDVYKVETIGDAYMVASGLPIRNGRRHAGEIAKMALHLVDAVSHNFIVRHKPEYKLQLRVGCHTGPVVAGVVGNTMARYCLFGDTVNTASRMESNGEPLRIHISQQTKDVLDELGTFVVKSRGKVHLKGKGTVETFWLVSTVDKNESWHTRALPTIEPA 514          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO36182 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7SJA4])

HSP 1 Score: 440.269 bits (1131), Expect = 2.761e-144
Identity = 234/502 (46.61%), Postives = 318/502 (63.35%), Query Frame = 3
Query: 1179 LRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVY-----EIYGSENIYSAKDLLWTAPELLRV-DHL--RANGSQKGDIYSFSIIMQEIITRDVPFGMMN--MTADEILNKIRK-PPPLCRPQVT---QSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELGGYHLELRGKVELKGKGIVDSYWLIGKDGFLKPLP----VAPPADSE 2630
            ++++RD+ + N+N  +G  ++  +I MV   C RG+L+D++ N ++ LDW F+ S   D+  GM  IH S I+ H  LKSSNC++D RW  KITDYGL  +      +  G   +Y  K+L WTAPELL + D    R N +Q GD+YS+ I++ EIITRD P+      +++ +++  +RK   P  RPQ +   + ++    +Q+ +  W  +A+ RP+F  + ++LK    G        +  M  +Y  +  + V  R       ++        +L R +A  L  G  V  ESF  VTI+FSDIVGFT+++A S P+QVVDLLN LYT FD  +D +DVYKVETIGDAYMV SGLP+RNG RHAGE+A+MAL+LLS+   F+I H+P   ++LRIG+H+G CV GVVGL MPRYCLFGDTVN ASRMESSG A RIHVSP  K VLD LGGYHL+ RG V +KGKG + +Y+L GKDGF KPLP     A  AD E
Sbjct:    1 MKMVRDLHHANLNRYLGVCVESPNICMVSRFCNRGTLQDLLGNDSIKLDWMFRQSFANDIATGMEAIHNSPIQAHGNLKSSNCLIDSRWACKITDYGLDLLRANQTPKDIGEFAVY--KNLFWTAPELLPLADGFKDRKNKTQAGDVYSYGIVLYEIITRDEPYSTNTDTLSSKDVIELVRKRQEPAFRPQFSKFMEEKSGHKMVQVTQDCWDNDAQKRPTFSAIKKKLKANGMGN-----GKISGMFSRYYNNFSKLVISRMGVCMALKRLL------VLSRPIADELKKGNSVSAESFQSVTIFFSDIVGFTSVAAQSTPLQVVDLLNQLYTRFDKVVDEHDVYKVETIGDAYMVVSGLPVRNGERHAGEVASMALNLLSEVRDFQIPHIPSRKVQLRIGIHSGSCVAGVVGLKMPRYCLFGDTVNYASRMESSGLALRIHVSPECKEVLDRLGGYHLDERGPVTMKGKGTIVTYFLTGKDGFDKPLPDVRYAAALADHE 489          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO36204 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7SJA3])

HSP 1 Score: 429.483 bits (1103), Expect = 3.591e-140
Identity = 238/492 (48.37%), Postives = 311/492 (63.21%), Query Frame = 3
Query: 1185 IIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYE-IYGSENIYSAK--DLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKP--PPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGL-----------HTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELGGYHLELRGKVELKGKGIVDSYWLIGKDGF--LKPLP 2606
            ++  + + N+NP IG  +   +I +V E CGRGSL D++ N ++ LDW FK+S  TD+  GM  +HAS++  H  L SSNC+VD  WV KI DYGL    +  Y  E   + +    LW APE +R  +  + GSQ GD+YSF +I+ EI+TR  PF  +  T   IL +I     PPL RP +   +  P   + +K+ WSE    RP+F ++ + ++ +N G+ + +VD M   M+ YS +LE  V  RT +LE E+ KT+ L+  MLPR VA  L +GK VE E FD+VT++FSDIVGFT +S+ S P+QVV  LNDLYT FD  I  YDVYKVETIGDAYMV SGLP +N  RHAGEIATMAL LL    TFKIRH+PD  L     L            +GP V GVVG+  PRY +FGDTVN ASRMES+G   RIH+S   +  L  LGGYH+E RG++ELKGKG V +Y+L GKDGF  ++P P
Sbjct:    1 MVHKLSHVNINPYIGVCITAPNICIVSEACGRGSLADVLINDDIKLDWTFKMSFATDIAAGMEALHASEVSFHGNLTSSNCLVDRMWVCKIADYGLQRFSKHTYEPEEQLTGQTGKSLWMAPEHMR--NASSTGSQPGDVYSFGVILSEIVTRCEPFETLRATT-SILRRIMSTEFPPL-RPTLNADDCDPTITKFIKQCWSEEPSARPTFRDIKKSMRKINGGRSLRLVDSMLGKMDIYSNNLEVLVEERTRQLEAEKAKTDQLLYEMLPRPVADQLKSGKSVEAELFDQVTVFFSDIVGFTKLSSSSTPIQVVTFLNDLYTYFDNIIPNYDVYKVETIGDAYMVVSGLPEKNRDRHAGEIATMALHLLCDIRTFKIRHVPDTRLVSSYSLLLIITCLFYLIFSGPAVAGVVGIKKPRYDVFGDTVNVASRMESNGVPNRIHISAECRKALLNLGGYHMERRGEIELKGKGKVITYFLNGKDGFNRVRPEP 488          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO27923 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7T7X3])

