Fras1 related extracellular matrix protein

Overview
NameFras1 related extracellular matrix protein
Smed IDSMED30035611
Length (bp)2794
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Fras1 related extracellular matrix protein (SMED30035611) t-SNE clustered cells

Violin plots show distribution of expression levels for Fras1 related extracellular matrix protein (SMED30035611) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Fras1 related extracellular matrix protein (SMED30035611) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Fras1 related extracellular matrix protein (SMED30035611) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035611

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30035611SMESG000032220.1 dd_Smed_v4_2407_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30035611SMESG000032220.1 dd_Smed_v4_2407_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035611SMESG000032220.1 dd_Smed_v4_2407_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035611SMESG000032220.1 dd_Smed_v4_2407_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30035611SMESG000032220.1 dd_Smed_v4_2407_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30035611SMESG000032220.1 dd_Smed_v4_2407_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30035611SMESG000032220.1 dd_Smed_v4_2407_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035611SMESG000032220.1 dd_Smed_v4_2407_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30035611SMESG000032220.1 dd_Smed_v4_2407_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30035611SMESG000032220.1 dd_Smed_v4_2407_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30035611SMESG000032220.1 dd_Smed_v4_2407_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035611SMESG000032220.1 dd_Smed_v4_2407_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Fras1 related extracellular matrix protein vs. Ensembl Human
Match: GPR158 (G protein-coupled receptor 158 [Source:HGNC Symbol;Acc:HGNC:23689])

HSP 1 Score: 72.4034 bits (176), Expect = 3.504e-12
Identity = 50/177 (28.25%), Postives = 76/177 (42.94%), Query Frame = 3
Query: 2064 DLGSKA---FSPYTENSWFKVLKERWGSNAYGL-----ERFKGKPWIRSDINGSQIQRYFHYPLFYYAPRYQDGYWSNPYFDCD--GFVPNWIMMYSAPFFGNVGSSGRVEFMGVVTVSVPLSELDINQCPSSFYTPNFFKNTATCDYRSTYCTPFPGRKFGLGNYKCECRQGFEYP 2564
            DL S A    +   E  WF  L+ +W  + +        R  G  W R D  G     +                WS PY +C+   + P W++  S+  +G +  +   EF GV+ V + L ++DI+QC S      +F  T  C   ++ C P  G  F LG Y+C C+ GF +P
Sbjct:  126 DLSSSAPHLANATLETEWFHGLRRKWRPHLHRRGPNQGPRGLGHSWRRKDGLGGDKSHF---------------KWSPPYLECENGSYKPGWLVTLSSAIYG-LQPNLVPEFRGVMKVDINLQKVDIDQCSSD----GWFSGTHKCHLNNSECMPIKGLGFVLGAYECICKAGFYHP 282          
BLAST of Fras1 related extracellular matrix protein vs. Ensembl Human
Match: GPR158 (G protein-coupled receptor 158 [Source:HGNC Symbol;Acc:HGNC:23689])

HSP 1 Score: 72.4034 bits (176), Expect = 3.615e-12
Identity = 50/177 (28.25%), Postives = 76/177 (42.94%), Query Frame = 3
Query: 2064 DLGSKA---FSPYTENSWFKVLKERWGSNAYGL-----ERFKGKPWIRSDINGSQIQRYFHYPLFYYAPRYQDGYWSNPYFDCD--GFVPNWIMMYSAPFFGNVGSSGRVEFMGVVTVSVPLSELDINQCPSSFYTPNFFKNTATCDYRSTYCTPFPGRKFGLGNYKCECRQGFEYP 2564
            DL S A    +   E  WF  L+ +W  + +        R  G  W R D  G     +                WS PY +C+   + P W++  S+  +G +  +   EF GV+ V + L ++DI+QC S      +F  T  C   ++ C P  G  F LG Y+C C+ GF +P
Sbjct:  205 DLSSSAPHLANATLETEWFHGLRRKWRPHLHRRGPNQGPRGLGHSWRRKDGLGGDKSHF---------------KWSPPYLECENGSYKPGWLVTLSSAIYG-LQPNLVPEFRGVMKVDINLQKVDIDQCSSD----GWFSGTHKCHLNNSECMPIKGLGFVLGAYECICKAGFYHP 361          
BLAST of Fras1 related extracellular matrix protein vs. Ensembl Human
Match: GPR179 (G protein-coupled receptor 179 [Source:HGNC Symbol;Acc:HGNC:31371])

HSP 1 Score: 72.4034 bits (176), Expect = 3.844e-12
Identity = 38/98 (38.78%), Postives = 49/98 (50.00%), Query Frame = 3
Query: 2268 SNPYFDCDG--FVPNWIMMYSAPFFGNVGSSGRVEFMGVVTVSVPLSELDINQCPSSFYTPNFFKNTATCDYRSTYCTPFPGRKFGLGNYKCECRQGF 2555
            S P+ +C      P W++  SA F+G +      E  G V + V L  +DINQC S    P ++ NT  CD  ST C P   + F LG Y C CR GF
Sbjct:  230 SPPFLECQEGRLRPGWLITLSATFYG-LKPDLSPEVRGQVQMDVDLQSVDINQCASG---PGWYSNTHLCDLNSTQCVPLESQGFVLGRYLCRCRPGF 323          
BLAST of Fras1 related extracellular matrix protein vs. Ensembl Human
Match: GPR179 (G protein-coupled receptor 179 [Source:HGNC Symbol;Acc:HGNC:31371])

