GRIP domain-containing protein

Overview
NameGRIP domain-containing protein
Smed IDSMED30035627
Length (bp)6809
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GRIP domain-containing protein (SMED30035627) t-SNE clustered cells

Violin plots show distribution of expression levels for GRIP domain-containing protein (SMED30035627) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GRIP domain-containing protein (SMED30035627) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GRIP domain-containing protein (SMED30035627) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035627

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30035627SMESG000017888.1 dd_Smed_v4_10306_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035627SMESG000017888.1 dd_Smed_v4_10306_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GRIP domain-containing protein vs. Ensembl Human
Match: GOLGA4 (golgin A4 [Source:HGNC Symbol;Acc:HGNC:4427])

HSP 1 Score: 80.1073 bits (196), Expect = 5.166e-14
Identity = 61/199 (30.65%), Postives = 111/199 (55.78%), Query Frame = 1
Query:  349 SEFDDSAYGGDTCSKEELFQRYQRAQTLARRFKTRFLEAAESCKKFESENNKLTRTLTDSQDKQIRRINELKEQVELDKKAKQDVEENYVLMIEEKTEMVNVLKLQVSLLKEG-KDLP---------PELEEQIKLKHEVE--------VLLEKQKQDEIKELKNSLSQRENLLQRCKDKINSLNSQLNELKSKFATMQ 891
            SE +D     D+ +KE+L QR +R +     ++ ++ E   + +  + E  KL   L+ SQDK +RRI EL+E++++D++AK+ ++E +   +EEK + ++VL+ QVSLLK+  ++ P         P+LE Q ++  + E        V+ +      ++ L+  + ++ENLL+RCK+ I S   Q   L S+   +Q
Sbjct:  144 SEAEDLVGNSDSLNKEQLIQRLRRMERSLSSYRGKYSELVTAYQMLQREKKKLQGILSQSQDKSLRRIAELREELQMDQQAKKHLQEEFDASLEEKDQYISVLQTQVSLLKQRLRNGPMNVDVLKPLPQLEPQAEVFTKEENPESDGEPVVEDGTSVKTLETLQQRVKRQENLLKRCKETIQSHKEQCTLLTSEKEALQ 342          

HSP 2 Score: 58.9214 bits (141), Expect = 1.662e-7
Identity = 26/68 (38.24%), Postives = 41/68 (60.29%), Query Frame = 1
Query: 6202 YRSPNTSCSDYTFCPIPITEATDYEYLHDVLLKYMTGMETEILAKVVCTVMKFSNEETSRVLCFEQDR 6405
            Y+  N   +D +    P    T++EYL  VL +YM G ET+ +AKV+ TV+KF +++T ++L  E  R
Sbjct: 2171 YKGGNLYHTDVSLFGEP----TEFEYLRKVLFEYMMGRETKTMAKVITTVLKFPDDQTQKILEREDAR 2234          
BLAST of GRIP domain-containing protein vs. Ensembl Human
Match: GOLGA4 (golgin A4 [Source:HGNC Symbol;Acc:HGNC:4427])

HSP 1 Score: 80.1073 bits (196), Expect = 5.953e-14
Identity = 80/296 (27.03%), Postives = 146/296 (49.32%), Query Frame = 1
Query:  349 SEFDDSAYGGDTCSKEELFQRYQRAQTLARRFKTRFLEAAESCKKFESENNKLTRTLTDSQDKQIRRINELKEQVELDKKAKQDVEENYVLMIEEKTEMVNVLKLQVSLLKEG-KDLP---------PELEEQIKLKHEVE--------VLLEKQKQDEIKELKNSLSQRENLLQRCKDKINSLNSQLNELKSKFATMQNTSXXXXXXXXXXXXSQQRAQQFSDSDNIEQINIDRMKSAFKDLENKNFQLEQ-------EIKSHCDVKCSDLKLEVQQLKEKIRSLTLENENLFEQ 1161
            SE +D     D+ +KE+L QR +R +     ++ ++ E   + +  + E  KL   L+ SQDK +RRI EL+E++++D++AK+ ++E +   +EEK + ++VL+ QVSLLK+  ++ P         P+LE Q ++  + E        V+ +      ++ L+  + ++ENLL+RCK+ I S   Q   L S+   +Q                 +R Q+     ++      ++ +  +D +N   QLEQ       E K          + E+ QL+ +I+ +T + E L EQ
Sbjct:  122 SEAEDLVGNSDSLNKEQLIQRLRRMERSLSSYRGKYSELVTAYQMLQREKKKLQGILSQSQDKSLRRIAELREELQMDQQAKKHLQEEFDASLEEKDQYISVLQTQVSLLKQRLRNGPMNVDVLKPLPQLEPQAEVFTKEENPESDGEPVVEDGTSVKTLETLQQRVKRQENLLKRCKETIQSHKEQCTLLTSEKEALQEQLD-------------ERLQELEKIKDLHMAEKTKLITQLRDAKNLIEQLEQDKGMVIAETKRQMHETLEMKEEEIAQLRSRIKQMTTQGEELREQ 404          

HSP 2 Score: 60.077 bits (144), Expect = 7.797e-8
Identity = 77/331 (23.26%), Postives = 146/331 (44.11%), Query Frame = 1
Query: 5452 EIEQIKTRHDIEKEEMEQQFADERINIDDDVNQRLKKLTKEFTDKIFEKERDFQKTFEEALSSIRKDESRMKSDLRSTIDDLNKSTIELQTERNQLLDQISYNNKEIKTLKK----LIDAKDLEFESLKEELSHSIVKINELENEKQALITAKISKMNQTVESGTCYEEPFLDNITVKD------HEVLLMHCSDIEEQLKQLQSENINLRRLMAVNNNDLSSPAILEPVIYXXXXXXXXXXXXXANDTVKHSIQHHTSIYRSPNTSCSDYTFCPIPITEATDYEYLHDVLLKYMTGMETEILAKVVCTVMKFSNEETSRVLCFEQDRNKF 6414
            E+E +K  +D E+EE   +   E+ +++   N  LK+L +EF  ++ +KE++ + T +E ++  ++ E+ +   L S            Q E NQLL +I+  + ++K   K    ++DA++ E             K+ +L+ + + L      K+ Q        E P  DN+T+ +       +  L+  S ++EQ  + + +  NL   +     ++ +  +  P                               Y+  N   +D +    P    T++EYL  VL +YM G ET+ +AKV+ TV+KF +++T ++L  E  R  F
Sbjct: 1963 ELEILKKEYDQEREE---KIKQEQEDLELKHNSTLKQLMREFNTQLAQKEQELEMTIKETINKAQEVEAEL---LESH-----------QEETNQLLKKIAEKDDDLKRTAKRYEEILDAREEEM----------TAKVRDLQTQLEELQKKYQQKLEQE-------ENPGNDNVTIMELQTQLAQKTTLISDSKLKEQ--EFREQIHNLEDRLKKYEKNVYATTVGTP-------------------------------YKGGNLYHTDVSLFGEP----TEFEYLRKVLFEYMMGRETKTMAKVITTVLKFPDDQTQKILEREDARLMF 2222          
BLAST of GRIP domain-containing protein vs. Ensembl Human
Match: GOLGA4 (golgin A4 [Source:HGNC Symbol;Acc:HGNC:4427])

HSP 1 Score: 76.2554 bits (186), Expect = 9.515e-13
Identity = 77/287 (26.83%), Postives = 142/287 (49.48%), Query Frame = 1
Query:  376 GDTCSKEELFQRYQRAQTLARRFKTRFLEAAESCKKFESENNKLTRTLTDSQDKQIRRINELKEQVELDKKAKQDVEENYVLMIEEKTEMVNVLKLQVSLLKEG-KDLP---------PELEEQIKLKHEVE--------VLLEKQKQDEIKELKNSLSQRENLLQRCKDKINSLNSQLNELKSKFATMQNTSXXXXXXXXXXXXSQQRAQQFSDSDNIEQINIDRMKSAFKDLENKNFQLEQ-------EIKSHCDVKCSDLKLEVQQLKEKIRSLTLENENLFEQ 1161
             D+ +KE+L QR +R +     ++ ++ E   + +  + E  KL   L+ SQDK +RRI EL+E++++D++AK+ ++E +   +EEK + ++VL+ QVSLLK+  ++ P         P+LE Q ++  + E        V+ +      ++ L+  + ++ENLL+RCK+ I S   Q   L S+   +Q                 +R Q+     ++      ++ +  +D +N   QLEQ       E K          + E+ QL+ +I+ +T + E L EQ
Sbjct:    2 SDSLNKEQLIQRLRRMERSLSSYRGKYSELVTAYQMLQREKKKLQGILSQSQDKSLRRIAELREELQMDQQAKKHLQEEFDASLEEKDQYISVLQTQVSLLKQRLRNGPMNVDVLKPLPQLEPQAEVFTKEENPESDGEPVVEDGTSVKTLETLQQRVKRQENLLKRCKETIQSHKEQCTLLTSEKEALQEQLD-------------ERLQELEKIKDLHMAEKTKLITQLRDAKNLIEQLEQDKGMVIAETKRQMHETLEMKEEEIAQLRSRIKQMTTQGEELREQ 275          

HSP 2 Score: 60.077 bits (144), Expect = 6.763e-8
Identity = 76/328 (23.17%), Postives = 145/328 (44.21%), Query Frame = 1
Query: 5452 EIEQIKTRHDIEKEEMEQQFADERINIDDDVNQRLKKLTKEFTDKIFEKERDFQKTFEEALSSIRKDESRMKSDLRSTIDDLNKSTIELQTERNQLLDQISYNNKEIKTLKK----LIDAKDLEFESLKEELSHSIVKINELENEKQALITAKISKMNQTVESGTCYEEPFLDNITVKD------HEVLLMHCSDIEEQLKQLQSENINLRRLMAVNNNDLSSPAILEPVIYXXXXXXXXXXXXXANDTVKHSIQHHTSIYRSPNTSCSDYTFCPIPITEATDYEYLHDVLLKYMTGMETEILAKVVCTVMKFSNEETSRVLCFEQDR 6405
            E+E +K  +D E+EE   +   E+ +++   N  LK+L +EF  ++ +KE++ + T +E ++  ++ E+ +   L S            Q E NQLL +I+  + ++K   K    ++DA++ E             K+ +L+ + + L      K+ Q        E P  DN+T+ +       +  L+  S ++EQ  + + +  NL   +     ++ +  +  P                               Y+  N   +D +    P    T++EYL  VL +YM G ET+ +AKV+ TV+KF +++T ++L  E  R
Sbjct: 1834 ELEILKKEYDQEREE---KIKQEQEDLELKHNSTLKQLMREFNTQLAQKEQELEMTIKETINKAQEVEAEL---LESH-----------QEETNQLLKKIAEKDDDLKRTAKRYEEILDAREEEM----------TAKVRDLQTQLEELQKKYQQKLEQE-------ENPGNDNVTIMELQTQLAQKTTLISDSKLKEQ--EFREQIHNLEDRLKKYEKNVYATTVGTP-------------------------------YKGGNLYHTDVSLFGEP----TEFEYLRKVLFEYMMGRETKTMAKVITTVLKFPDDQTQKILEREDAR 2090          
BLAST of GRIP domain-containing protein vs. Ensembl Human
Match: GOLGA4 (golgin A4 [Source:HGNC Symbol;Acc:HGNC:4427])

HSP 1 Score: 65.855 bits (159), Expect = 4.767e-10
Identity = 77/296 (26.01%), Postives = 139/296 (46.96%), Query Frame = 1
Query:  349 SEFDDSAYGGDTCSKEELFQRYQRAQTLARRFKTRFLEAAESCKKFESENNKLTRTLTDSQDKQIRRINELKEQVELDKKAKQDVEENYVLMIEEKTEMVNVLKLQVSLLKEG-KDLP---------PELEEQIKLKHEVE--------VLLEKQKQDEIKELKNSLSQRENLLQRCKDKINSLNSQLNELKSKFATMQNTSXXXXXXXXXXXXSQQRAQQFSDSDNIEQINIDRMKSAFKDLENKNFQLEQ-------EIKSHCDVKCSDLKLEVQQLKEKIRSLTLENENLFEQ 1161
            SE +D     D+ +KE+L QR +R +     ++ ++ E                  L+ SQDK +RRI EL+E +++D++AK+ ++E +   +EEK + ++VL+ QVSLLK+  ++ P         P+LE Q ++  + E        V+ +      ++ L+  + ++ENLL+RCK+ I S   Q   L S+   +Q                 +R Q+     ++      ++ +  +D +N   QLEQ       E K          + E+ QL+ +I+ +T + E L EQ
Sbjct:  144 SEAEDLVGNSDSLNKEQLIQRLRRMERSLSSYRGKYSEG----------------ILSQSQDKSLRRIAELRE-LQMDQQAKKHLQEEFDASLEEKDQYISVLQTQVSLLKQRLRNGPMNVDVLKPLPQLEPQAEVFTKEENPESDGEPVVEDGTSVKTLETLQQRVKRQENLLKRCKETIQSHKEQCTLLTSEKEALQE-------------QLDERLQELEKIKDLHMAEKTKLITQLRDAKNLIEQLEQDKGMVIAETKRQMHETLEMKEEEIAQLRSRIKQMTTQGEELREQ 409          
BLAST of GRIP domain-containing protein vs. Ensembl Human
Match: LAMA2 (laminin subunit alpha 2 [Source:HGNC Symbol;Acc:HGNC:6482])