HSP 1 Score: 422.935 bits (1086), Expect = 1.957e-138
Identity = 219/430 (50.93%), Postives = 290/430 (67.44%), Query Frame = 3
Query: 1296 IIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGSENIYS---AKDLLWTAPELLRV-----DHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMN--MTADEILNKIRK-PPPLCRPQVT---QSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELGGYHLELRGKVELK 2543
            ++ N ++ LDW F+ S   D+  GM  IH S I+ H  LKSSNC++D RW  KITDYGL  +      ++I      ++L WT PELL +     DH   N +Q GD+YS+ I++ EIITRD P+      +++ +++  +RK   P  RPQ +   + ++    +Q+ +  W  +A+ RP+F  + ++LK    GK +NIVD+M  MM KY+  LE+ V  RT +L  E+ KT+ L+ +MLPR +A  L  G PV  ESF  VTI+FSDIVGFT+++A S P+QVVDLLN LYT FD  +D +DVYKVETIGDAYMV SGLP+RNG RHAGE+A+MAL+LLS+   F+I H+P   ++LRIG+H+G CV GVVGL MPRYCLFGDTVN ASRMESSG A RIHVSP  K VLD LGGYHL+ RG V +K
Sbjct:    2 LLGNDSIKLDWMFRQSFANDIATGMEAIHNSPIQAHGNLKSSNCLIDSRWACKITDYGLDLLRANQTPKDIGEFAVYRNLFWTVPELLPLADGFKDH--KNKTQAGDVYSYGIVLYEIITRDEPYSTNTDTLSSKDVIELVRKRQEPAFRPQFSKFMEEKSGHKMVQVTQDCWDNDAQKRPTFSAIKKKLKANGMGKNLNIVDNMITMMAKYTDQLEDIVEERTKQLAEEKAKTDELLYKMLPRPIADELKKGNPVSAESFQSVTIFFSDIVGFTSVAAQSTPLQVVDLLNQLYTRFDKVVDEHDVYKVETIGDAYMVVSGLPVRNGERHAGEVASMALNLLSEVRDFQIPHIPSRKVQLRIGIHSGSCVAGVVGLKMPRYCLFGDTVNYASRMESSGLALRIHVSPECKEVLDRLGGYHLDERGPVTMK 429          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: olgc-r1 (guanylate cyclase OlGC-R1 [Source:NCBI gene;Acc:100049189])

HSP 1 Score: 587.03 bits (1512), Expect = 0.000e+0
Identity = 291/519 (56.07%), Postives = 384/519 (73.99%), Query Frame = 3
Query: 1092 NTAKYNGDFVHIKYLDLSH-ASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIY-GSENIYSAKDLLWTAPELLR-VDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELG-GYHLELRGKVELKGKGIVDSYWLIGKDGFLKPLPVAPPADSEDN 2636
            + A Y GD+V +K  +      +K         ++D+RNENVNP +G +LD S  ++V EHC RGSL+D+++N++V LDW FK SL+ DLI+GM+Y+H  +   H RLKS NCVVDGR+VLKITDYG   + E           ++L WTAPELLR + H    G+ KGD+YSFSII+QE++ R  P+ M+ +  +EI+ K++KPPP+CRP V   +AP   IQ+MK+ WSE  + RP+FEE+  + K +NKGKK NI+D M +M+E+YS++LE+ +R RT+ELE E+++TE L++ MLP  VA +L  G  VEPE FD+VTIYFSDIVGFTTIS+LS+P++VVDLLNDLYT+FDA +  +DVYKVETIGDAYMVASGLP RNG +HA EIA M+L++LS  G+F +RHMPD+P+R+RIG+H+GPCV GVVGLTMPRYCLFGDTVNTASRMES+G  +RIHV+  T  +L  L  GY +++RGK ELKGKGI ++YWL+GK  F KPLP  P     DN
Sbjct:  560 SVAVYEGDWVWLKKFEEGQFKEVKQSTTKIFTKMKDLRNENVNPFLGFFLDCSMFAVVTEHCSRGSLQDLLRNEDVKLDWMFKSSLLLDLIKGMKYLHHREFP-HGRLKSRNCVVDGRFVLKITDYGFNELLESQKAPVEEPPPEELYWTAPELLRDLTHFH-KGTYKGDVYSFSIILQEVVVRGPPYCMLGLPPEEIIRKVKKPPPMCRPTVAPDQAPLECIQLMKQCWSEQPDRRPTFEEIFDRFKIINKGKKTNIIDSMLRMLEQYSSNLEDLIRERTEELEVEKQRTEKLLSEMLPPSVADTLKTGATVEPEYFDQVTIYFSDIVGFTTISSLSDPIEVVDLLNDLYTLFDAVLSNHDVYKVETIGDAYMVASGLPKRNGNKHAAEIANMSLNILSSVGSFHMRHMPDVPVRIRIGIHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNMSTVKILRSLNDGYKIDVRGKTELKGKGIEETYWLVGKTNFSKPLPKPPEIKPGDN 1076          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: olgc5 (guanylate cyclase OlGC5 [Source:NCBI gene;Acc:100125800])

HSP 1 Score: 583.178 bits (1502), Expect = 0.000e+0
Identity = 297/512 (58.01%), Postives = 384/512 (75.00%), Query Frame = 3
Query: 1092 NTAKYNGDFVHIKYLDLSHASLKSKFVDHLRI-IRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGSENI----YSAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELG-GYHLELRGKVELKGKGIVDSYWLIGKDGFLKPLPV 2609
            N A Y GD+V +K       S  S   + L + +RD+R+EN+N  +G + D     +V EHC RGSL+D++ N++V LDW FK SL+ DLIRGM+Y+H   I +H RLKS NCVVDGR+VLK+TDYG     EI  ++ +      A+DLLWTAPELLR  +LR  GS  GD+YSF+IIMQE+++R  PF M++M   EI++K+++ PPLCRP V+  EAP   IQ+MK+AWSE  + RP+FEE+ +Q K  +K KK NI+D M +M+E+YS++LE+ +R RT+ELE E++KT+ L+A+MLP+ VAQSL  GKPVEPE F EVT+YFSDIVGF+TIS LS P++VVDLLNDLY++FDA I  +DVYKVETIGDAYMVASG+P RNG RHA EIA M+LD+L   GTFK RHMPD+ +R+RIGLH+GP V GVVGLTMPRYCLFGDTVNT SRMES+ S +R+HV+  T  +L+ L  GY +++RG  ELKGKGI  +YWL+GKD F K LPV
Sbjct:  612 NIAVYEGDWVWLKKCPTGSVSSVSSSTEMLFVKLRDMRHENLNLYLGLFFDSGIFGIVTEHCIRGSLEDLLANEDVRLDWMFKSSLLMDLIRGMKYLHHRNI-IHGRLKSRNCVVDGRFVLKVTDYGFN---EIMNTQEVDVEEEKAEDLLWTAPELLRNLNLRRKGSFPGDVYSFAIIMQEVVSRSAPFCMLDMPPKEIISKVKESPPLCRPVVSVEEAPLDIIQLMKQAWSEEPDKRPTFEEIFKQFKGNSKAKKTNIIDSMLRMLEQYSSNLEDLIRERTEELEVERQKTDNLVAQMLPKSVAQSLKLGKPVEPEHFSEVTLYFSDIVGFSTISTLSEPIEVVDLLNDLYSLFDAIIPLHDVYKVETIGDAYMVASGVPTRNGNRHAAEIANMSLDILHCIGTFKARHMPDLKIRIRIGLHSGPVVAGVVGLTMPRYCLFGDTVNTTSRMESTSSPYRVHVNQSTVNLLNSLKLGYKIDVRGLTELKGKGIETTYWLVGKDDFKKSLPV 1119          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: olgc-r2 (guanylate cyclase OlGC-R2 [Source:NCBI gene;Acc:100216004])