HSP 1 Score: 55.4546 bits (132), Expect = 2.026e-6
Identity = 85/492 (17.28%), Postives = 213/492 (43.29%), Query Frame = 1
Query: 4420 LIATSEELESSMRRLNEVADEKGRIDEEK-QSLRKELKELNEKISNLKMEFEKQSSEKERLEMQFDESLEKVKLNHAALEEMYKKELGTQHEYQRNLEEQMACHKESTDXXXXXXXXXXXXXXNQSEQLLELNYQYKKLLDEAKIETSEIETKYLTLEQETSEFLSELNRLKVEKIELMETINNLNISHSEMSAQCENWKSNISILQDENKRLSENIQKVTRVKNEEIEVIKTELNHTKVIKETLKNK---IDLLESTSEELILKEKSILNQSSEMRSEKAEFENQIANLQSK----LDETEIKCLTSS----NEKNQLMIQLNEQIKTINQLKSQINELKNVSYSYKNQIENFSLEIEQIKTRHDIEKEEMEQQFADERINIDDDVNQRLKKLTKEFTDKIFEKERDFQKTFEEALSSIRKDESRMKSDLRSTIDDLNKSTIELQTERNQLLDQIS-----YNN--KEIKTLKKLIDAKDLEFESLKEELS 5838
            L   +E +     +LNE    +    E   + L+KE+ ++ +++    +E +K+ +E E +  +    L+KVK       +++ +  G   E +++L E++A +K   D       +  + +  ++ +L  +N +    L++ K      + +     +E ++ L E NRL  E   +++ + ++      MS +  +   ++S  + ++++L+E + +         E    +LN +  + + + ++   I    + + +     K  ++++ ++  E  +  ++   L +     L E    CL  S    NE  +L   + E    +N LK++I   +N      + +   +  + ++    +    ++ Q   D+    +D     L ++T+     + +     +K + +   S+ K  + +K   ++T+ D + +   L+ E ++L+D++       +N  K I  +K+LI+    +  S+K  +S
Sbjct: 1685 LARDAEAVNEKAIKLNETLGTRDEAFERNLEGLQKEIDQMIKELRRKNLETQKEIAEDELVAAE--ALLKKVK-------KLFGESRGENEEMEKDLREKLADYKNKVDDAWDLLREATDKI-REANRLFAVNQKNMTALEKKKEAVESGKRQIENTLKEGNDILDEANRLADEINSIIDYVEDIQTKLPPMSEELNDKIDDLS-QEIKDRKLAEKVSQA--------ESHAAQLNDSSAVLDGILDEAKNISFNATAAFKAYSNIKDYIDEAEKVAKEAKDLAHEATKLATGPRGLLKEDAKGCLQKSFRILNEAKKLANDVKENEDHLNGLKTRI---ENADARNGDLLRTLNDTLGKLSAIPNDTAAKL-QAVKDKARQANDTAKDVLAQITE-----LHQNLDGLKKNYNKLADSVAKTNAVVKDPSKNTVADADATVKNLEQEADRLIDKLKPIKELEDNLKKNISEIKELINQARKQANSIKVSVS 2148          
BLAST of GRIP domain-containing protein vs. Ensembl Fly
Match: Golgin245 (gene:FBgn0034854 transcript:FBtr0072036)

HSP 1 Score: 62.7734 bits (151), Expect = 5.014e-9
Identity = 33/93 (35.48%), Postives = 61/93 (65.59%), Query Frame = 1
Query:  337 NESISEFDDSAYGG--DTCSKEELFQRYQRAQTLARRFKTRFLEAAESCKKFESENNKLTRTLTDSQDKQIRRINELKEQVELDKKAKQDVEE 609
            +E+ SEFDDSA     D  +K++L+  Y+++     +++ R+ + A+  K+ E +++K    L ++QDK +RRI+EL+EQ  L+++AK  +EE
Sbjct:  125 DETSSEFDDSASTARLDVITKDQLYDAYKKSLDRYHKYRCRYTDLAKKYKELERDSSKARSVLVETQDKALRRISELREQCTLEQQAKAHLEE 217          
BLAST of GRIP domain-containing protein vs. Ensembl Zebrafish
Match: golga4 (golgin A4 [Source:ZFIN;Acc:ZDB-GENE-050208-275])

HSP 1 Score: 76.2554 bits (186), Expect = 5.632e-13
Identity = 58/201 (28.86%), Postives = 105/201 (52.24%), Query Frame = 1
Query:  316 NNVKLYDNESI--SEFDDSAYGGDTCSKEELFQRYQRAQTLARRFKTRFLEAAESCKKFESENNKLTRTLTDSQDKQIRRINELKEQVELDKKAKQDVEENYVLMIEEKTEMVNVLKLQVSLLKE-----GKDLPPELE-----EQIKLKHEV-------------EVLLEKQKQDEIKELKNSLSQRENLLQRCKDKINS 843
            N    YD  S   SE +DS    ++ S+E+L  R  R +     ++ ++ E   + +  + +  K    L+ SQDK +RRI EL+E++++D++AK+ ++E +   +EEK +M+ VL  QVSLLK+     G  L  EL+     + +    +V             E  ++     +++ L+  ++++E+LLQRCK+ I S
Sbjct:  125 NEAPAYDPPSDIESEAEDSPGSVESLSREQLLHRLHRVERSLGNYRGKYSELVTAYRTAQRDKEKTQAILSQSQDKALRRIGELREELQMDQQAKKHLQEEFDAALEEKDQMITVLHTQVSLLKKRLQASGGVLSSELQVSPATDTVDANSDVQSPSKDDNSTLNTEGSVDSGSAVDVESLQKRVTRQESLLQRCKEMIRS 325          

HSP 2 Score: 57.3806 bits (137), Expect = 2.956e-7
Identity = 25/75 (33.33%), Postives = 44/75 (58.67%), Query Frame = 1
Query: 6181 IQHHTSIYRSPNTSCSDYTFCPIPITEATDYEYLHDVLLKYMTGMETEILAKVVCTVMKFSNEETSRVLCFEQDR 6405
            + H  S Y+  + + +D      P +E T++EYL  V+ +YM G ET+ +AKV+ +++KF  ++  +VL  E  R
Sbjct: 2067 VTHLGSTYKDMSHNSAD------PFSEPTEFEYLRKVMFEYMMGRETKTMAKVITSMLKFPADQAQKVLEREDSR 2135          
BLAST of GRIP domain-containing protein vs. Ensembl Zebrafish
Match: golga4 (golgin A4 [Source:ZFIN;Acc:ZDB-GENE-050208-275])

HSP 1 Score: 76.2554 bits (186), Expect = 5.646e-13
Identity = 58/201 (28.86%), Postives = 105/201 (52.24%), Query Frame = 1
Query:  316 NNVKLYDNESI--SEFDDSAYGGDTCSKEELFQRYQRAQTLARRFKTRFLEAAESCKKFESENNKLTRTLTDSQDKQIRRINELKEQVELDKKAKQDVEENYVLMIEEKTEMVNVLKLQVSLLKE-----GKDLPPELE-----EQIKLKHEV-------------EVLLEKQKQDEIKELKNSLSQRENLLQRCKDKINS 843
            N    YD  S   SE +DS    ++ S+E+L  R  R +     ++ ++ E   + +  + +  K    L+ SQDK +RRI EL+E++++D++AK+ ++E +   +EEK +M+ VL  QVSLLK+     G  L  EL+     + +    +V             E  ++     +++ L+  ++++E+LLQRCK+ I S
Sbjct:  125 NEAPAYDPPSDIESEAEDSPGSVESLSREQLLHRLHRVERSLGNYRGKYSELVTAYRTAQRDKEKTQAILSQSQDKALRRIGELREELQMDQQAKKHLQEEFDAALEEKDQMITVLHTQVSLLKKRLQASGGVLSSELQVSPATDTVDANSDVQSPSKDDNSTLNTEGSVDSGSAVDVESLQKRVTRQESLLQRCKEMIRS 325          

HSP 2 Score: 58.151 bits (139), Expect = 1.700e-7
Identity = 29/103 (28.16%), Postives = 57/103 (55.34%), Query Frame = 1
Query: 6181 IQHHTSIYRSPNTSCSDYTFCPIPITEATDYEYLHDVLLKYMTGMETEILAKVVCTVMKFSNEETSRVLCFEQDRNKF-IRRIL*ISLIGMFVFICRFLASAC 6486
            + H  S Y+  + + +D      P +E T++EYL  V+ +YM G ET+ +AKV+ +++KF  ++  +VL  E  R    +++   +  + +F F+   L+ +C
Sbjct: 2067 VTHLGSTYKDMSHNSAD------PFSEPTEFEYLRKVMFEYMMGRETKTMAKVITSMLKFPADQAQKVLEREDSRVMVSVQKQKCLQQLTLFAFL---LSDSC 2160          
BLAST of GRIP domain-containing protein vs. Ensembl Zebrafish
Match: golga4 (golgin A4 [Source:ZFIN;Acc:ZDB-GENE-050208-275])

HSP 1 Score: 76.2554 bits (186), Expect = 5.778e-13
Identity = 58/201 (28.86%), Postives = 105/201 (52.24%), Query Frame = 1
Query:  316 NNVKLYDNESI--SEFDDSAYGGDTCSKEELFQRYQRAQTLARRFKTRFLEAAESCKKFESENNKLTRTLTDSQDKQIRRINELKEQVELDKKAKQDVEENYVLMIEEKTEMVNVLKLQVSLLKE-----GKDLPPELE-----EQIKLKHEV-------------EVLLEKQKQDEIKELKNSLSQRENLLQRCKDKINS 843
            N    YD  S   SE +DS    ++ S+E+L  R  R +     ++ ++ E   + +  + +  K    L+ SQDK +RRI EL+E++++D++AK+ ++E +   +EEK +M+ VL  QVSLLK+     G  L  EL+     + +    +V             E  ++     +++ L+  ++++E+LLQRCK+ I S
Sbjct:  100 NEAPAYDPPSDIESEAEDSPGSVESLSREQLLHRLHRVERSLGNYRGKYSELVTAYRTAQRDKEKTQAILSQSQDKALRRIGELREELQMDQQAKKHLQEEFDAALEEKDQMITVLHTQVSLLKKRLQASGGVLSSELQVSPATDTVDANSDVQSPSKDDNSTLNTEGSVDSGSAVDVESLQKRVTRQESLLQRCKEMIRS 300          

HSP 2 Score: 58.151 bits (139), Expect = 1.642e-7
Identity = 29/103 (28.16%), Postives = 57/103 (55.34%), Query Frame = 1
Query: 6181 IQHHTSIYRSPNTSCSDYTFCPIPITEATDYEYLHDVLLKYMTGMETEILAKVVCTVMKFSNEETSRVLCFEQDRNKF-IRRIL*ISLIGMFVFICRFLASAC 6486
            + H  S Y+  + + +D      P +E T++EYL  V+ +YM G ET+ +AKV+ +++KF  ++  +VL  E  R    +++   +  + +F F+   L+ +C
Sbjct: 2042 VTHLGSTYKDMSHNSAD------PFSEPTEFEYLRKVMFEYMMGRETKTMAKVITSMLKFPADQAQKVLEREDSRVMVSVQKQKCLQQLTLFAFL---LSDSC 2135          
BLAST of GRIP domain-containing protein vs. Ensembl Zebrafish
Match: golga4 (golgin A4 [Source:ZFIN;Acc:ZDB-GENE-050208-275])

HSP 1 Score: 76.2554 bits (186), Expect = 6.182e-13
Identity = 58/201 (28.86%), Postives = 105/201 (52.24%), Query Frame = 1
Query:  316 NNVKLYDNESI--SEFDDSAYGGDTCSKEELFQRYQRAQTLARRFKTRFLEAAESCKKFESENNKLTRTLTDSQDKQIRRINELKEQVELDKKAKQDVEENYVLMIEEKTEMVNVLKLQVSLLKE-----GKDLPPELE-----EQIKLKHEV-------------EVLLEKQKQDEIKELKNSLSQRENLLQRCKDKINS 843
            N    YD  S   SE +DS    ++ S+E+L  R  R +     ++ ++ E   + +  + +  K    L+ SQDK +RRI EL+E++++D++AK+ ++E +   +EEK +M+ VL  QVSLLK+     G  L  EL+     + +    +V             E  ++     +++ L+  ++++E+LLQRCK+ I S
Sbjct:  103 NEAPAYDPPSDIESEAEDSPGSVESLSREQLLHRLHRVERSLGNYRGKYSELVTAYRTAQRDKEKTQAILSQSQDKALRRIGELREELQMDQQAKKHLQEEFDAALEEKDQMITVLHTQVSLLKKRLQASGGVLSSELQVSPATDTVDANSDVQSPSKDDNSTLNTEGSVDSGSAVDVESLQKRVTRQESLLQRCKEMIRS 303          

HSP 2 Score: 58.151 bits (139), Expect = 1.561e-7
Identity = 29/103 (28.16%), Postives = 57/103 (55.34%), Query Frame = 1
Query: 6181 IQHHTSIYRSPNTSCSDYTFCPIPITEATDYEYLHDVLLKYMTGMETEILAKVVCTVMKFSNEETSRVLCFEQDRNKF-IRRIL*ISLIGMFVFICRFLASAC 6486
            + H  S Y+  + + +D      P +E T++EYL  V+ +YM G ET+ +AKV+ +++KF  ++  +VL  E  R    +++   +  + +F F+   L+ +C
Sbjct: 2045 VTHLGSTYKDMSHNSAD------PFSEPTEFEYLRKVMFEYMMGRETKTMAKVITSMLKFPADQAQKVLEREDSRVMVSVQKQKCLQQLTLFAFL---LSDSC 2138          
BLAST of GRIP domain-containing protein vs. Ensembl Zebrafish
Match: golga4 (golgin A4 [Source:ZFIN;Acc:ZDB-GENE-050208-275])