HSP 1 Score: 582.022 bits (1499), Expect = 0.000e+0
Identity = 289/514 (56.23%), Postives = 380/514 (73.93%), Query Frame = 3
Query: 1092 NTAKYNGDFVHIKYL-DLSHASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEI----YGSENIYSAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELG-GYHLELRGKVELKGKGIVDSYWLIGKDGFLKPLPVAP 2615
            N   Y GD+  +K L + +  S+  K  D   +++D+R+EN+NP +G + D    ++V E C RGSL+D++ N +V LDW FK SL+ DLI+GM+Y+H   +  H RLKS NCVVDGR+VLK+TDYG   V E     Y  E     ++LLWTAPE+LR      +G+   D+YSF+IIMQE++ R  PF M++++  EI+ K+R+PPPLCRP V+   AP   IQ+MK+ W+E  + RP+F+++  Q K++NKG+K NI+D M +M+E+YS++LEE +R RT+ELE E++KTE L+ +MLP  VA++L+ G  V+PE FD V++YFSDIVGFTTISA S P++VVDLLNDLYT+FDA I  +DVYKVETIGDAYMVASG+P+ N  RHA EIA M+LD+LS  GTFK+RHMPD+P+R+RIGLHTGPCV GVVGLTMPRYCLFGDTV TASRMESSG  +RIHV      VL EL  GY LELRG+ E+KGKG  ++YWL+G+ GF KPLPV P
Sbjct:  572 NIVIYEGDWAWLKRLPNGNFGSINPKTSDVFELMKDMRHENINPFLGFFHDCGVFAIVTEFCSRGSLEDLLLNDDVKLDWMFKSSLLLDLIKGMKYLHHRGV-CHTRLKSRNCVVDGRFVLKVTDYGYNEVLESQRFPYAEER---PEELLWTAPEVLRSGQAGLHGTLPADVYSFAIIMQEVVIRGPPFCMLDLSDAEIIEKVRRPPPLCRPVVSPDYAPMECIQLMKQCWTETPDKRPTFDDIFDQFKNINKGRKTNIIDSMLRMLEQYSSNLEELIRERTEELEIEKQKTEKLLTQMLPPSVAEALMVGGTVKPEYFDSVSLYFSDIVGFTTISANSEPIEVVDLLNDLYTLFDAIIGNHDVYKVETIGDAYMVASGVPVPNANRHAAEIANMSLDILSAVGTFKMRHMPDVPVRIRIGLHTGPCVAGVVGLTMPRYCLFGDTVTTASRMESSGMPYRIHVHESIVKVLKELNLGYKLELRGRTEVKGKGTEETYWLVGRVGFTKPLPVPP 1081          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: olgc3 (membrane guanylyl cyclase [Source:NCBI gene;Acc:100192404])

HSP 1 Score: 552.362 bits (1422), Expect = 1.332e-179
Identity = 279/526 (53.04%), Postives = 387/526 (73.57%), Query Frame = 3
Query: 1092 NTAKYNGDFVHIKYLDL--SHASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGSENIY---SAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELG-GYHLELRGKVELKGKGIVDSYWLIGKDGFLKPLPVAPP-ADSEDNHGLA 2648
            N     GD+V +K + +  +  ++     +    +R++R+EN+N  +G ++D   +++V EHC RGSL D++ + +V LDW FK SL+ DLI+GM+Y+H   +  H RLKS+NC+VDGR+VLKITDYGLP + +   S+N+      +DLLWT+PELLR + +R  GS  GD++SFSII+QE+I+R +P+ MM+M A EI++++ KPPPLCRP V+  EAP   + +M   W+E+   RP+F+++ +Q + +++G++ NI+D M +M+E+YS++LE+ +R RTDELE E+ KTE L+ ++LP+ VAQ+L  GKPV+PE + + T+YFSDIVGFTTISALS P++VVDLLNDLYTMFDA I  +DVYKVETIGDAYMVASG+P RNG RHA E++ M+LD+L   G FKI+HMP+I +++RIGLH+GP V GVVGLTMPRYCLFGDTV TAS MESSG  +RIH+S  T  VL  L  GYH+E R   + + KG  D+YWL+G+DGF KPLPV P       NHG+A
Sbjct:  519 NIGILEGDWVWLKKIPIGKTTTAVNQNTQNLFSQLREMRHENLNLYLGLFVDSGILALVVEHCPRGSLADLLADSDVRLDWMFKSSLLMDLIKGMKYLHLRGL-THGRLKSTNCLVDGRFVLKITDYGLPMILQ---SQNLSLPEDPQDLLWTSPELLR-NPVRG-GSFAGDVFSFSIIIQEVISRTLPYAMMDMPAHEIVDRLMKPPPLCRPVVSVDEAPAECLNLMNECWNEDPTKRPTFDDIFKQFRGISRGRRANIIDSMLRMLEQYSSNLEDLIRERTDELEVERNKTEKLVGQLLPKSVAQALKKGKPVQPEHYSDCTLYFSDIVGFTTISALSEPIEVVDLLNDLYTMFDAIIASHDVYKVETIGDAYMVASGVPNRNGNRHAAEVSNMSLDILHSIGAFKIKHMPEIKVKIRIGLHSGPVVAGVVGLTMPRYCLFGDTVTTASLMESSGLPYRIHISLSTVKVLTSLKVGYHIETR---KAQVKGTEDTYWLMGRDGFNKPLPVPPDLIGGASNHGIA 1035          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: olgc3 (membrane guanylyl cyclase [Source:NCBI gene;Acc:100192404])

HSP 1 Score: 549.666 bits (1415), Expect = 9.197e-179
Identity = 275/514 (53.50%), Postives = 382/514 (74.32%), Query Frame = 3
Query: 1092 NTAKYNGDFVHIKYLDL--SHASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGSENIY---SAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELG-GYHLELRGKVELKGKGIVDSYWLIGKDGFLKPLPVAP 2615
            N     GD+V +K + +  +  ++     +    +R++R+EN+N  +G ++D   +++V EHC RGSL D++ + +V LDW FK SL+ DLI+GM+Y+H   +  H RLKS+NC+VDGR+VLKITDYGLP + +   S+N+      +DLLWT+PELLR + +R  GS  GD++SFSII+QE+I+R +P+ MM+M A EI++++ KPPPLCRP V+  EAP   + +M   W+E+   RP+F+++ +Q + +++G++ NI+D M +M+E+YS++LE+ +R RTDELE E+ KTE L+ ++LP+ VAQ+L  GKPV+PE + + T+YFSDIVGFTTISALS P++VVDLLNDLYTMFDA I  +DVYKVETIGDAYMVASG+P RNG RHA E++ M+LD+L   G FKI+HMP+I +++RIGLH+GP V GVVGLTMPRYCLFGDTV TAS MESSG  +RIH+S  T  VL  L  GYH+E R   + + KG  D+YWL+G+DGF KPLPV P
Sbjct:  519 NIGILEGDWVWLKKIPIGKTTTAVNQNTQNLFSQLREMRHENLNLYLGLFVDSGILALVVEHCPRGSLADLLADSDVRLDWMFKSSLLMDLIKGMKYLHLRGL-THGRLKSTNCLVDGRFVLKITDYGLPMILQ---SQNLSLPEDPQDLLWTSPELLR-NPVRG-GSFAGDVFSFSIIIQEVISRTLPYAMMDMPAHEIVDRLMKPPPLCRPVVSVDEAPAECLNLMNECWNEDPTKRPTFDDIFKQFRGISRGRRANIIDSMLRMLEQYSSNLEDLIRERTDELEVERNKTEKLVGQLLPKSVAQALKKGKPVQPEHYSDCTLYFSDIVGFTTISALSEPIEVVDLLNDLYTMFDAIIASHDVYKVETIGDAYMVASGVPNRNGNRHAAEVSNMSLDILHSIGAFKIKHMPEIKVKIRIGLHSGPVVAGVVGLTMPRYCLFGDTVTTASLMESSGLPYRIHISLSTVKVLTSLKVGYHIETR---KAQVKGTEDTYWLMGRDGFNKPLPVPP 1023          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000056474.1 (SMESG000056474.1)

HSP 1 Score: 1306.2 bits (3379), Expect = 0.000e+0
Identity = 672/672 (100.00%), Postives = 672/672 (100.00%), Query Frame = 3
Query: 1050 KSFSSGSLEGILDPNTAKYNGDFVHIKYLDLSHASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGSENIYSAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELGGYHLELRGKVELKGKGIVDSYWLIGKDGFLKPLPVAPPADSEDNHGLASVLKPDVLESIKSQHDHQSNTNPQSPDKTVSKDSKTLVAKRSDETKINSTEKSSTLNXXXXXXXXXXXXXXXXNYNSSDQVDLSKENSILKSQVPXXXXXXXXXXXXNNKKLPNINGGGGHNPYRKAPHIKEKITPVSE 3065
            KSFSSGSLEGILDPNTAKYNGDFVHIKYLDLSHASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGSENIYSAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDELETEQKKTELLIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELGGYHLELRGKVELKGKGIVDSYWLIGKDGFLKPLPVAPPADSEDNHGLASVLKPDVLESIKSQHDHQSNTNPQSPDKTVSKDSKTLVAKRSDETKINSTEKSSTLNKSGSKDSFKSSGGSDKNYNSSDQVDLSKENSILKSQVPSDSSMDSGYSGSNNKKLPNINGGGGHNPYRKAPHIKEKITPVSE
Sbjct:  496 KSFSSGSLEGILDPNTAKYNGDFVHIKYLDLSHASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGSENIYSAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPPPLCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDELETEQKKTELLIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELGGYHLELRGKVELKGKGIVDSYWLIGKDGFLKPLPVAPPADSEDNHGLASVLKPDVLESIKSQHDHQSNTNPQSPDKTVSKDSKTLVAKRSDETKINSTEKSSTLNKSGSKDSFKSSGGSDKNYNSSDQVDLSKENSILKSQVPSDSSMDSGYSGSNNKKLPNINGGGGHNPYRKAPHIKEKITPVSE 1167          

HSP 2 Score: 713.375 bits (1840), Expect = 0.000e+0
Identity = 349/349 (100.00%), Postives = 349/349 (100.00%), Query Frame = 2
Query:    2 SYTFFNTILRLLTNYTWSRILIVYDSTVEWRDRAYYLAYQLKTLNFTTAISTRINVSLALQSLSFKPQACLILANTSSVISLLNQLWTNYSTIFDGSMAFIFYDQYSFALDSVRLWENLFSSANGSYQNLPFQSLLIIAAHPKDSNYSTSITESFYNKQIQIGLAIAMVYGAESTNKSTFQSTNISFKPLPNSGITIVTDSLGHPIVDFYVFDVVTPSFKLLPVFYMKYPQYSIEIINSISWPNGVGPTPDNCFLKTCSTNLGFTAEQGLYLLAAFLIAGAVGLLIFYIIRYYNQKKQMKRGPNKIILFPEDIEFVKSVKTKSLLSIHNTGLGGLLANKETLKIASNDV 1048
            SYTFFNTILRLLTNYTWSRILIVYDSTVEWRDRAYYLAYQLKTLNFTTAISTRINVSLALQSLSFKPQACLILANTSSVISLLNQLWTNYSTIFDGSMAFIFYDQYSFALDSVRLWENLFSSANGSYQNLPFQSLLIIAAHPKDSNYSTSITESFYNKQIQIGLAIAMVYGAESTNKSTFQSTNISFKPLPNSGITIVTDSLGHPIVDFYVFDVVTPSFKLLPVFYMKYPQYSIEIINSISWPNGVGPTPDNCFLKTCSTNLGFTAEQGLYLLAAFLIAGAVGLLIFYIIRYYNQKKQMKRGPNKIILFPEDIEFVKSVKTKSLLSIHNTGLGGLLANKETLKIASNDV
Sbjct:  146 SYTFFNTILRLLTNYTWSRILIVYDSTVEWRDRAYYLAYQLKTLNFTTAISTRINVSLALQSLSFKPQACLILANTSSVISLLNQLWTNYSTIFDGSMAFIFYDQYSFALDSVRLWENLFSSANGSYQNLPFQSLLIIAAHPKDSNYSTSITESFYNKQIQIGLAIAMVYGAESTNKSTFQSTNISFKPLPNSGITIVTDSLGHPIVDFYVFDVVTPSFKLLPVFYMKYPQYSIEIINSISWPNGVGPTPDNCFLKTCSTNLGFTAEQGLYLLAAFLIAGAVGLLIFYIIRYYNQKKQMKRGPNKIILFPEDIEFVKSVKTKSLLSIHNTGLGGLLANKETLKIASNDV 494          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000065837.1 (SMESG000065837.1)