HSP 1 Score: 75.8702 bits (185), Expect = 6.267e-13
Identity = 58/201 (28.86%), Postives = 105/201 (52.24%), Query Frame = 1
Query:  316 NNVKLYDNESI--SEFDDSAYGGDTCSKEELFQRYQRAQTLARRFKTRFLEAAESCKKFESENNKLTRTLTDSQDKQIRRINELKEQVELDKKAKQDVEENYVLMIEEKTEMVNVLKLQVSLLKE-----GKDLPPELE-----EQIKLKHEV-------------EVLLEKQKQDEIKELKNSLSQRENLLQRCKDKINS 843
            N    YD  S   SE +DS    ++ S+E+L  R  R +     ++ ++ E   + +  + +  K    L+ SQDK +RRI EL+E++++D++AK+ ++E +   +EEK +M+ VL  QVSLLK+     G  L  EL+     + +    +V             E  ++     +++ L+  ++++E+LLQRCK+ I S
Sbjct:  125 NEAPAYDPPSDIESEAEDSPGSVESLSREQLLHRLHRVERSLGNYRGKYSELVTAYRTAQRDKEKTQAILSQSQDKALRRIGELREELQMDQQAKKHLQEEFDAALEEKDQMITVLHTQVSLLKKRLQASGGVLSSELQVSPATDTVDANSDVQSPSKDDNSTLNTEGSVDSGSAVDVESLQKRVTRQESLLQRCKEMIRS 325          
BLAST of GRIP domain-containing protein vs. Ensembl Xenopus
Match: lhb (luteinizing hormone subunit beta [Source:Xenbase;Acc:XB-GENE-486113])

HSP 1 Score: 84.3445 bits (207), Expect = 2.940e-15
Identity = 64/199 (32.16%), Postives = 107/199 (53.77%), Query Frame = 1
Query:  349 SEFDDSAYGGDTCSKEELFQRYQRAQTLARRFKTRFLEAAESCKKFESENNKLTRTLTDSQDKQIRRINELKEQVELDKKAKQDVEENYVLMIEEKTEMVNVLKLQVSLLK-------EGKDLP-----PELEEQIKLKHEVEVLLEKQKQDE-----IKELKNSLSQRENLLQRCKDKINSLNSQLNELKSKFATMQN 894
            SE +DS    +  +KE+LF R  R       ++ ++ E   + +  + +  KL   L+ SQDK +RRI EL+E++++D++AK+ ++E +   +EEK ++++VL+ QVSLLK          +LP     PEL+ +  L+ EV+        D      +  L+  + ++ENLLQRCK  I S   Q   L S+   +QN
Sbjct:  141 SEAEDSVGSIEGLNKEQLFNRLHRMDKSLGNYRGKYSELVTAYRTMQRDKEKLQSILSQSQDKALRRIGELREELQMDQQAKKHLQEEFDASLEEKDQLISVLQTQVSLLKNRLQNGQSSTELPESTASPELDSESSLQ-EVDTDNRSTPDDGNAANTLNALQVRVKRQENLLQRCKKSIKSHKEQCAHLSSENEALQN 338          
BLAST of GRIP domain-containing protein vs. Ensembl Xenopus
Match: lhb (luteinizing hormone subunit beta [Source:Xenbase;Acc:XB-GENE-486113])

HSP 1 Score: 84.3445 bits (207), Expect = 3.092e-15
Identity = 64/199 (32.16%), Postives = 107/199 (53.77%), Query Frame = 1
Query:  349 SEFDDSAYGGDTCSKEELFQRYQRAQTLARRFKTRFLEAAESCKKFESENNKLTRTLTDSQDKQIRRINELKEQVELDKKAKQDVEENYVLMIEEKTEMVNVLKLQVSLLK-------EGKDLP-----PELEEQIKLKHEVEVLLEKQKQDE-----IKELKNSLSQRENLLQRCKDKINSLNSQLNELKSKFATMQN 894
            SE +DS    +  +KE+LF R  R       ++ ++ E   + +  + +  KL   L+ SQDK +RRI EL+E++++D++AK+ ++E +   +EEK ++++VL+ QVSLLK          +LP     PEL+ +  L+ EV+        D      +  L+  + ++ENLLQRCK  I S   Q   L S+   +QN
Sbjct:  141 SEAEDSVGSIEGLNKEQLFNRLHRMDKSLGNYRGKYSELVTAYRTMQRDKEKLQSILSQSQDKALRRIGELREELQMDQQAKKHLQEEFDASLEEKDQLISVLQTQVSLLKNRLQNGQSSTELPESTASPELDSESSLQ-EVDTDNRSTPDDGNAANTLNALQVRVKRQENLLQRCKKSIKSHKEQCAHLSSENEALQN 338          
BLAST of GRIP domain-containing protein vs. Ensembl Xenopus
Match: lhb (luteinizing hormone subunit beta [Source:Xenbase;Acc:XB-GENE-486113])

HSP 1 Score: 83.9593 bits (206), Expect = 3.111e-15
Identity = 64/199 (32.16%), Postives = 107/199 (53.77%), Query Frame = 1
Query:  349 SEFDDSAYGGDTCSKEELFQRYQRAQTLARRFKTRFLEAAESCKKFESENNKLTRTLTDSQDKQIRRINELKEQVELDKKAKQDVEENYVLMIEEKTEMVNVLKLQVSLLK-------EGKDLP-----PELEEQIKLKHEVEVLLEKQKQDE-----IKELKNSLSQRENLLQRCKDKINSLNSQLNELKSKFATMQN 894
            SE +DS    +  +KE+LF R  R       ++ ++ E   + +  + +  KL   L+ SQDK +RRI EL+E++++D++AK+ ++E +   +EEK ++++VL+ QVSLLK          +LP     PEL+ +  L+ EV+        D      +  L+  + ++ENLLQRCK  I S   Q   L S+   +QN
Sbjct:  141 SEAEDSVGSIEGLNKEQLFNRLHRMDKSLGNYRGKYSELVTAYRTMQRDKEKLQSILSQSQDKALRRIGELREELQMDQQAKKHLQEEFDASLEEKDQLISVLQTQVSLLKNRLQNGQSSTELPESTASPELDSESSLQ-EVDTDNRSTPDDGNAANTLNALQVRVKRQENLLQRCKKSIKSHKEQCAHLSSENEALQN 338          
BLAST of GRIP domain-containing protein vs. Ensembl Xenopus
Match: lhb (luteinizing hormone subunit beta [Source:Xenbase;Acc:XB-GENE-486113])

HSP 1 Score: 76.6406 bits (187), Expect = 6.398e-13
Identity = 64/199 (32.16%), Postives = 105/199 (52.76%), Query Frame = 1
Query:  349 SEFDDSAYGGDTCSKEELFQRYQRAQTLARRFKTRFLEAAESCKKFESENNKLTRTLTDSQDKQIRRINELKEQVELDKKAKQDVEENYVLMIEEKTEMVNVLKLQVSLLK-------EGKDLP-----PELEEQIKLKHEVEVLLEKQKQDE-----IKELKNSLSQRENLLQRCKDKINSLNSQLNELKSKFATMQN 894
            SE +DS    +  +KE+LF R  R       ++ ++ E A+     +S        L+ SQDK +RRI EL+E++++D++AK+ ++E +   +EEK ++++VL+ QVSLLK          +LP     PEL+ +  L+ EV+        D      +  L+  + ++ENLLQRCK  I S   Q   L S+   +QN
Sbjct:   98 SEAEDSVGSIEGLNKEQLFNRLHRMDKSLGNYRGKYSEVADLFVLLQS-------ILSQSQDKALRRIGELREELQMDQQAKKHLQEEFDASLEEKDQLISVLQTQVSLLKNRLQNGQSSTELPESTASPELDSESSLQ-EVDTDNRSTPDDGNAANTLNALQVRVKRQENLLQRCKKSIKSHKEQCAHLSSENEALQN 288          
BLAST of GRIP domain-containing protein vs. Ensembl Xenopus
Match: lhb (luteinizing hormone subunit beta [Source:Xenbase;Acc:XB-GENE-486113])

HSP 1 Score: 76.2554 bits (186), Expect = 8.063e-13
Identity = 64/199 (32.16%), Postives = 105/199 (52.76%), Query Frame = 1
Query:  349 SEFDDSAYGGDTCSKEELFQRYQRAQTLARRFKTRFLEAAESCKKFESENNKLTRTLTDSQDKQIRRINELKEQVELDKKAKQDVEENYVLMIEEKTEMVNVLKLQVSLLK-------EGKDLP-----PELEEQIKLKHEVEVLLEKQKQDE-----IKELKNSLSQRENLLQRCKDKINSLNSQLNELKSKFATMQN 894
            SE +DS    +  +KE+LF R  R       ++ ++ E A+     +S        L+ SQDK +RRI EL+E++++D++AK+ ++E +   +EEK ++++VL+ QVSLLK          +LP     PEL+ +  L+ EV+        D      +  L+  + ++ENLLQRCK  I S   Q   L S+   +QN
Sbjct:  141 SEAEDSVGSIEGLNKEQLFNRLHRMDKSLGNYRGKYSEVADLFVLLQS-------ILSQSQDKALRRIGELREELQMDQQAKKHLQEEFDASLEEKDQLISVLQTQVSLLKNRLQNGQSSTELPESTASPELDSESSLQ-EVDTDNRSTPDDGNAANTLNALQVRVKRQENLLQRCKKSIKSHKEQCAHLSSENEALQN 331          
BLAST of GRIP domain-containing protein vs. Ensembl Mouse
Match: Golga4 (golgi autoantigen, golgin subfamily a, 4 [Source:MGI Symbol;Acc:MGI:1859646])

HSP 1 Score: 90.5077 bits (223), Expect = 6.061e-18
Identity = 58/182 (31.87%), Postives = 106/182 (58.24%), Query Frame = 1
Query:  349 SEFDDSAYGGDTCSKEELFQRYQRAQTLARRFKTRFLEAAESCKKFESENNKLTRTLTDSQDKQIRRINELKEQVELDKKAKQDVEENYVLMIEEKTEMVNVLKLQVSLLKE-----------GKDLPP-ELEEQI-----KLKHEVEVLLEKQKQDEIKELKNSLSQRENLLQRCKDKINS 843
            SE +D+ +  D  S+E+L QR +R +     ++ ++ E   + +  + E  KL   L+ SQDK +RRI+EL+E++++D++AK+ +++ +   +EEK + ++VL+ QVSLLK+            K LPP EL+ ++     K++   E +        ++ L+  + ++ENLLQRCK+ I S
Sbjct:  152 SEAEDAPWNSDGLSREQLLQRLRRMERSLSSYRGKYSELVTAFQTLQREKKKLQGILSQSQDKSLRRISELREELQMDQQAKKHLQDEFDACLEEKDQYISVLQTQVSLLKQRLQNGPMNVDAPKPLPPGELQAEVHGDTEKMEGVGEPVGGGTSAKTLEMLQQRVKRQENLLQRCKETIGS 333          
BLAST of GRIP domain-containing protein vs. Ensembl Mouse
Match: Golga4 (golgi autoantigen, golgin subfamily a, 4 [Source:MGI Symbol;Acc:MGI:1859646])

HSP 1 Score: 88.1965 bits (217), Expect = 1.143e-16
Identity = 59/186 (31.72%), Postives = 107/186 (57.53%), Query Frame = 1
Query:  349 SEFDDSAYGGDTCSKEELFQRYQRAQTLARRFKTRFLEAAESCKKFESENNKLTRTLTDSQDKQIRRINELKEQVELDKKAKQDVEENYVLMIEEKTEMVNVLKLQVSLLKE-----------GKDLPP-ELEEQI-----KLKHEVEVLLEKQKQDEIKELKNSLSQRENLLQRCKDKINSLNSQ 855
            SE +D+ +  D  S+E+L QR +R +     ++ ++ E   + +  + E  KL   L+ SQDK +RRI+EL+E++++D++AK+ +++ +   +EEK + ++VL+ QVSLLK+            K LPP EL+ ++     K++   E +        ++ L+  + ++ENLLQRCK+ I S   Q
Sbjct:  143 SEAEDAPWNSDGLSREQLLQRLRRMERSLSSYRGKYSELVTAFQTLQREKKKLQGILSQSQDKSLRRISELREELQMDQQAKKHLQDEFDACLEEKDQYISVLQTQVSLLKQRLQNGPMNVDAPKPLPPGELQAEVHGDTEKMEGVGEPVGGGTSAKTLEMLQQRVKRQENLLQRCKETIGSHKEQ 328          
BLAST of GRIP domain-containing protein vs. Ensembl Mouse
Match: Golga4 (golgi autoantigen, golgin subfamily a, 4 [Source:MGI Symbol;Acc:MGI:1859646])