HSP 1 Score: 448.743 bits (1153), Expect = 8.253e-143
Identity = 246/515 (47.77%), Postives = 330/515 (64.08%), Query Frame = 3
Query: 1098 AKYNGDFVHIKYLDLSHASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGS-------------ENIYSAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNM--TADEILNKIRKPPP----LCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELGGYHLELRGKVELKGKGIVDSYWLIGKD 2585
              Y G  V IK+L+     L  KF   ++  +D+  EN+N  IG  LD  +I ++  +C RGSLKDI+ NK++ LD  F  SL+ DLI+GM Y+H SQI  H  L++S C++D RW+L+IT +GL ++   Y S             E  Y    LLW +PE L+  +  + GSQKGDIYSF+II  E+  +  P+G +     A EI+ K++          RP + +++ P      +   W + +E RP F+ +   LK L KG + NI D+M  +MEKY+ +LE  V  RT +L  E+KK E L+ RMLP+ V + L  G+ V PE +  VTIYFSDIVGFT++SA S PM+VV +LNDLYT+FD+ I  YDVYKVETIGDAYMV SGLP+RN   HAGEIA+++L LL    +F IRH P+  L+LRIG+H+GPCV GVVGL MPRYCLFGDTVNTASRME++G A +IH S  TK +LD LGGY L  RG +E+KGKG + +Y+L  +D
Sbjct:  172 GSYKGMIVSIKFLNHKSIELTRKFRQEMQFFKDMNQENLNRIIGVCLDPPNICILTLYCSRGSLKDILSNKDIFLDEIFVASLLFDLIKGMIYLHDSQINYHGNLRTSKCLIDSRWILQITGFGLQSIR--YASPKDPSNWPHSLDAEKYYYK--LLWKSPEHLKEPYPMSRGSQKGDIYSFAIIFHELTHQTGPWGSIYRPGNATEIIRKLKNETSNELSSMRPIIDETQVPNFVKDCLTECWDDVSERRPDFKFIRVILKPLLKGLRSNIFDNMLLIMEKYAKNLEVLVEERTWQLSEEKKKIERLLLRMLPKSVTEQLKVGQTVIPEHYSCVTIYFSDIVGFTSLSASSTPMEVVQMLNDLYTLFDSIIIEYDVYKVETIGDAYMVVSGLPMRNADLHAGEIASLSLHLLKAIKSFVIRHRPNETLKLRIGIHSGPCVAGVVGLKMPRYCLFGDTVNTASRMEATGEALKIHTSSETKFLLDALGGYCLIKRGNIEVKGKGDMITYFLESED 682          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000065837.1 (SMESG000065837.1)

HSP 1 Score: 449.899 bits (1156), Expect = 2.263e-141
Identity = 246/513 (47.95%), Postives = 330/513 (64.33%), Query Frame = 3
Query: 1104 YNGDFVHIKYLDLSHASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGS-------------ENIYSAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNM--TADEILNKIRKPPP----LCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELGGYHLELRGKVELKGKGIVDSYWLIGKD 2585
            Y G  V IK+L+     L  KF   ++  +D+  EN+N  IG  LD  +I ++  +C RGSLKDI+ NK++ LD  F  SL+ DLI+GM Y+H SQI  H  L++S C++D RW+L+IT +GL ++   Y S             E  Y    LLW +PE L+  +  + GSQKGDIYSF+II  E+  +  P+G +     A EI+ K++          RP + +++ P      +   W + +E RP F+ +   LK L KG + NI D+M  +MEKY+ +LE  V  RT +L  E+KK E L+ RMLP+ V + L  G+ V PE +  VTIYFSDIVGFT++SA S PM+VV +LNDLYT+FD+ I  YDVYKVETIGDAYMV SGLP+RN   HAGEIA+++L LL    +F IRH P+  L+LRIG+H+GPCV GVVGL MPRYCLFGDTVNTASRME++G A +IH S  TK +LD LGGY L  RG +E+KGKG + +Y+L  +D
Sbjct:  336 YKGMIVSIKFLNHKSIELTRKFRQEMQFFKDMNQENLNRIIGVCLDPPNICILTLYCSRGSLKDILSNKDIFLDEIFVASLLFDLIKGMIYLHDSQINYHGNLRTSKCLIDSRWILQITGFGLQSIR--YASPKDPSNWPHSLDAEKYYYK--LLWKSPEHLKEPYPMSRGSQKGDIYSFAIIFHELTHQTGPWGSIYRPGNATEIIRKLKNETSNELSSMRPIIDETQVPNFVKDCLTECWDDVSERRPDFKFIRVILKPLLKGLRSNIFDNMLLIMEKYAKNLEVLVEERTWQLSEEKKKIERLLLRMLPKSVTEQLKVGQTVIPEHYSCVTIYFSDIVGFTSLSASSTPMEVVQMLNDLYTLFDSIIIEYDVYKVETIGDAYMVVSGLPMRNADLHAGEIASLSLHLLKAIKSFVIRHRPNETLKLRIGIHSGPCVAGVVGLKMPRYCLFGDTVNTASRMEATGEALKIHTSSETKFLLDALGGYCLIKRGNIEVKGKGDMITYFLESED 844          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000065837.1 (SMESG000065837.1)

HSP 1 Score: 449.899 bits (1156), Expect = 2.466e-141
Identity = 246/513 (47.95%), Postives = 330/513 (64.33%), Query Frame = 3
Query: 1104 YNGDFVHIKYLDLSHASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYEIYGS-------------ENIYSAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNM--TADEILNKIRKPPP----LCRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELGGYHLELRGKVELKGKGIVDSYWLIGKD 2585
            Y G  V IK+L+     L  KF   ++  +D+  EN+N  IG  LD  +I ++  +C RGSLKDI+ NK++ LD  F  SL+ DLI+GM Y+H SQI  H  L++S C++D RW+L+IT +GL ++   Y S             E  Y    LLW +PE L+  +  + GSQKGDIYSF+II  E+  +  P+G +     A EI+ K++          RP + +++ P      +   W + +E RP F+ +   LK L KG + NI D+M  +MEKY+ +LE  V  RT +L  E+KK E L+ RMLP+ V + L  G+ V PE +  VTIYFSDIVGFT++SA S PM+VV +LNDLYT+FD+ I  YDVYKVETIGDAYMV SGLP+RN   HAGEIA+++L LL    +F IRH P+  L+LRIG+H+GPCV GVVGL MPRYCLFGDTVNTASRME++G A +IH S  TK +LD LGGY L  RG +E+KGKG + +Y+L  +D
Sbjct:  340 YKGMIVSIKFLNHKSIELTRKFRQEMQFFKDMNQENLNRIIGVCLDPPNICILTLYCSRGSLKDILSNKDIFLDEIFVASLLFDLIKGMIYLHDSQINYHGNLRTSKCLIDSRWILQITGFGLQSIR--YASPKDPSNWPHSLDAEKYYYK--LLWKSPEHLKEPYPMSRGSQKGDIYSFAIIFHELTHQTGPWGSIYRPGNATEIIRKLKNETSNELSSMRPIIDETQVPNFVKDCLTECWDDVSERRPDFKFIRVILKPLLKGLRSNIFDNMLLIMEKYAKNLEVLVEERTWQLSEEKKKIERLLLRMLPKSVTEQLKVGQTVIPEHYSCVTIYFSDIVGFTSLSASSTPMEVVQMLNDLYTLFDSIIIEYDVYKVETIGDAYMVVSGLPMRNADLHAGEIASLSLHLLKAIKSFVIRHRPNETLKLRIGIHSGPCVAGVVGLKMPRYCLFGDTVNTASRMEATGEALKIHTSSETKFLLDALGGYCLIKRGNIEVKGKGDMITYFLESED 848          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000056411.1 (SMESG000056411.1)