HSP 1 Score: 88.1965 bits (217), Expect = 1.452e-16
Identity = 59/186 (31.72%), Postives = 107/186 (57.53%), Query Frame = 1
Query:  349 SEFDDSAYGGDTCSKEELFQRYQRAQTLARRFKTRFLEAAESCKKFESENNKLTRTLTDSQDKQIRRINELKEQVELDKKAKQDVEENYVLMIEEKTEMVNVLKLQVSLLKE-----------GKDLPP-ELEEQI-----KLKHEVEVLLEKQKQDEIKELKNSLSQRENLLQRCKDKINSLNSQ 855
            SE +D+ +  D  S+E+L QR +R +     ++ ++ E   + +  + E  KL   L+ SQDK +RRI+EL+E++++D++AK+ +++ +   +EEK + ++VL+ QVSLLK+            K LPP EL+ ++     K++   E +        ++ L+  + ++ENLLQRCK+ I S   Q
Sbjct:  143 SEAEDAPWNSDGLSREQLLQRLRRMERSLSSYRGKYSELVTAFQTLQREKKKLQGILSQSQDKSLRRISELREELQMDQQAKKHLQDEFDACLEEKDQYISVLQTQVSLLKQRLQNGPMNVDAPKPLPPGELQAEVHGDTEKMEGVGEPVGGGTSAKTLEMLQQRVKRQENLLQRCKETIGSHKEQ 328          
BLAST of GRIP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q91VW5|GOGA4_MOUSE (Golgin subfamily A member 4 OS=Mus musculus OX=10090 GN=Golga4 PE=1 SV=2)

HSP 1 Score: 88.1965 bits (217), Expect = 1.016e-15
Identity = 59/186 (31.72%), Postives = 107/186 (57.53%), Query Frame = 1
Query:  349 SEFDDSAYGGDTCSKEELFQRYQRAQTLARRFKTRFLEAAESCKKFESENNKLTRTLTDSQDKQIRRINELKEQVELDKKAKQDVEENYVLMIEEKTEMVNVLKLQVSLLKE-----------GKDLPP-ELEEQI-----KLKHEVEVLLEKQKQDEIKELKNSLSQRENLLQRCKDKINSLNSQ 855
            SE +D+ +  D  S+E+L QR +R +     ++ ++ E   + +  + E  KL   L+ SQDK +RRI+EL+E++++D++AK+ +++ +   +EEK + ++VL+ QVSLLK+            K LPP EL+ ++     K++   E +        ++ L+  + ++ENLLQRCK+ I S   Q
Sbjct:  143 SEAEDAPWNSDGLSREQLLQRLRRMERSLSSYRGKYSELVTAFQTLQREKKKLQGILSQSQDKSLRRISELREELQMDQQAKKHLQDEFDACLEEKDQYISVLQTQVSLLKQRLQNGPMNVDAPKPLPPGELQAEVHGDTEKMEGVGEPVGGGTSAKTLEMLQQRVKRQENLLQRCKETIGSHKEQ 328          
BLAST of GRIP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5U4E6|GOGA4_RAT (Golgin subfamily A member 4 OS=Rattus norvegicus OX=10116 GN=Golga4 PE=1 SV=2)

HSP 1 Score: 82.8037 bits (203), Expect = 4.864e-14
Identity = 44/129 (34.11%), Postives = 79/129 (61.24%), Query Frame = 1
Query:  349 SEFDDSAYGGDTCSKEELFQRYQRAQTLARRFKTRFLEAAESCKKFESENNKLTRTLTDSQDKQIRRINELKEQVELDKKAKQDVEENYVLMIEEKTEMVNVLKLQVSLLKE-----------GKDLPP 702
            SE +D+ +  D+ S+E+L QR +R +     ++ ++ E   + +  + E  KL   L+ SQDK +RRI+EL+E++++D++AK+ ++E +   +EEK + ++VL+ QVSLLK+            K LPP
Sbjct:  154 SEAEDAPWSSDSLSREQLLQRLRRMERSLSSYRGKYSELVTAFQTLQREKKKLQGILSQSQDKSLRRISELREELQMDQQAKRHLQEEFDACVEEKDQYISVLQTQVSLLKQRLQNGPMSVDVPKPLPP 282          
BLAST of GRIP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q13439|GOGA4_HUMAN (Golgin subfamily A member 4 OS=Homo sapiens OX=9606 GN=GOLGA4 PE=1 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 2.859e-13
Identity = 80/296 (27.03%), Postives = 146/296 (49.32%), Query Frame = 1
Query:  349 SEFDDSAYGGDTCSKEELFQRYQRAQTLARRFKTRFLEAAESCKKFESENNKLTRTLTDSQDKQIRRINELKEQVELDKKAKQDVEENYVLMIEEKTEMVNVLKLQVSLLKEG-KDLP---------PELEEQIKLKHEVE--------VLLEKQKQDEIKELKNSLSQRENLLQRCKDKINSLNSQLNELKSKFATMQNTSXXXXXXXXXXXXSQQRAQQFSDSDNIEQINIDRMKSAFKDLENKNFQLEQ-------EIKSHCDVKCSDLKLEVQQLKEKIRSLTLENENLFEQ 1161
            SE +D     D+ +KE+L QR +R +     ++ ++ E   + +  + E  KL   L+ SQDK +RRI EL+E++++D++AK+ ++E +   +EEK + ++VL+ QVSLLK+  ++ P         P+LE Q ++  + E        V+ +      ++ L+  + ++ENLL+RCK+ I S   Q   L S+   +Q                 +R Q+     ++      ++ +  +D +N   QLEQ       E K          + E+ QL+ +I+ +T + E L EQ
Sbjct:  122 SEAEDLVGNSDSLNKEQLIQRLRRMERSLSSYRGKYSELVTAYQMLQREKKKLQGILSQSQDKSLRRIAELREELQMDQQAKKHLQEEFDASLEEKDQYISVLQTQVSLLKQRLRNGPMNVDVLKPLPQLEPQAEVFTKEENPESDGEPVVEDGTSVKTLETLQQRVKRQENLLKRCKETIQSHKEQCTLLTSEKEALQEQLD-------------ERLQELEKIKDLHMAEKTKLITQLRDAKNLIEQLEQDKGMVIAETKRQMHETLEMKEEEIAQLRSRIKQMTTQGEELREQ 404          

HSP 2 Score: 60.077 bits (144), Expect = 3.744e-7
Identity = 77/331 (23.26%), Postives = 146/331 (44.11%), Query Frame = 1
Query: 5452 EIEQIKTRHDIEKEEMEQQFADERINIDDDVNQRLKKLTKEFTDKIFEKERDFQKTFEEALSSIRKDESRMKSDLRSTIDDLNKSTIELQTERNQLLDQISYNNKEIKTLKK----LIDAKDLEFESLKEELSHSIVKINELENEKQALITAKISKMNQTVESGTCYEEPFLDNITVKD------HEVLLMHCSDIEEQLKQLQSENINLRRLMAVNNNDLSSPAILEPVIYXXXXXXXXXXXXXANDTVKHSIQHHTSIYRSPNTSCSDYTFCPIPITEATDYEYLHDVLLKYMTGMETEILAKVVCTVMKFSNEETSRVLCFEQDRNKF 6414
            E+E +K  +D E+EE   +   E+ +++   N  LK+L +EF  ++ +KE++ + T +E ++  ++ E+ +   L S            Q E NQLL +I+  + ++K   K    ++DA++ E             K+ +L+ + + L      K+ Q        E P  DN+T+ +       +  L+  S ++EQ  + + +  NL   +     ++ +  +  P                               Y+  N   +D +    P    T++EYL  VL +YM G ET+ +AKV+ TV+KF +++T ++L  E  R  F
Sbjct: 1963 ELEILKKEYDQEREE---KIKQEQEDLELKHNSTLKQLMREFNTQLAQKEQELEMTIKETINKAQEVEAEL---LESH-----------QEETNQLLKKIAEKDDDLKRTAKRYEEILDAREEEM----------TAKVRDLQTQLEELQKKYQQKLEQE-------ENPGNDNVTIMELQTQLAQKTTLISDSKLKEQ--EFREQIHNLEDRLKKYEKNVYATTVGTP-------------------------------YKGGNLYHTDVSLFGEP----TEFEYLRKVLFEYMMGRETKTMAKVITTVLKFPDDQTQKILEREDARLMF 2222          
BLAST of GRIP domain-containing protein vs. TrEMBL
Match: A0A1I8G7I4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 5.867e-33
Identity = 81/174 (46.55%), Postives = 123/174 (70.69%), Query Frame = 1
Query:  352 EFDDSAYGGDTCSKEELFQRYQRAQTLARRFKTRFLEAAESCKKFESENNKLTRTLTDSQDKQIRRINELKEQVELDKKAKQDVEENYVLMIEEKTEMVNVLKLQVSLLKEGKDLPPELEEQIKLKHEVEVLLEKQKQDEIKELKNSLSQRENLLQRCKDKINSLNSQLNELKS 873
            E + S  G +  +K+ELFQ++   Q+LA+R+K++F E  E+ +  ++E  KL + LT +QDK +RRI+ELKEQ+ELD+ AK+D+E+NY LM+EEK E+  VLK+QVSLLKEGKDLPPELE +IK  HE E   +++ ++ +K  +    + E LL +C+D I S   +L E+++
Sbjct:   99 ESEASVAGVEVMTKQELFQKFLHVQSLAKRYKSKFYELMEAHRSLDTEKEKLKKALTTNQDKSLRRISELKEQIELDQLAKRDLEQNYSLMLEEKDELNKVLKIQVSLLKEGKDLPPELEAKIKDGHEKEASEKRKMEENLKAAQEKNVRLEQLLTKCRDSIQSHKEKLAEIQA 272          
BLAST of GRIP domain-containing protein vs. TrEMBL
Match: A0A1I8IUS5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 1.662e-32
Identity = 87/209 (41.63%), Postives = 135/209 (64.59%), Query Frame = 1
Query:  364 SAYGGDTCSKEELFQRYQRAQTLARRFKTRFLEAAESCKKFESENNKLTRTLTDSQDKQIRRINELKEQVELDKKAKQDVEENYVLMIEEKTEMVNVLKLQVSLLKEGKDLPPELEEQIKLKHEVEVLLEKQKQDEIKELKNSLSQRENLLQRCKDKINSLNSQLNELKS--------KFATMQNTSXXXXXXXXXXXXSQQRAQQFSD 966
            S  G +  +K+ELFQ++   Q+LA+R+K++F E  E+ +  ++E  KL + LT +QDK +RRI+ELKEQ+ELD+ AK+D+E+NY LM+EEK E+  VLK+QVSLLKEGKDLPPELE +IK  HE E   +++ ++ +K  +    + E LL +C+D I S   +L E+++          A MQ +    +        ++Q+A+Q +D
Sbjct:  617 SVAGVEVMTKQELFQKFLHVQSLAKRYKSKFYELMEAHRSLDTEKEKLKKALTTNQDKSLRRISELKEQIELDQLAKRDLEQNYSLMLEEKDELNKVLKIQVSLLKEGKDLPPELEAKIKDGHEKEASEKRKMEENLKAAQEKNVRLEQLLTKCRDSIQSHKEKLAEIQADKEALRAEAEAKMQASKAEIEKLTARLAETRQKAKQATD 825          
BLAST of GRIP domain-containing protein vs. TrEMBL
Match: A0A267H9A1 (GRIP domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029368g1 PE=4 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 2.619e-32
Identity = 88/213 (41.31%), Postives = 137/213 (64.32%), Query Frame = 1
Query:  352 EFDDSAYGGDTCSKEELFQRYQRAQTLARRFKTRFLEAAESCKKFESENNKLTRTLTDSQDKQIRRINELKEQVELDKKAKQDVEENYVLMIEEKTEMVNVLKLQVSLLKEGKDLPPELEEQIKLKHEVEVLLEKQKQDEIKELKNSLSQRENLLQRCKDKINSLNSQLNELKS--------KFATMQNTSXXXXXXXXXXXXSQQRAQQFSD 966
            E + S  G +  +K+ELFQ++   Q+LA+R+K++F E  E+ +  ++E  KL + LT +QDK +RRI+ELKEQ+ELD+ AK+D+E+NY LM+EEK E+  VLK+QVSLLKEGKDLPPELE +IK  HE E   +++ ++ +K  +    + E LL +C+D I S   +L E+++          A MQ +    +        ++Q+A+Q +D
Sbjct:   99 ESEASVAGVEVMTKQELFQKFLHVQSLAKRYKSKFYELMEAHRSLDTEKEKLKKALTTNQDKSLRRISELKEQIELDQLAKRDLEQNYSLMLEEKDELNKVLKIQVSLLKEGKDLPPELEAKIKDGHEKEASEKRKMEENLKAAQEKNVRLEQLLTKCRDSIQSHKEKLAEIQADKEALRAEAEAKMQASKAEIEKLTARLAETRQKAKQATD 311          