HSP 1 Score: 433.721 bits (1114), Expect = 1.111e-133
Identity = 237/518 (45.75%), Postives = 340/518 (65.64%), Query Frame = 3
Query: 1095 TAKYNGDFVHIKYLDLS-HASLKSKFVDHLRIIRDIRNENVNPCIGCYLDISSISMVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHARLKSSNCVVDGRWVLKITDYGLPTVYE-----IYGSENIYSAKDLLWTAPELLRVDHLRANGSQKGDIYSFSIIMQEIITRDVPFGMM---NMTADEILNKIR-KPPPLCRPQVTQSEA-PPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKM-NIVDHMFKMMEKYSADLEEQVRVRTDXXXXXXXXXXXXIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELGGYHLELRGKVELKGKGIVDSYWLIGKDG-FLKPLPV 2609
            TA + G+ V +K ++++    + ++ +  ++ I+D+ N+++   IG  LD   I  V+E+C +GSL+D++  + + LDW FK SLM D+ RGM Y+H +    H  LKSSNC+VD R+VLKITD+GLP++       ++   N+Y  K  LWTAPELL + +   NG+ KGD+YSF++I QEI+ R+  F +    N+T+ EI  K+R K  P  RP +  ++      ++++++AW E+   RP F  +   ++ LNKG    NI+D++   ME+Y+ +LE  V  RT++   E++K E L+  MLP+ VA  L+  + V  ES+D VTI+FSDIVGFT +SA S PMQ+++LLN LYT FD+ I+ YDVYKVETIGDAYMV SGLP  NG  H+ EIA M++  L     F I H PD  L LRIG+H+GP  +GVVGL MPRYCLFGDTVNT+SRMES+G   +IH+S  TK +LD  G + +  RG ++LKGKG+  +YWL G+D   + PLPV
Sbjct:  641 TALFKGNLVALKPINVNGKIEITTELLIEIKKIKDMSNDHICRFIGVCLDHPYI--VYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMY-YKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGEDSNIVDPLPV 1154          
The following BLAST results are available for this feature:
BLAST of Guanylate cyclase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GUCY2F0.000e+058.27guanylate cyclase 2F, retinal [Source:HGNC Symbol;... [more]
GUCY2D3.183e-18051.82guanylate cyclase 2D, retinal [Source:HGNC Symbol;... [more]
NPR11.653e-15850.70natriuretic peptide receptor 1 [Source:HGNC Symbol... [more]
NPR21.719e-15550.89natriuretic peptide receptor 2 [Source:HGNC Symbol... [more]
GUCY2C3.431e-12141.16guanylate cyclase 2C [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gcy-281.318e-13145.80Receptor-type guanylate cyclase gcy-28 [Source:Un... [more]
gcy-282.340e-13145.80Receptor-type guanylate cyclase gcy-28 [Source:Un... [more]
gcy-284.308e-13145.80Receptor-type guanylate cyclase gcy-28 [Source:Un... [more]
gcy-222.242e-12644.96Receptor-type guanylate cyclase gcy-22 [Source:Un... [more]
gcy-222.269e-12644.96Receptor-type guanylate cyclase gcy-22 [Source:Un... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG343570.000e+054.99gene:FBgn0085386 transcript:FBtr0474144[more]
CG343570.000e+054.99gene:FBgn0085386 transcript:FBtr0335239[more]
CG343570.000e+054.99gene:FBgn0085386 transcript:FBtr0303867[more]
CG426372.536e-14950.98gene:FBgn0261360 transcript:FBtr0302277[more]
CG426372.536e-14950.98gene:FBgn0261360 transcript:FBtr0302279[more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gucy2d0.000e+056.42guanylate cyclase 2D, retinal [Source:ZFIN;Acc:ZDB... [more]
gc20.000e+057.85guanylyl cyclase 2 [Source:ZFIN;Acc:ZDB-GENE-01112... [more]
gc20.000e+057.85guanylyl cyclase 2 [Source:ZFIN;Acc:ZDB-GENE-01112... [more]
gucy2d0.000e+056.29guanylate cyclase 2D, retinal [Source:ZFIN;Acc:ZDB... [more]
gucy2d0.000e+056.29guanylate cyclase 2D, retinal [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc8a30.000e+056.82solute carrier family 8 (sodium/calcium exchanger)... [more]
ENSXETT00000002786.10.000e+057.30retinal guanylyl cyclase 2-like [Source:NCBI gene;... [more]
ENSXETT00000002946.10.000e+057.30retinal guanylyl cyclase 2-like [Source:NCBI gene;... [more]
ENSXETT00000002882.10.000e+057.30retinal guanylyl cyclase 2-like [Source:NCBI gene;... [more]
slc8a30.000e+056.60solute carrier family 8 (sodium/calcium exchanger)... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gucy2f0.000e+057.30guanylate cyclase 2f [Source:MGI Symbol;Acc:MGI:10... [more]
Gucy2e0.000e+052.60guanylate cyclase 2e [Source:MGI Symbol;Acc:MGI:10... [more]
Gucy2e0.000e+052.60guanylate cyclase 2e [Source:MGI Symbol;Acc:MGI:10... [more]
Gucy2e0.000e+052.60guanylate cyclase 2e [Source:MGI Symbol;Acc:MGI:10... [more]
Gucy2d1.986e-18054.89guanylate cyclase 2d [Source:MGI Symbol;Acc:MGI:10... [more]
back to top
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P51842|GUC2F_RAT0.000e+057.27Retinal guanylyl cyclase 2 OS=Rattus norvegicus OX... [more]
sp|P51841|GUC2F_HUMAN0.000e+058.27Retinal guanylyl cyclase 2 OS=Homo sapiens OX=9606... [more]
sp|Q5SDA5|GUC2F_MOUSE0.000e+057.30Retinal guanylyl cyclase 2 OS=Mus musculus OX=1009... [more]
sp|O02740|GUC2F_BOVIN0.000e+057.35Retinal guanylyl cyclase 2 OS=Bos taurus OX=9913 G... [more]
sp|P52785|GUC2E_MOUSE0.000e+052.60Retinal guanylyl cyclase 1 OS=Mus musculus OX=1009... [more]
back to top
BLAST of Guanylate cyclase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q0KKX90.000e+070.88Guanylate cyclase OS=Schistosoma mansoni OX=6183 P... [more]
A0A094ZE640.000e+070.85Guanylate cyclase OS=Schistosoma haematobium OX=61... [more]
A0A183JWZ20.000e+068.14Guanylate cyclase OS=Schistosoma curassoni OX=6186... [more]
A0A504YKG04.171e-972.81Guanylate cyclase OS=Fasciola gigantica OX=46835 G... [more]
A0A4E0R4E81.260e-972.63Guanylate cyclase OS=Fasciola hepatica OX=6192 GN=... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000020840.20.000e+057.63retinal guanylyl cyclase 2 [Source:NCBI gene;Acc:1... [more]
gucy2f0.000e+056.32retinal guanylyl cyclase 2-like [Source:NCBI gene;... [more]
gucy2f0.000e+056.18retinal guanylyl cyclase 2-like [Source:NCBI gene;... [more]
gc20.000e+057.09retinal guanylyl cyclase 2 [Source:NCBI gene;Acc:1... [more]