HSP 2 Score: 72.0182 bits (175), Expect = 2.480e-8
Identity = 49/167 (29.34%), Postives = 74/167 (44.31%), Query Frame = 1
Query: 5914 QTVESGTCYEEPFLDNITVKDHEVLLMHCSDIEEQLKQLQSE--NINLR----RLMAVNNNDLSSPAILEPVIYXXXXXXXXXXXXXANDTVKHSIQHHTSIYRSPNTSCSDYTFCPIPITEATDYEYLHDVLLKYMTGMETEILAKVVCTVMKFSNEETSRVLCFE 6396
            + V+S     +P  D ++++D+E L MH +D+E QL  + +E  ++ LR    R  A     L SP   E + Y                                       +F  IP     + EYL +VL KYM G +T+ LAKV+CTV+KFS  +  +VL +E
Sbjct: 2055 EAVKSSALNTQPTGDTVSLEDYEALRMHTTDLETQLSSVSAELSSLKLRSSPERPSASQIAQLPSPGPSESMQYQF------------------------------------ASFIEIP-----EIEYLRNVLFKYMLGEKTQTLAKVICTVLKFSEPQIQQVLDYE 2180          
BLAST of GRIP domain-containing protein vs. TrEMBL
Match: A0A267H9K5 (GRIP domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031271g1 PE=4 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 3.305e-32
Identity = 88/213 (41.31%), Postives = 137/213 (64.32%), Query Frame = 1
Query:  352 EFDDSAYGGDTCSKEELFQRYQRAQTLARRFKTRFLEAAESCKKFESENNKLTRTLTDSQDKQIRRINELKEQVELDKKAKQDVEENYVLMIEEKTEMVNVLKLQVSLLKEGKDLPPELEEQIKLKHEVEVLLEKQKQDEIKELKNSLSQRENLLQRCKDKINSLNSQLNELKS--------KFATMQNTSXXXXXXXXXXXXSQQRAQQFSD 966
            E + S  G +  +K+ELFQ++   Q+LA+R+K++F E  E+ +  ++E  KL + LT +QDK +RRI+ELKEQ+ELD+ AK+D+E+NY LM+EEK E+  VLK+QVSLLKEGKDLPPELE +IK  HE E   +++ ++ +K  +    + E LL +C+D I S   +L E+++          A MQ +    +        ++Q+A+Q +D
Sbjct:  100 ESEASVAGVEVMTKQELFQKFLHVQSLAKRYKSKFYELMEAHRSLDTEKEKLKKALTTNQDKSLRRISELKEQIELDQLAKRDLEQNYSLMLEEKDELNKVLKIQVSLLKEGKDLPPELEAKIKDGHEKEASEKRKMEENLKAAQEKNVRLEQLLTKCRDSIQSHKEKLAEIQADKEALRAEAEAKMQASKAEIEKLTARLAETRQKAKQATD 312          

HSP 2 Score: 72.0182 bits (175), Expect = 2.533e-8
Identity = 49/167 (29.34%), Postives = 74/167 (44.31%), Query Frame = 1
Query: 5914 QTVESGTCYEEPFLDNITVKDHEVLLMHCSDIEEQLKQLQSE--NINLR----RLMAVNNNDLSSPAILEPVIYXXXXXXXXXXXXXANDTVKHSIQHHTSIYRSPNTSCSDYTFCPIPITEATDYEYLHDVLLKYMTGMETEILAKVVCTVMKFSNEETSRVLCFE 6396
            + V+S     +P  D ++++D+E L MH +D+E QL  + +E  ++ LR    R  A     L SP   E + Y                                       +F  IP     + EYL +VL KYM G +T+ LAKV+CTV+KFS  +  +VL +E
Sbjct: 2000 EAVKSSALNTQPTGDTVSLEDYEALRMHTTDLETQLSSVSAELSSLKLRSSPERPSASQIAQLPSPGPSESMQYQF------------------------------------ASFIEIP-----EIEYLRNVLFKYMLGEKTQTLAKVICTVLKFSEPQIQQVLDYE 2125          
BLAST of GRIP domain-containing protein vs. TrEMBL
Match: A0A267FKW2 (GRIP domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025853g1 PE=4 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 2.580e-31
Identity = 78/162 (48.15%), Postives = 118/162 (72.84%), Query Frame = 1
Query:  388 SKEELFQRYQRAQTLARRFKTRFLEAAESCKKFESENNKLTRTLTDSQDKQIRRINELKEQVELDKKAKQDVEENYVLMIEEKTEMVNVLKLQVSLLKEGKDLPPELEEQIKLKHEVEVLLEKQKQDEIKELKNSLSQRENLLQRCKDKINSLNSQLNELKS 873
            +K+ELFQ++   Q+LA+R+K++F E  E+ +  ++E  KL + LT +QDK +RRI+ELKEQ+ELD+ AK+D+E+NY LM+EEK E+  VLK+QVSLLKEGKDLPPELE +IK  HE E   +++ ++ +K  +    + E LL +C+D I S   +L E+++
Sbjct:    2 TKQELFQKFLHVQSLAKRYKSKFYELMEAHRSLDTEKEKLKKALTTNQDKSLRRISELKEQIELDQLAKRDLEQNYSLMLEEKDELNKVLKIQVSLLKEGKDLPPELEAKIKDGHEKEASEKRKMEENLKAAQEKNVRLEQLLTKCRDSIQSHKDKLAEIQA 163          

HSP 2 Score: 71.633 bits (174), Expect = 2.891e-8
Identity = 49/167 (29.34%), Postives = 74/167 (44.31%), Query Frame = 1
Query: 5914 QTVESGTCYEEPFLDNITVKDHEVLLMHCSDIEEQLKQLQSE--NINLR----RLMAVNNNDLSSPAILEPVIYXXXXXXXXXXXXXANDTVKHSIQHHTSIYRSPNTSCSDYTFCPIPITEATDYEYLHDVLLKYMTGMETEILAKVVCTVMKFSNEETSRVLCFE 6396
            + V+S     +P  D ++++D+E L MH +D+E QL  + +E  ++ LR    R  A     L SP   E + Y                                       +F  IP     + EYL +VL KYM G +T+ LAKV+CTV+KFS  +  +VL +E
Sbjct: 2514 EAVKSSALNTQPTGDTVSLEDYEALRMHTTDLETQLSSVSAELSSLKLRSSPERPSASQIAQLPSPGPSESMQYQF------------------------------------ASFIEIP-----EIEYLRNVLFKYMLGEKTQTLAKVICTVLKFSEPQIQQVLDYE 2639          
BLAST of GRIP domain-containing protein vs. Ensembl Cavefish
Match: golga4 (golgin A4 [Source:ZFIN;Acc:ZDB-GENE-050208-275])

HSP 1 Score: 76.2554 bits (186), Expect = 4.757e-13
Identity = 58/202 (28.71%), Postives = 104/202 (51.49%), Query Frame = 1
Query:  313 SNNVKLYDNESI--SEFDDSAYGGDTCSKEELFQRYQRAQTLARRFKTRFLEAAESCKKFESENNKLTRTLTDSQDKQIRRINELKEQVELDKKAKQDVEENYVLMIEEKTEMVNVLKLQVSLLKEG-KDLPPEL---EEQIKLKHEVEVLLEKQKQDEIKE-------------------LKNSLSQRENLLQRCKDKINS 843
            S+ +  YD  S   SE +DS    D  SK++L  R  R +     ++ ++ E   + +  + +  K    L+ SQDK +RRI EL+E++++D++AK+ ++E +   +EEK +M+ VL+ QV+L+K+  + +P  L   EE+ K     E   + Q  D++                     L+  + ++E LLQRCK+ I +
Sbjct:  163 SDTLPAYDPPSDIESEAEDSPSNADALSKDQLLHRLHRVEKSLGNYRGKYSELVTAYRTVQRDKEKTQAILSQSQDKALRRIGELREELQMDQQAKKHLQEEFDAALEEKDQMITVLQTQVALMKKRLQGVPGALVSTEEEAK---STETSPDLQNTDQVDSTELNEGVSSEPGSEVDMEVLQKRVRRQETLLQRCKEMIRT 361          
BLAST of GRIP domain-containing protein vs. Ensembl Cavefish
Match: golga4 (golgin A4 [Source:ZFIN;Acc:ZDB-GENE-050208-275])

HSP 1 Score: 75.8702 bits (185), Expect = 5.582e-13
Identity = 58/202 (28.71%), Postives = 104/202 (51.49%), Query Frame = 1
Query:  313 SNNVKLYDNESI--SEFDDSAYGGDTCSKEELFQRYQRAQTLARRFKTRFLEAAESCKKFESENNKLTRTLTDSQDKQIRRINELKEQVELDKKAKQDVEENYVLMIEEKTEMVNVLKLQVSLLKEG-KDLPPEL---EEQIKLKHEVEVLLEKQKQDEIKE-------------------LKNSLSQRENLLQRCKDKINS 843
            S+ +  YD  S   SE +DS    D  SK++L  R  R +     ++ ++ E   + +  + +  K    L+ SQDK +RRI EL+E++++D++AK+ ++E +   +EEK +M+ VL+ QV+L+K+  + +P  L   EE+ K     E   + Q  D++                     L+  + ++E LLQRCK+ I +
Sbjct:   74 SDTLPAYDPPSDIESEAEDSPSNADALSKDQLLHRLHRVEKSLGNYRGKYSELVTAYRTVQRDKEKTQAILSQSQDKALRRIGELREELQMDQQAKKHLQEEFDAALEEKDQMITVLQTQVALMKKRLQGVPGALVSTEEEAK---STETSPDLQNTDQVDSTELNEGVSSEPGSEVDMEVLQKRVRRQETLLQRCKEMIRT 272          
BLAST of GRIP domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009771.1 (pep scaffold:Pmarinus_7.0:GL486128:713:10235:-1 gene:ENSPMAG00000008833.1 transcript:ENSPMAT00000009771.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.8702 bits (185), Expect = 6.068e-14
Identity = 58/226 (25.66%), Postives = 113/226 (50.00%), Query Frame = 1
Query:  289 TAPQHVQPSNNVKLYDNESISEFDDSAYGG--DTCSKEELFQRYQRAQTLARRFKTRFLEAAESCKKFESENNKLTRTLTDSQDKQIRRINELKEQVELDKKAKQDVEENYVLMIEEKTEMVNVLKLQVSLLKE-------------------GKDLPPELE----EQIKLKHEVEVLLEKQKQDEIKELKNSLSQRENLLQRCKDKINSLNSQLNELKSKFATMQ 891
              PQ   P   + + D ES SE   +   G  D  S++E+  R  R +    +++ R+ E    CK  + +  KL   L  +QD+ +RRI+EL+E++++D++AK+ +++ +   +EEK ++++VL+ QV+LLK+                   G D   E      ++  + H  E        +E++  +  + ++ENLL+RCK+ +     +  +L ++  T+Q
Sbjct:  141 AVPQSPTPGPEL-VSDIESESEEGSTMPSGGIDGLSRDEMAHRLGRMERSLAKYRGRYTELVSICKDLQRDKEKLQVVLGQNQDRALRRISELREELQMDQQAKKHLQQEFDASLEEKDQLISVLQTQVALLKKQQRVDGMSLDEHDSGSGQTGTDGDAERSGGDVQEASIPHHAERGEGPHPPEELEATRERVRRQENLLKRCKETMRVQKERSTQLSAEKETLQ 365          
BLAST of GRIP domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009774.1 (pep scaffold:Pmarinus_7.0:GL486128:734:10235:-1 gene:ENSPMAG00000008833.1 transcript:ENSPMAT00000009774.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.7886 bits (177), Expect = 3.873e-13
Identity = 42/133 (31.58%), Postives = 78/133 (58.65%), Query Frame = 1
Query:  289 TAPQHVQPSNNVKLYDNESISEFDDSAYGG--DTCSKEELFQRYQRAQTLARRFKTRFLEAAESCKKFESENNKLTRTLTDSQDKQIRRINELKEQVELDKKAKQDVEENYVLMIEEKTEMVNVLKLQVSLLK 681
              PQ   P   + + D ES SE   +   G  D  S++E+  R  R +    +++ R+ E    CK  + +  KL   L  +QD+ +RRI+EL+E++++D++AK+ +++ +   +EEK ++++VL+ QV+LLK
Sbjct:   81 AVPQSPTPGPEL-VSDIESESEEGSTMPSGGIDGLSRDEMAHRLGRMERSLAKYRGRYTELVSICKDLQRDKEKLQVVLGQNQDRALRRISELREELQMDQQAKKHLQQEFDASLEEKDQLISVLQTQVALLK 212          
BLAST of GRIP domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009772.1 (pep scaffold:Pmarinus_7.0:GL486128:728:5968:-1 gene:ENSPMAG00000008833.1 transcript:ENSPMAT00000009772.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.781 bits (164), Expect = 1.182e-11
Identity = 58/214 (27.10%), Postives = 111/214 (51.87%), Query Frame = 1
Query:  310 PSNNVKLY-DNESISEFDDSAYGG--DTCSKEELFQRYQRAQTLARRFKTRFLEAAESCKKFESENNKLTRTLTDSQDKQIRRINELKEQVELDKKAKQDVEENYVLMIEEKTEMVNVLKLQVSLLKE---GKD--------LPPEL---EEQIKLKHEVEVLLEKQKQDEIKEL---KNSLSQRENLLQRCKDKINSLNSQLNELKSKFATMQ 891
            P+   +L  D ES SE   +   G  D  S++E+  R  R +    +++ R+ E    CK  + +  KL   L  +QD+ +RRI+EL+E++++D++AK+ +++ +   +EEK ++++VL+ QV  +     G          L PEL      I+  H  E+   ++    + EL   +  + ++ENLL+RCK+ +     +  +L ++  T+Q
Sbjct:   35 PTPGPELVSDIESESEEGSTMPSGGIDGLSRDEMAHRLGRMERSLAKYRGRYTELVSICKDLQRDKEKLQVVLGQNQDRALRRISELREELQMDQQAKKHLQQEFDASLEEKDQLISVLQTQVCTVHPTLCGPSVFVCVRVLLQPELAVGAVGIRQHHRDELCTGERVCTSVWELEATRERVRRQENLLKRCKETMRVQKERSTQLSAEKETLQ 248          
BLAST of GRIP domain-containing protein vs. Planmine SMEST
Match: SMESG000017888.1 (SMESG000017888.1)