npr1a9.755e-15349.41natriuretic peptide receptor 1a [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NPR11.211e-15848.81natriuretic peptide receptor 1 [Source:HGNC Symbol... [more]
ENSPMAT00000006352.15.622e-15850.80pep scaffold:Pmarinus_7.0:GL477176:19246:83539:-1 ... [more]
ENSPMAT00000008976.15.817e-12645.78pep scaffold:Pmarinus_7.0:GL476454:105373:131710:-... [more]
ENSPMAT00000008942.11.881e-12545.05pep scaffold:Pmarinus_7.0:GL476454:59555:94399:-1 ... [more]
ENSPMAT00000008986.19.399e-12546.36pep scaffold:Pmarinus_7.0:GL476454:105373:128493:-... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CLA41.219e-1126.88Cdc42p-activated signal transducing kinase; member... [more]
CDC52.857e-1126.37Polo-like kinase; controls targeting and activatio... [more]
CDC152.770e-1022.88Protein kinase of the Mitotic Exit Network; locali... [more]
SPS12.211e-925.37Putative protein serine/threonine kinase; localize... [more]
SKM11.207e-823.40Member of the PAK family of serine/threonine prote... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO342753.202e-17152.07Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO309854.653e-16252.64Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361822.761e-14446.61Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362043.591e-14048.37Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO279231.957e-13850.93Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
olgc-r10.000e+056.07guanylate cyclase OlGC-R1 [Source:NCBI gene;Acc:10... [more]
olgc50.000e+058.01guanylate cyclase OlGC5 [Source:NCBI gene;Acc:1001... [more]
olgc-r20.000e+056.23guanylate cyclase OlGC-R2 [Source:NCBI gene;Acc:10... [more]
olgc31.332e-17953.04membrane guanylyl cyclase [Source:NCBI gene;Acc:10... [more]
olgc39.197e-17953.50membrane guanylyl cyclase [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Guanylate cyclase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000056474.10.000e+0100.00SMESG000056474.1[more]
SMESG000065837.18.253e-14347.77SMESG000065837.1[more]
SMESG000065837.12.263e-14147.95SMESG000065837.1[more]
SMESG000065837.12.466e-14147.95SMESG000065837.1[more]
SMESG000056411.11.111e-13345.75SMESG000056411.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035633 ID=SMED30035633|Name=Guanylate cyclase|organism=Schmidtea mediterranea sexual|type=transcript|length=3128bp
TTCATACACGTTTTTTAATACTATTTTACGACTTTTGACAAACTATACAT
GGAGTCGAATACTGATCGTATACGATTCGACAGTAGAATGGAGAGATCGG
GCTTATTATTTGGCATATCAACTTAAAACGCTCAATTTTACAACAGCTAT
CAGCACCAGAATAAACGTTAGTTTAGCTTTACAGAGTTTATCATTTAAAC
CACAAGCTTGCCTTATTTTGGCGAATACTTCCTCAGTTATTAGTCTACTA
AATCAATTGTGGACAAACTACTCAACCATCTTTGATGGATCCATGGCTTT
CATATTTTATGACCAATATTCCTTTGCTCTCGATTCGGTACGATTGTGGG
AAAATCTTTTTAGTTCTGCAAATGGTTCTTATCAGAATTTACCGTTTCAA
TCTTTATTAATTATCGCGGCACATCCAAAAGATTCCAACTATTCCACGAG
TATTACAGAAAGCTTTTACAATAAACAAATTCAAATAGGTTTAGCAATAG
CTATGGTTTATGGGGCTGAAAGCACAAATAAATCGACTTTTCAAAGCACC
AATATTTCATTCAAACCGTTACCTAATAGCGGTATAACAATTGTTACAGA
CTCCCTTGGACACCCTATTGTTGACTTCTACGTGTTCGATGTTGTCACTC
CATCATTTAAACTACTCCCAGTGTTTTATATGAAATATCCTCAGTACTCT
ATTGAGATTATCAATTCGATTTCATGGCCCAATGGAGTTGGACCAACACC
AGATAATTGTTTTTTGAAGACTTGCTCAACAAACCTAGGATTCACTGCAG
AACAAGGTTTATATTTATTAGCTGCTTTTCTCATCGCTGGTGCAGTGGGT
CTTTTGATTTTCTACATTATCCGATATTACAATCAAAAGAAACAGATGAA
AAGAGGCCCAAATAAAATAATTCTTTTCCCTGAAGACATTGAATTTGTTA
AATCTGTTAAAACGAAGAGTCTTTTAAGTATACACAATACAGGATTAGGG
GGTCTGCTGGCTAATAAAGAAACACTGAAAATCGCTTCAAATGATGTAAA
AGTCATTTAGTTCAGGAAGCTTAGAGGGGATTTTGGATCCTAATACTGCA
AAATATAATGGTGATTTTGTTCATATCAAGTACTTGGATCTGAGCCATGC
TAGTTTGAAATCTAAATTTGTGGATCATTTGAGAATTATTCGTGATATCC
GAAATGAAAACGTGAATCCTTGCATAGGCTGTTATTTGGACATAAGTTCA
ATCAGTATGGTCTTCGAACATTGTGGACGTGGCAGCCTTAAGGATATTAT
CCAAAACAAAAATGTCAATCTGGACTGGGAATTTAAGTTATCCTTGATGA
CTGATCTGATCAGAGGAATGCGTTATATTCATGCATCTCAAATTAAAGTT
CACGCGAGACTGAAATCTTCTAATTGCGTCGTTGACGGAAGGTGGGTATT
GAAAATAACAGATTACGGCTTACCAACCGTTTATGAAATTTATGGATCAG
AAAATATATACAGTGCAAAAGATTTATTGTGGACCGCTCCAGAATTATTG
AGAGTAGACCATCTTCGTGCAAATGGCTCACAGAAAGGGGATATTTATTC
CTTTTCAATAATTATGCAAGAGATTATTACTAGAGATGTTCCATTTGGAA
TGATGAATATGACTGCTGATGAAATTCTGAACAAAATTAGAAAGCCACCG
CCATTGTGTAGGCCTCAGGTCACTCAATCTGAGGCCCCTCCAGCATATAT
TCAGATAATGAAACGAGCTTGGTCAGAAAACGCTGAAATGAGGCCGTCAT
TTGAGGAACTGAATCAACAACTGAAAGATCTCAACAAAGGAAAAAAAATG
AATATCGTTGATCACATGTTTAAAATGATGGAGAAATATTCGGCAGACCT
TGAGGAACAAGTACGTGTAAGAACAGATGAACTCGAAACCGAACAGAAGA
AAACAGAACTATTAATTGCACGTATGCTTCCAAGGATGGTAGCACAGAGT
TTATTGGCTGGAAAACCAGTAGAACCGGAATCTTTTGATGAAGTAACTAT
ATATTTCAGTGACATAGTTGGATTCACAACCATTTCCGCTCTGTCAAACC
CAATGCAAGTTGTAGATTTGCTGAATGATCTTTATACAATGTTTGATGCA
ACGATTGACTTTTATGATGTGTATAAGGTTGAAACCATTGGTGATGCGTA
CATGGTTGCATCAGGTCTTCCAATTCGGAATGGTAGAAGGCATGCGGGTG
AAATAGCTACAATGGCTTTGGATTTATTAAGTCAATGTGGCACATTTAAA
ATTCGACATATGCCTGATATTCCTTTACGATTACGAATCGGCCTTCATAC
AGGTCCATGTGTGACAGGTGTAGTCGGATTAACTATGCCTAGGTACTGTT
TATTTGGAGACACTGTCAACACTGCGTCTAGGATGGAATCATCTGGCTCA
GCATTCCGAATACATGTGAGTCCTTTCACAAAAGTCGTATTAGATGAATT
AGGAGGGTATCATCTTGAATTGAGAGGAAAAGTAGAACTGAAAGGCAAAG
GTATTGTAGACTCATATTGGTTAATAGGAAAAGATGGTTTTCTAAAACCT
CTTCCAGTTGCACCACCTGCTGATTCAGAAGATAATCATGGGCTAGCGTC
CGTTCTTAAACCAGATGTCCTCGAATCTATAAAATCTCAACACGACCACC
AGTCAAACACAAATCCACAAAGCCCTGATAAAACCGTTAGCAAAGATAGC
AAAACTTTAGTGGCAAAAAGGTCAGATGAAACTAAAATAAACTCTACTGA
AAAATCATCAACCTTAAACAAGAGTGGTAGCAAAGACAGTTTCAAAAGTT
CTGGTGGGTCTGATAAAAATTATAATTCTTCCGACCAAGTCGATTTATCC
AAAGAAAATTCTATTCTAAAATCACAAGTTCCATCCGACAGTTCAATGGA
TAGCGGATATTCTGGTTCCAATAATAAGAAACTTCCAAACATCAATGGTG
GTGGTGGTCATAACCCATATAGAAAAGCGCCTCATATAAAAGAAAAAATA
ACTCCAGTTTCTGAATGAATTAGTTATAAATCCAAACTTATACACATTTA
TTATCTAATTAACGAAATACTTAGCGCG
back to top