HSP 1 Score: 3682.88 bits (9549), Expect = 0.000e+0
Identity = 2105/2120 (99.29%), Postives = 2106/2120 (99.34%), Query Frame = 1
Query:   70 MFKNLREKITTADPXXXXXXXXXXXXXXXXXGELTSSENLNETSKNPGNQXXXXXXXXXXXXXDVGSAFTKSMTAPQHVQPSNNVKLYDNESISEFDDSAYGGDTCSKEELFQRYQRAQTLARRFKTRFLEAAESCKKFESENNKLTRTLTDSQDKQIRRINELKEQVELDKKAKQDVEENYVLMIEEKTEMVNVLKLQVSLLKEGKDLPPELEEQIKLKHEVEVLLEKQKQDEIKELKNSLSQRENLLQRCKDKINSLNSQLNELKSKFATMQNTSXXXXXXXXXXXXSQQRAQQFSDSDNIEQINIDRMKSAFKDLENKNFQLEQEIKSHCDVKCSDLKLEVQQLKEKIRSLTLENENLFEQVNIKTKIIQDLMNDQFAQNQEFCDPSILNTPVEKLKLCKLIISKHSSCVHPIIDELQSVIGTMKIAPNVIDMSSSYVGNSEEFTENVIASDSKENETFADLAEQNKFLNSKIEQMVKLKSICEEENINREKELVETVSILEDERKDLIAKIKKFEEDSEIFKKDIKELCYKNEEILHKLSETQLSLNKIELEKLSITEEKNILFKNLESLEQSLKNLQIENEKLLFEMKKLHXXXXXXXXXXXXKCIELESYSKVFTGKQEECKHLTDKLDESFATIDYXXXXXXXXXXXXXGRQFDESNKDEKFSLVVIEMQQRFXXXXXXXXXXXXXXXXINEEQSVQIKQLNSQLDEYKEFADLSKKELEQLKTQYRELIEEYEAKEIVIKNLETDIENLNXXXXXXXXXXXXXXXXXSSTLREKEGLGNEIQNFNLINKNLQSEIDYSKNNTCKLLEEIENLTLTVKEKSELLEKAISEKVLLNENLSSTLNQLESVQLQLADLTSKHNYFIKENQSIVETLQQSSVENEPLKLRTTQLESHIETILKQKEELINTLNITKEEVNTLKIKNQEFSDXXXXXXXXXXXLTLELREKSHLLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCQLVDKEELVAKNEKLNKENITLLKQFEALKKETVSYQTETIVEKDVXXXXXXXXXXXXSVKSNLEEQYSTIQSENVTITXXXXXXXXXXXXXXXXXXXIITELEEDLKSHSMTIVSNEESIASLQKTIDNQNETISLEVQTKTDLSSQINLMESYLYKFCSWIENLTSIENCHGECNQPIPDNWNGDMEFKCSESKILEFVGQSIEKLLSINHRFHREFHENSKRSIEMLKTQSELQKKLDTTLNEVDSILKKNCDNYDSFDDNISLKLEFLNSTMISLTDQLLVKSNLLSEIESQVFKLSEALNIDNLSLIDSSTPESFCLNGLEKKIINIVNYYKQELLIKEEIHQKTQSEYEKVTDEKSEKLSILMVQMFKQLINIFHLTDIHVNNVSDITKQTRKNVIKKLKEFGKNHEQLKTEIEDINIKLISKEKDLKTSDALNQNIQSELDDLKNSVANDRDRLIATSEELESSMRRLNEVADEKGRIDEEKQSLRKELKELNEKISNLKMEFEKQSSEKERLEMQFDESLEKVKLNHAALEEMYKKELGTQHEYQRNLEEQMACHKESTDXXXXXXXXXXXXXXNQSEQLLELNYQYKKLLDEAKIETSEIETKYLTLEQETSEFLSELNRLKVEKIELMETINNLNISHSEMSAQCENWKSNISILQDENKRLSENIQKVTRVKNEEIEVIKTELNHTKVIKETLKNKIDLLESTSEELILKEKSILNQSSEMRSEKAEFENQIANLQSKLDETEIKCLTSSNEKNQLMIQLNEQIKTINQLKSQINELKNVSYSYKNQIENFSLEIEQIKTRHDIEKEEMEQQFADERINIDDDVNQRLKKLTKEFTDKIFEKERDFQKTFEEALSSIRKDESRMKSDLRSTIDDLNKSTIELQTERNQLLDQISYNNKEIKTLKKLIDAKDLEFESLKEELSHSIVKINELENEKQALITAKISKMNQTVESGTCYEEPFLDNITVKDHEVLLMHCSDIEEQLKQLQSENINLRRLMAVNNNDLSSPAILEPVIYXXXXXXXXXXXXXANDTVKHSIQHHTSIYRSPNTSCSDYTFCPIPITEATDYEYLHDVLLKYMTGMETEILAKVVCTVMKFSNEETSRVLCFEQDRNKFIRRIL 6429
            MFKNLREKITTADPNKIK K   +       GELTSSENLNETSKNPGNQSLSRFSSLSSLVSDVGSAFTKSMTAPQHVQPSNNVKLYDNESISEFDDS YGGDTCSKEELFQRYQRAQTLARRFKTRFLEAAESCKKFESENNKLTRTLTDSQDKQIRRINELKEQVELDKKAKQDVEENYVLMIEEKTEMVNVLKLQVSLLKEGKDLPPELEEQIKLKHEVEVLLEKQKQDEIKELKNSLSQRENLLQRCKDKINSLNSQLNELKSKFATMQNTSIFNDDDKIFNDFSQQRAQQFSDSDNIEQINIDRMKSAFKDLENKNFQLEQEIKSHCDVKCSDLKLEVQQLKEKIRSLTLENENLFEQVNIKTKIIQDLMNDQFAQNQEFCDPSILNTPVEKLKLCKLIISKHSSCVHPIIDELQSVIGTMKIAPNVIDMSSSYVGNSEEFTENVIASDSKENETFADLAEQNKFLNSKIEQMVKLKSICEEENINREKELVETVSILEDERKD IAKIKKFEEDSEIFKKDIKELCYKNEEILHKLSETQLSLNKIELEKLSITEEKNILFKNLESLEQSLKNLQIENEKLLFEMKKLHNENSELDSNLSSKCIELESYSKVFTGKQEECKHLTDKLDESFATIDYLNEEKNELLSKLNGRQFDESNKDEKFSLVVIEMQQRFEQESEEMKKKQSECEKINEEQSVQIKQLNSQLDEYKEFADLSKKELEQLKTQYRELIEEYEAKEIVIKNLETDIENLNKEIELLKIQLEEIIEKLSSTLREKEGLGNEIQNFNLINKNLQSEIDYSKNNTCKLLEEIENLTLTVKEKSELLEKAISEKVLLNENLSSTLNQLESVQLQLADLTSKHNYFIKENQSIVETLQQSSVENEPLKLRTTQLESHIETILKQKEELINTLNITKEEVNTLKIKNQEFSDEIIKIESIEEKLTLELREKSHLLVKENQEKIQINNNNIELSKENEKNLKELELLKCQLVDKEELVAKNEKLNKENITLLKQFEALKKETVSYQTETIVEKDVLNNLKEELFNLNSVKSNLEEQYSTIQSENVTITKSLNEEKLALEKLVEEKSKIITELEEDLKSHSMTIVSNEESIASLQKTIDNQNETISLEVQTKTDLSSQINLMESYLYKFCSWIENLTSIENCHGECNQPIPDNWNGDMEFKCSESKILEFVGQSIEKLLSINHRFHREFHENSKRSIEMLKTQSELQKKLDTTLNEVDSILKKNCDNYDSFDDNISLKLEFLNSTMISLTDQLLVKSNLLSEIESQVFKLSEALNIDNLSLIDSSTPESFCLNGLEKKIINIVNYYKQELLIKEEIHQKTQSEYEKVTDEKSEKLSILMVQMFKQLINIFHLTDIHVNNVSDITKQTRKNVIKKLKEFGKNHEQLKTEIEDINIKLISKEKDLKTSDALNQNIQSELDDLKNSVANDRDRLIATSEELESSMRRLNEVADEKGRIDEEKQSLRKELKELNEKISNLKMEFEKQSSEKERLEMQFDESLEKVKLNHAALEEMYKKELGTQHEYQRNLEEQMACHKESTDLKLTESEKKLELVLNQSEQLLELNYQYKKLLDEAKIETSEIE KYLTLEQETSEFLSELNRLKVEKIELMETINNLNISHSEMSAQCENWKSNISILQDENKRLSENIQKVTRVKNEEIEVIKTELNHTKVIKETLKNKIDLLESTSEELILKEKSILNQSSEMRSEKAEFENQIANLQSKLDETEIKCLTSSNEKNQLMIQLNEQIKTINQLKSQINELKNVSYSYKNQIENFSLEIEQIKTRHDIEKEEMEQQFADERINIDDDVNQRLKKLTKEFTDKIFEKERDFQKTFEEALSSIRKDESRMKSDLRSTIDDLNKSTIELQTERNQLLDQISYNNKEIKTLKKLIDAKDLEFESLKEELSHSIVKINELENEKQALITAKISKMNQTVESGTCYEEPFLDNITVKDHEVLLMHCSDIEEQLKQLQSENINLRRLMAVNNNDLSSPAILEPVIYSSKTKQLSSQQSLANDTVKHSIQHHTSIYRSPNTSCSDYTFCPIPITEATDYEYLHDVLLKYMTGMETEILAKVVCTVMKFSNEETSRVLCFEQDRNKFIRRIL
Sbjct:    1 MFKNLREKITTADPNKIKKKSSNN-------GELTSSENLNETSKNPGNQSLSRFSSLSSLVSDVGSAFTKSMTAPQHVQPSNNVKLYDNESISEFDDSVYGGDTCSKEELFQRYQRAQTLARRFKTRFLEAAESCKKFESENNKLTRTLTDSQDKQIRRINELKEQVELDKKAKQDVEENYVLMIEEKTEMVNVLKLQVSLLKEGKDLPPELEEQIKLKHEVEVLLEKQKQDEIKELKNSLSQRENLLQRCKDKINSLNSQLNELKSKFATMQNTSIFNDDDKIFNDFSQQRAQQFSDSDNIEQINIDRMKSAFKDLENKNFQLEQEIKSHCDVKCSDLKLEVQQLKEKIRSLTLENENLFEQVNIKTKIIQDLMNDQFAQNQEFCDPSILNTPVEKLKLCKLIISKHSSCVHPIIDELQSVIGTMKIAPNVIDMSSSYVGNSEEFTENVIASDSKENETFADLAEQNKFLNSKIEQMVKLKSICEEENINREKELVETVSILEDERKDFIAKIKKFEEDSEIFKKDIKELCYKNEEILHKLSETQLSLNKIELEKLSITEEKNILFKNLESLEQSLKNLQIENEKLLFEMKKLHNENSELDSNLSSKCIELESYSKVFTGKQEECKHLTDKLDESFATIDYLNEEKNELLSKLNGRQFDESNKDEKFSLVVIEMQQRFEQESEEMKKKQSECEKINEEQSVQIKQLNSQLDEYKEFADLSKKELEQLKTQYRELIEEYEAKEIVIKNLETDIENLNKEIELLKIQLEEIIEKLSSTLREKEGLGNEIQNFNLINKNLQSEIDYSKNNTCKLLEEIENLTLTVKEKSELLEKAISEKVLLNENLSSTLNQLESVQLQLADLTSKHNYFIKENQSIVETLQQSSVENEPLKLRTTQLESHIETILKQKEELINTLNITKEEVNTLKIKNQEFSDEIIKIESIEEKLTLELREKSHLLVKENQEKIQINNNNIELSKENEKNLKELELLKCQLVDKEELVAKNEKLNKENITLLKQFEALKKETVSYQTETIVEKDVLNNLKEELFNLNSVKSNLEEQYSTIQSENVTITKSLNEEKLALEKLVEEKSKIITELEEDLKSHSMTIVSNEESIASLQKTIDNQNETISLEVQTKTDLSSQINLMESYLYKFCSWIENLTSIENCHGECNQPIPDNWNGDMEFKCSESKILEFVGQSIEKLLSINHRFHREFHENSKRSIEMLKTQSELQKKLDTTLNEVDSILKKNCDNYDSFDDNISLKLEFLNSTMISLTDQLLVKSNLLSEIESQVFKLSEALNIDNLSLIDSSTPESFCLNGLEKKIINIVNYYKQELLIKEEIHQKTQSEYEKVTDEKSEKLSILMVQMFKQLINIFHLTDIHVNNVSDITKQTRKNVIKKLKEFGKNHEQLKTEIEDINIKLISKEKDLKTSDALNQNIQSELDDLKNSVANDRDRLIATSEELESSMRRLNEVADEKGRIDEEKQSLRKELKELNEKISNLKMEFEKQSSEKERLEMQFDESLEKVKLNHAALEEMYKKELGTQHEYQRNLEEQMACHKESTDLKLTESEKKLELVLNQSEQLLELNYQYKKLLDEAKIETSEIEKKYLTLEQETSEFLSELNRLKVEKIELMETINNLNISHSEMSAQCENWKSNISILQDENKRLSENIQKVTRVKNEEIEVIKTELNHTKVIKETLKNKIDLLESTSEELILKEKSILNQSSEMRSEKAEFENQIANLQSKLDETEIKCLTSSNEKNQLMIQLNEQIKTINQLKSQINELKNVSYSYKNQIENFSLEIEQIKTRHDIEKEEMEQQFADERINIDDDVNQRLKKLTKEFTDKIFEKERDFQKTFEEALSSIRKDESRMKSDLRSTIDDLNKSTIELQTERNQLLDQISYNNKEIKTLKKLIDAKDLEFESLKEELSHSIVKINELENEKQALITAKISKMNQTVESGTCYEEPFLDNITVKDHEVLLMHCSDIEEQLKQLQSENINLRRLMAVNNNDLSSPAILEPVIYSSKTKQLSSQQSLANDTVKHSIQHHTSIYRSPNTSCSDYTFCPIPITEATDYEYLHDVLLKYMTGMETEILAKVVCTVMKFSNEETSRVLCFEQDRNKFIRRIL 2113          
The following BLAST results are available for this feature:
BLAST of GRIP domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GOLGA45.166e-1430.65golgin A4 [Source:HGNC Symbol;Acc:HGNC:4427][more]
GOLGA45.953e-1427.03golgin A4 [Source:HGNC Symbol;Acc:HGNC:4427][more]
GOLGA49.515e-1326.83golgin A4 [Source:HGNC Symbol;Acc:HGNC:4427][more]
GOLGA44.767e-1026.01golgin A4 [Source:HGNC Symbol;Acc:HGNC:4427][more]
LAMA22.026e-617.28laminin subunit alpha 2 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of GRIP domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GRIP domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Golgin2455.014e-935.48gene:FBgn0034854 transcript:FBtr0072036[more]
back to top
BLAST of GRIP domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
golga45.632e-1328.86golgin A4 [Source:ZFIN;Acc:ZDB-GENE-050208-275][more]
golga45.646e-1328.86golgin A4 [Source:ZFIN;Acc:ZDB-GENE-050208-275][more]
golga45.778e-1328.86golgin A4 [Source:ZFIN;Acc:ZDB-GENE-050208-275][more]
golga46.182e-1328.86golgin A4 [Source:ZFIN;Acc:ZDB-GENE-050208-275][more]
golga46.267e-1328.86golgin A4 [Source:ZFIN;Acc:ZDB-GENE-050208-275][more]
back to top
BLAST of GRIP domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lhb2.940e-1532.16luteinizing hormone subunit beta [Source:Xenbase;A... [more]
lhb3.092e-1532.16luteinizing hormone subunit beta [Source:Xenbase;A... [more]
lhb3.111e-1532.16luteinizing hormone subunit beta [Source:Xenbase;A... [more]
lhb6.398e-1332.16luteinizing hormone subunit beta [Source:Xenbase;A... [more]
lhb8.063e-1332.16luteinizing hormone subunit beta [Source:Xenbase;A... [more]
back to top
BLAST of GRIP domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Golga46.061e-1831.87golgi autoantigen, golgin subfamily a, 4 [Source:M... [more]
Golga41.143e-1631.72golgi autoantigen, golgin subfamily a, 4 [Source:M... [more]
Golga41.452e-1631.72golgi autoantigen, golgin subfamily a, 4 [Source:M... [more]
back to top
BLAST of GRIP domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q91VW5|GOGA4_MOUSE1.016e-1531.72Golgin subfamily A member 4 OS=Mus musculus OX=100... [more]
sp|Q5U4E6|GOGA4_RAT4.864e-1434.11Golgin subfamily A member 4 OS=Rattus norvegicus O... [more]
sp|Q13439|GOGA4_HUMAN2.859e-1327.03Golgin subfamily A member 4 OS=Homo sapiens OX=960... [more]
back to top
BLAST of GRIP domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8G7I45.867e-3346.55Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8IUS51.662e-3241.63Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267H9A12.619e-3241.31GRIP domain-containing protein OS=Macrostomum lign... [more]
A0A267H9K53.305e-3241.31GRIP domain-containing protein OS=Macrostomum lign... [more]
A0A267FKW22.580e-3148.15GRIP domain-containing protein OS=Macrostomum lign... [more]
back to top
BLAST of GRIP domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
golga44.757e-1328.71golgin A4 [Source:ZFIN;Acc:ZDB-GENE-050208-275][more]
golga45.582e-1328.71golgin A4 [Source:ZFIN;Acc:ZDB-GENE-050208-275][more]
back to top
BLAST of GRIP domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000009771.16.068e-1425.66pep scaffold:Pmarinus_7.0:GL486128:713:10235:-1 ge... [more]
ENSPMAT00000009774.13.873e-1331.58pep scaffold:Pmarinus_7.0:GL486128:734:10235:-1 ge... [more]
ENSPMAT00000009772.11.182e-1127.10pep scaffold:Pmarinus_7.0:GL486128:728:5968:-1 gen... [more]
back to top
BLAST of GRIP domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GRIP domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GRIP domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GRIP domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000017888.10.000e+099.29SMESG000017888.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035627 ID=SMED30035627|Name=GRIP domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=6809bp
TGTAATTTAAACTATTTAAATATGTTTGCGTAAAATTTTTACTAATATTT
AAATTTATTATGTTTTAAAATGTTTAAAAATTTACGTGAAAAAATAACGA
CCGCTGATCCAAATAAAATCAAAGTAAAATTAAAATTATCGAAAAAAAAG
TCGTCCAACAATGGAGAATTAACGAGCAGTGAAAATTTGAATGAAACTTC
TAAAAATCCTGGAAACCAAAGCTTGTCTAGATTTTCTTCACTAAGCTCTT
TAGTTAGTGATGTAGGTTCTGCTTTTACCAAATCCATGACTGCACCGCAG
CACGTTCAACCATCCAATAATGTAAAATTATATGATAATGAGTCTATTTC
CGAATTTGATGATTCTGCATACGGAGGTGACACATGTTCGAAGGAAGAAT
TATTTCAGAGATACCAAAGAGCCCAAACTCTTGCTAGAAGATTTAAAACT
CGATTTCTTGAAGCAGCCGAAAGTTGCAAAAAATTCGAATCTGAAAATAA
CAAATTGACTCGGACTCTCACAGATTCTCAGGACAAACAAATCCGAAGAA
TTAATGAATTGAAGGAACAAGTTGAATTGGACAAGAAAGCGAAACAAGAC
GTTGAAGAAAATTACGTTTTAATGATTGAAGAAAAAACTGAAATGGTTAA
TGTTTTGAAATTACAGGTTTCATTACTTAAAGAGGGCAAAGATTTACCGC
CAGAACTAGAAGAACAAATCAAGCTAAAACACGAAGTTGAAGTTTTATTA
GAAAAGCAAAAGCAAGATGAAATTAAAGAGCTTAAAAATTCGTTATCCCA
AAGAGAAAATCTTCTTCAGCGTTGCAAGGATAAAATTAACAGTCTAAATT
CACAATTGAATGAATTAAAGTCAAAATTTGCAACGATGCAAAATACCTCG
ATTTTCAATGATGATGATAAAATTTTCAATGACTTTTCTCAGCAACGCGC
TCAACAATTTTCTGATTCGGATAATATTGAACAAATAAATATTGATCGAA
TGAAAAGCGCTTTCAAGGATTTAGAAAATAAAAACTTTCAATTAGAACAA
GAAATTAAATCTCATTGTGATGTAAAGTGTTCTGATTTAAAGTTGGAAGT
GCAGCAATTGAAAGAAAAAATCAGAAGCTTGACACTAGAAAATGAAAATT
TATTTGAACAAGTTAATATCAAAACAAAAATCATCCAAGATTTAATGAAC
GACCAATTTGCCCAAAATCAGGAATTTTGTGATCCTTCGATACTAAATAC
GCCCGTAGAGAAATTGAAACTTTGTAAATTGATTATTAGCAAACATTCCA
GCTGTGTTCATCCAATCATTGACGAGTTACAAAGCGTTATAGGGACAATG
AAAATAGCACCAAACGTGATAGATATGTCAAGTAGTTACGTTGGAAATAG
TGAAGAGTTTACGGAAAATGTTATAGCTTCTGATTCCAAAGAAAACGAAA
CATTTGCCGATTTGGCAGAACAAAACAAGTTTCTTAATTCGAAAATAGAA
CAAATGGTAAAATTGAAATCTATTTGCGAAGAGGAAAATATTAATCGGGA
AAAAGAGTTAGTTGAAACAGTTTCAATTCTAGAAGACGAAAGGAAAGATT
TAATTGCAAAAATTAAGAAATTTGAAGAAGATTCTGAGATTTTTAAAAAG
GATATTAAAGAATTATGTTATAAAAATGAGGAAATTCTACATAAACTGTC
GGAAACGCAATTATCATTGAATAAAATTGAACTCGAAAAGTTGTCGATTA
CTGAAGAAAAAAATATATTATTTAAAAATTTGGAATCTTTAGAACAATCT
TTAAAGAATCTACAAATAGAAAACGAAAAATTACTTTTTGAAATGAAGAA
ATTGCATAACGAAAACAGTGAATTGGACTCAAATCTTTCATCGAAATGTA
TTGAATTGGAAAGTTATAGCAAAGTATTTACTGGAAAACAAGAAGAATGC
AAACATTTAACTGACAAATTGGACGAATCCTTTGCAACAATAGATTACCT
AAATGAAGAAAAAAATGAATTACTATCAAAACTAAACGGGAGACAATTCG
ATGAGTCAAATAAAGACGAAAAATTCAGTTTGGTTGTAATAGAAATGCAA
CAAAGATTTGAACAAGAGTCGGAAGAAATGAAAAAAAAGCAATCTGAATG
CGAAAAAATCAATGAAGAACAATCGGTTCAGATTAAGCAGCTAAACAGTC
AGCTTGATGAGTACAAAGAATTCGCCGATTTATCCAAAAAGGAATTAGAA
CAGTTAAAAACTCAATATCGGGAATTAATTGAAGAATACGAAGCAAAGGA
AATTGTTATCAAAAATCTTGAAACTGATATTGAAAATTTAAACAAAGAAA
TCGAGTTATTAAAAATTCAATTGGAAGAAATAATTGAGAAATTGAGTTCG
ACTTTGAGAGAAAAAGAAGGATTAGGAAATGAAATTCAAAATTTCAATTT
GATCAATAAAAATCTTCAAAGTGAAATTGATTATTCGAAAAATAACACAT
GCAAATTATTGGAAGAAATAGAAAATCTCACTTTGACTGTCAAGGAAAAA
TCCGAACTATTAGAAAAGGCAATCAGTGAAAAAGTGTTATTAAATGAAAA
TCTTTCAAGTACCCTTAATCAGTTGGAATCTGTTCAATTACAACTCGCTG
ATTTGACATCCAAACATAATTACTTCATAAAAGAAAATCAGTCAATTGTT
GAAACCCTACAACAGAGCTCGGTGGAAAATGAACCATTAAAACTTCGAAC
GACGCAACTGGAATCACATATCGAAACAATTCTAAAACAAAAAGAAGAAT
TAATAAATACATTGAATATTACCAAAGAAGAAGTTAATACACTAAAAATT
AAGAATCAAGAATTCTCGGATGAAATCATCAAAATTGAAAGCATTGAAGA
AAAATTAACTTTAGAGTTACGTGAAAAATCGCATTTGCTAGTGAAAGAAA
ATCAAGAAAAAATCCAAATTAACAATAACAATATTGAATTATCGAAGGAA
AATGAAAAGAATTTAAAAGAATTAGAATTGTTGAAATGTCAACTTGTAGA
TAAAGAGGAATTAGTTGCCAAGAATGAGAAGTTAAATAAAGAAAACATAA
CGCTACTTAAACAGTTTGAAGCATTGAAAAAAGAAACCGTCAGTTATCAA
ACTGAAACGATTGTCGAAAAAGATGTTCTGAATAATCTGAAAGAAGAACT
TTTTAATCTGAATAGTGTCAAAAGTAATCTCGAGGAGCAATATTCAACAA
TCCAATCTGAAAACGTTACCATCACGAAGTCGTTGAATGAAGAAAAGTTA
GCACTTGAAAAATTGGTTGAAGAAAAATCAAAAATAATCACTGAACTTGA
AGAGGATCTTAAAAGTCATTCGATGACAATTGTCAGCAATGAAGAATCTA
TTGCAAGTCTTCAAAAGACTATTGACAACCAAAATGAAACTATTTCACTT
GAAGTCCAAACGAAAACCGATTTAAGTTCCCAAATCAATTTAATGGAATC
TTATCTCTACAAGTTTTGCAGCTGGATTGAAAATTTGACAAGTATAGAAA
ATTGTCACGGAGAATGCAATCAACCCATTCCTGACAATTGGAATGGTGAC
ATGGAATTCAAATGTTCTGAAAGTAAAATCTTGGAATTTGTCGGACAATC
TATCGAAAAATTGTTGTCCATCAATCATCGGTTTCATAGAGAATTCCACG
AAAATTCCAAGCGTTCTATTGAAATGTTAAAAACTCAATCAGAACTCCAA
AAAAAACTCGATACAACTCTAAACGAAGTTGATTCTATTTTGAAAAAGAA
CTGTGACAACTATGACTCCTTCGATGACAATATTTCTTTGAAATTGGAAT
TCCTTAATTCGACAATGATTTCTTTAACAGATCAATTATTGGTTAAATCG
AATCTCCTTTCAGAAATCGAATCTCAAGTTTTTAAATTGTCCGAAGCTCT
AAACATTGATAATCTCTCGCTTATTGACAGTAGTACCCCGGAATCGTTCT
GTCTCAATGGGCTGGAAAAGAAAATTATTAATATTGTAAATTACTATAAG
CAAGAGTTATTAATCAAAGAAGAAATTCATCAAAAGACTCAAAGTGAGTA
TGAAAAAGTTACGGATGAAAAATCAGAAAAATTGAGTATTTTAATGGTCC
AAATGTTCAAACAGTTGATAAATATTTTCCACTTAACTGATATCCATGTA
AACAATGTCTCAGATATTACTAAACAAACTCGTAAAAATGTCATTAAAAA
ACTAAAAGAATTTGGAAAGAATCACGAACAATTGAAAACGGAAATAGAAG
ACATCAACATCAAACTGATTTCCAAGGAAAAGGATTTGAAAACCTCAGAT
GCACTAAATCAAAATATTCAATCAGAACTTGATGATTTAAAAAATTCTGT
TGCCAATGATCGAGATCGACTTATAGCAACGAGTGAAGAATTGGAAAGTT
CGATGAGGCGATTGAATGAAGTCGCTGATGAAAAAGGCCGAATAGATGAG
GAAAAACAGTCGCTGAGAAAAGAATTGAAAGAGTTGAATGAAAAAATCTC
TAATCTAAAAATGGAATTCGAAAAACAGAGTTCAGAAAAAGAGCGACTTG
AAATGCAATTTGATGAATCTTTGGAGAAGGTAAAATTAAATCATGCTGCT
TTGGAGGAAATGTATAAAAAAGAATTGGGAACTCAACATGAATATCAACG
AAATTTGGAAGAGCAAATGGCTTGTCACAAAGAATCGACGGATTTGAAAT
TGACAGAAAGTGAAAAGAAACTCGAATTAGTATTGAATCAAAGTGAACAA
TTGCTGGAACTGAATTATCAATATAAAAAATTGTTAGATGAAGCAAAAAT
CGAAACAAGTGAAATCGAAACAAAATATTTGACATTGGAACAAGAAACAT
CAGAATTTCTAAGCGAATTAAATCGACTGAAGGTGGAAAAAATAGAATTA
ATGGAAACAATAAACAACTTGAACATTTCTCACAGCGAAATGTCAGCTCA
GTGTGAAAACTGGAAATCCAATATTTCCATTCTTCAAGATGAAAATAAAA
GACTGTCGGAAAATATCCAGAAAGTAACACGAGTGAAAAATGAAGAAATC
GAAGTAATCAAAACGGAATTGAATCATACGAAAGTGATCAAAGAGACTTT
GAAAAATAAAATCGATCTTCTTGAAAGTACGAGTGAAGAATTGATTCTGA
AAGAAAAATCAATTTTGAACCAATCAAGTGAAATGAGAAGTGAAAAGGCA
GAATTTGAAAATCAAATCGCGAATTTGCAGAGTAAACTCGATGAAACAGA
AATAAAGTGCCTTACGTCAAGTAATGAAAAAAATCAATTAATGATCCAAT
TAAATGAACAGATCAAAACCATTAATCAATTAAAAAGTCAAATTAATGAA
TTAAAAAATGTGTCTTATTCCTACAAAAATCAAATCGAAAATTTCAGTTT
GGAAATCGAACAAATTAAAACACGGCACGACATTGAAAAGGAAGAAATGG
AACAGCAATTTGCTGATGAAAGGATAAACATTGATGATGATGTAAATCAA
CGACTGAAAAAGTTGACTAAAGAATTCACTGATAAAATATTTGAAAAAGA
AAGGGATTTTCAGAAAACCTTTGAAGAAGCTTTAAGCAGTATTAGGAAGG
ATGAAAGTCGTATGAAAAGTGATCTTAGATCTACAATTGATGATCTTAAC
AAATCGACTATCGAATTGCAAACTGAAAGAAATCAATTACTAGATCAAAT
ATCTTATAATAATAAGGAAATCAAAACTCTCAAGAAACTCATTGATGCCA
AAGATCTTGAATTCGAATCACTCAAAGAAGAATTATCACATTCAATAGTC
AAAATAAATGAATTGGAAAATGAAAAGCAAGCGCTAATTACTGCTAAAAT
TTCCAAAATGAATCAAACAGTGGAATCGGGTACCTGCTATGAAGAACCAT
TCTTAGATAATATTACAGTTAAGGATCATGAAGTTTTGTTGATGCATTGT
TCAGATATAGAGGAACAATTGAAACAACTTCAAAGCGAAAATATCAACCT
TAGAAGGTTGATGGCTGTGAATAACAACGATCTTTCTTCGCCAGCAATAT
TAGAACCGGTAATTTACTCTTCAAAAACAAAACAACTTTCATCCCAACAA
TCTCTGGCCAATGATACCGTAAAACATTCGATTCAGCATCACACCAGTAT
ATATCGGTCTCCAAATACTTCTTGCTCTGATTACACTTTCTGTCCAATTC
CGATAACCGAGGCCACTGATTATGAATACCTTCATGATGTACTCCTCAAA
TACATGACCGGAATGGAAACAGAAATTCTAGCCAAGGTTGTCTGTACAGT
GATGAAGTTTTCTAATGAAGAAACCAGCCGAGTTCTCTGTTTTGAGCAAG
ATCGTAACAAATTTATTCGTCGGATCCTGTAAATCTCATTAATAGGTATG
TTTGTTTTTATTTGTCGTTTTCTCGCTTCCGCCTGTGATTTCACTGTGGT
TCTTTCGATATATATCTGATAATCTTACGTCAAGGTCGATTTGATTTTTT
GCACATATTACTGACGTTCTCATTGGATCAATTGCTTTTTTCTGGATAAA
TATATTGGACTGTTTTGTGTTTTAACCCGATTTCTCAATCATTTTATGTA
GCTCAAGCCTCCTTGGAAGATATCAAGATGACTTATGTTGAATATTATCT
ATTTTTATTGTGAATATTATCTAGCTGAAATTAAAAATATAATTTGATTG
ATTATGTACATCAATAAAGGTTTTTAACACGATCGGTCAATATTTTATCT
GCATGCAAT
back to top