protein sequence of SMED30035633-orf-1

>SMED30035633-orf-1 ID=SMED30035633-orf-1|Name=SMED30035633-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=604bp
MVFEHCGRGSLKDIIQNKNVNLDWEFKLSLMTDLIRGMRYIHASQIKVHA
RLKSSNCVVDGRWVLKITDYGLPTVYEIYGSENIYSAKDLLWTAPELLRV
DHLRANGSQKGDIYSFSIIMQEIITRDVPFGMMNMTADEILNKIRKPPPL
CRPQVTQSEAPPAYIQIMKRAWSENAEMRPSFEELNQQLKDLNKGKKMNI
VDHMFKMMEKYSADLEEQVRVRTDELETEQKKTELLIARMLPRMVAQSLL
AGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATI
DFYDVYKVETIGDAYMVASGLPIRNGRRHAGEIATMALDLLSQCGTFKIR
HMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAF
RIHVSPFTKVVLDELGGYHLELRGKVELKGKGIVDSYWLIGKDGFLKPLP
VAPPADSEDNHGLASVLKPDVLESIKSQHDHQSNTNPQSPDKTVSKDSKT
LVAKRSDETKINSTEKSSTLNKSGSKDSFKSSGGSDKNYNSSDQVDLSKE
NSILKSQVPSDSSMDSGYSGSNNKKLPNINGGGGHNPYRKAPHIKEKITP
VSE*
back to top

protein sequence of SMED30035633-orf-2

>SMED30035633-orf-2 ID=SMED30035633-orf-2|Name=SMED30035633-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=353bp
SYTFFNTILRLLTNYTWSRILIVYDSTVEWRDRAYYLAYQLKTLNFTTAI
STRINVSLALQSLSFKPQACLILANTSSVISLLNQLWTNYSTIFDGSMAF
IFYDQYSFALDSVRLWENLFSSANGSYQNLPFQSLLIIAAHPKDSNYSTS
ITESFYNKQIQIGLAIAMVYGAESTNKSTFQSTNISFKPLPNSGITIVTD
SLGHPIVDFYVFDVVTPSFKLLPVFYMKYPQYSIEIINSISWPNGVGPTP
DNCFLKTCSTNLGFTAEQGLYLLAAFLIAGAVGLLIFYIIRYYNQKKQMK
RGPNKIILFPEDIEFVKSVKTKSLLSIHNTGLGGLLANKETLKIASNDVK
VI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR028082Peripla_BP_I
IPR001054A/G_cyclase
IPR001245Ser-Thr/Tyr_kinase_cat_dom
IPR018297A/G_cyclase_CS
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom_sf
IPR029787Nucleotide_cyclase
Vocabulary: molecular function
TermDefinition
GO:0016849phosphorus-oxygen lyase activity
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004383guanylate cyclase activity
GO:0016829lyase activity
Vocabulary: biological process
TermDefinition
GO:0035556intracellular signal transduction
GO:0009190cyclic nucleotide biosynthetic process
GO:0006468protein phosphorylation
GO:0006182cGMP biosynthetic process
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR028082Periplasmic binding protein-like ISUPERFAMILYSSF53822Periplasmic binding protein-like Icoord: 6..252
NoneNo IPR availableTMHMMTMhelixcoord: 270..292