protein sequence of SMED30035627-orf-1

>SMED30035627-orf-1 ID=SMED30035627-orf-1|Name=SMED30035627-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2121bp
MFKNLREKITTADPNKIKVKLKLSKKKSSNNGELTSSENLNETSKNPGNQ
SLSRFSSLSSLVSDVGSAFTKSMTAPQHVQPSNNVKLYDNESISEFDDSA
YGGDTCSKEELFQRYQRAQTLARRFKTRFLEAAESCKKFESENNKLTRTL
TDSQDKQIRRINELKEQVELDKKAKQDVEENYVLMIEEKTEMVNVLKLQV
SLLKEGKDLPPELEEQIKLKHEVEVLLEKQKQDEIKELKNSLSQRENLLQ
RCKDKINSLNSQLNELKSKFATMQNTSIFNDDDKIFNDFSQQRAQQFSDS
DNIEQINIDRMKSAFKDLENKNFQLEQEIKSHCDVKCSDLKLEVQQLKEK
IRSLTLENENLFEQVNIKTKIIQDLMNDQFAQNQEFCDPSILNTPVEKLK
LCKLIISKHSSCVHPIIDELQSVIGTMKIAPNVIDMSSSYVGNSEEFTEN
VIASDSKENETFADLAEQNKFLNSKIEQMVKLKSICEEENINREKELVET
VSILEDERKDLIAKIKKFEEDSEIFKKDIKELCYKNEEILHKLSETQLSL
NKIELEKLSITEEKNILFKNLESLEQSLKNLQIENEKLLFEMKKLHNENS
ELDSNLSSKCIELESYSKVFTGKQEECKHLTDKLDESFATIDYLNEEKNE
LLSKLNGRQFDESNKDEKFSLVVIEMQQRFEQESEEMKKKQSECEKINEE
QSVQIKQLNSQLDEYKEFADLSKKELEQLKTQYRELIEEYEAKEIVIKNL
ETDIENLNKEIELLKIQLEEIIEKLSSTLREKEGLGNEIQNFNLINKNLQ
SEIDYSKNNTCKLLEEIENLTLTVKEKSELLEKAISEKVLLNENLSSTLN
QLESVQLQLADLTSKHNYFIKENQSIVETLQQSSVENEPLKLRTTQLESH
IETILKQKEELINTLNITKEEVNTLKIKNQEFSDEIIKIESIEEKLTLEL
REKSHLLVKENQEKIQINNNNIELSKENEKNLKELELLKCQLVDKEELVA
KNEKLNKENITLLKQFEALKKETVSYQTETIVEKDVLNNLKEELFNLNSV
KSNLEEQYSTIQSENVTITKSLNEEKLALEKLVEEKSKIITELEEDLKSH
SMTIVSNEESIASLQKTIDNQNETISLEVQTKTDLSSQINLMESYLYKFC
SWIENLTSIENCHGECNQPIPDNWNGDMEFKCSESKILEFVGQSIEKLLS
INHRFHREFHENSKRSIEMLKTQSELQKKLDTTLNEVDSILKKNCDNYDS
FDDNISLKLEFLNSTMISLTDQLLVKSNLLSEIESQVFKLSEALNIDNLS
LIDSSTPESFCLNGLEKKIINIVNYYKQELLIKEEIHQKTQSEYEKVTDE
KSEKLSILMVQMFKQLINIFHLTDIHVNNVSDITKQTRKNVIKKLKEFGK
NHEQLKTEIEDINIKLISKEKDLKTSDALNQNIQSELDDLKNSVANDRDR
LIATSEELESSMRRLNEVADEKGRIDEEKQSLRKELKELNEKISNLKMEF
EKQSSEKERLEMQFDESLEKVKLNHAALEEMYKKELGTQHEYQRNLEEQM
ACHKESTDLKLTESEKKLELVLNQSEQLLELNYQYKKLLDEAKIETSEIE
TKYLTLEQETSEFLSELNRLKVEKIELMETINNLNISHSEMSAQCENWKS
NISILQDENKRLSENIQKVTRVKNEEIEVIKTELNHTKVIKETLKNKIDL
LESTSEELILKEKSILNQSSEMRSEKAEFENQIANLQSKLDETEIKCLTS
SNEKNQLMIQLNEQIKTINQLKSQINELKNVSYSYKNQIENFSLEIEQIK
TRHDIEKEEMEQQFADERINIDDDVNQRLKKLTKEFTDKIFEKERDFQKT
FEEALSSIRKDESRMKSDLRSTIDDLNKSTIELQTERNQLLDQISYNNKE
IKTLKKLIDAKDLEFESLKEELSHSIVKINELENEKQALITAKISKMNQT
VESGTCYEEPFLDNITVKDHEVLLMHCSDIEEQLKQLQSENINLRRLMAV
NNNDLSSPAILEPVIYSSKTKQLSSQQSLANDTVKHSIQHHTSIYRSPNT
SCSDYTFCPIPITEATDYEYLHDVLLKYMTGMETEILAKVVCTVMKFSNE
ETSRVLCFEQDRNKFIRRIL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000237GRIP_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0000042protein targeting to Golgi
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 901..935
NoneNo IPR availableCOILSCoilCoilcoord: 1072..1096
NoneNo IPR availableCOILSCoilCoilcoord: 1691..1711
NoneNo IPR availableCOILSCoilCoilcoord: 228..276
NoneNo IPR availableCOILSCoilCoilcoord: 501..521
NoneNo IPR availableCOILSCoilCoilcoord: 136..156
NoneNo IPR availableCOILSCoilCoilcoord: 1719..1809
NoneNo IPR availableCOILSCoilCoilcoord: 1589..1609
NoneNo IPR availableCOILSCoilCoilcoord: 817..837
NoneNo IPR availableCOILSCoilCoilcoord: 337..364
NoneNo IPR availableCOILSCoilCoilcoord: 673..802
NoneNo IPR availableCOILSCoilCoilcoord: 564..605
NoneNo IPR availableCOILSCoilCoilcoord: 1970..2000
NoneNo IPR availableCOILSCoilCoilcoord: 957..1022
NoneNo IPR availableCOILSCoilCoilcoord: 1873..1893
NoneNo IPR availableCOILSCoilCoilcoord: 1617..1672
NoneNo IPR availableCOILSCoilCoilcoord: 1037..1057
NoneNo IPR availableCOILSCoilCoilcoord: 308..328
NoneNo IPR availableCOILSCoilCoilcoord: 845..865
NoneNo IPR availableCOILSCoilCoilcoord: 1561..1581
NoneNo IPR availableCOILSCoilCoilcoord: 1388..1520
NoneNo IPR availableCOILSCoilCoilcoord: 161..181
NoneNo IPR availableCOILSCoilCoilcoord: 1901..1949
NoneNo IPR availableGENE3DG3DSA:1.10.220.60coord: 2062..2118
e-value: 8.5E-15
score: 56.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 28..52
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 22..52
NoneNo IPR availablePANTHERPTHR19327GOLGINcoord: 11..269
coord: 1218..2116
NoneNo IPR availableSUPERFAMILYSSF101283GRIP domaincoord: 2065..2113
IPR000237GRIP domainSMARTSM007551gripcoord: 2064..2108
e-value: 2.3E-6
score: 37.2
IPR000237GRIP domainPFAMPF01465GRIPcoord: 2066..2104
e-value: 3.2E-5
score: 23.7
IPR000237GRIP domainPROSITEPS50913GRIPcoord: 2061..2108
score: 10.216