HSP 1 Score: 72.4034 bits (176), Expect = 3.943e-12
Identity = 38/98 (38.78%), Postives = 49/98 (50.00%), Query Frame = 3
Query: 2268 SNPYFDCDG--FVPNWIMMYSAPFFGNVGSSGRVEFMGVVTVSVPLSELDINQCPSSFYTPNFFKNTATCDYRSTYCTPFPGRKFGLGNYKCECRQGF 2555
            S P+ +C      P W++  SA F+G +      E  G V + V L  +DINQC S    P ++ NT  CD  ST C P   + F LG Y C CR GF
Sbjct:  230 SPPFLECQEGRLRPGWLITLSATFYG-LKPDLSPEVRGQVQMDVDLQSVDINQCASG---PGWYSNTHLCDLNSTQCVPLESQGFVLGRYLCRCRPGF 323          
BLAST of Fras1 related extracellular matrix protein vs. Ensembl Human
Match: GPR179 (G protein-coupled receptor 179 [Source:HGNC Symbol;Acc:HGNC:31371])

HSP 1 Score: 70.4774 bits (171), Expect = 1.465e-11
Identity = 37/98 (37.76%), Postives = 47/98 (47.96%), Query Frame = 3
Query: 2268 SNPYFDCDG--FVPNWIMMYSAPFFGNVGSSGRVEFMGVVTVSVPLSELDINQCPSSFYTPNFFKNTATCDYRSTYCTPFPGRKFGLGNYKCECRQGF 2555
            S P+ +C      P W++  SA F+G           G V + V L  +DINQC S    P ++ NT  CD  ST C P   + F LG Y C CR GF
Sbjct:  230 SPPFLECQEGRLRPGWLITLSATFYGLKPDLSPEVSRGQVQMDVDLQSVDINQCASG---PGWYSNTHLCDLNSTQCVPLESQGFVLGRYLCRCRPGF 324          
BLAST of Fras1 related extracellular matrix protein vs. Ensembl Fly
Match: CG31195 (gene:FBgn0051195 transcript:FBtr0302188)

HSP 1 Score: 278.87 bits (712), Expect = 1.461e-80
Identity = 145/359 (40.39%), Postives = 212/359 (59.05%), Query Frame = 3
Query: 1665 MDKMMQFINNVSIGNCKSFTKDQLSLPGEVGYGSETHFEIQGRVALRLAHFLSAYYQNNIKNEKYGNLRPG-RTINREHLFGEVFANVMADLNIKSSGVFFDRQKFVDDNDTRKDLFGPYAYKQDGSLQAYAAIDLG--SKAFSPYTENSWFKVLKERWGSNAYGLERFKGKPWIRSDINGSQIQRYFHYPLFYYAPRYQDGYWSNPYFDCDGFVPNWIMMYSAPFFGNVGSSGRVEFMGVVTVSVPLSELDINQCPSSFYTPNFFKNTATCDYRSTYCTPFPGRKFGLGNYKCECRQGFEYPFGDALWFYPGQLLEKEYRNKLIGVANRYDTLQCRESVGSRIYISSVLFCLSFLISV 2732
            +D+ +++I+ V+   CK+F    L L G+V +G++  FE + ++A+RLA+F+SA+ Q +  NE Y   R   + +  + + GE  A V+ D  + S+ + ++R KF     T +  F PYAYK + + + +   DL   +K    YTE  +FK LK+RW +N   LE F  K  IR +  G   Q+Y HYP  Y A   + GYW+ P FDCDG+V  W++ Y+ PFFG      ++EF GVV VS+ + +LDINQCP  +Y PN FKNT  CD +S+YC P  GR +  G YKCEC QG+EYPF D + +Y GQL+E EY+N +  V  RYD  +CR +  S   + S L  +  LI +
Sbjct:  447 IDQALKYIHGVNYRTCKNFHPQDLILRGDVSFGAKEQFENEAKMAVRLANFISAFLQVSDPNEVYSGKRVADKPLTEDQMIGETLAIVLGDSKVWSATMLWERNKF-----TNRTYFAPYAYKTELNTRKFKVEDLARLNKTHELYTEKKYFKFLKQRWNTNFDDLETFYMKIKIRHNETGEYQQKYEHYPNSYRAANIKHGYWTQPQFDCDGYVKKWLVTYAVPFFGWDSLKVKLEFKGVVAVSMDMLQLDINQCPDWYYEPNAFKNTHKCDEQSSYCVPIMGRGYETGGYKCECLQGYEYPFEDLITYYDGQLVEAEYQNIVADVETRYDMFKCRLAGASG--LQSALGLVVALIGL 798          

HSP 2 Score: 209.92 bits (533), Expect = 2.006e-56
Identity = 132/332 (39.76%), Postives = 193/332 (58.13%), Query Frame = 1
Query:  106 DTYEEIMIKMDSVNRDNCLLKSWDELTLPVDSVAMLPVFNTLFKTPWVANRSSLLHMHNMAMNRGFFYSYILQK--LNTSDADFPDLPGLHYYYLSASADVSANPGIINGSSVFFDTNCQYANWIQNLEFNHTLPLFGPKAWRLDDWNDEINWLRGEPTNFTIEIIDYGA----GPNNNYTNPQYKFNPWMKDKEMNIDFLPDYVYSNARSHQTDFVIYEKYENGTMGQVSLNFFGPPQPGVKEVFQPVRFTRPYFDCKRSKKWIVTAIGPVVDYMARYVPPQVLNVRRPRIVGVTTMDIDFLRIDFNPCPTAEGNEA-HYFANVARCKATT 1080
            D ++EI  + D VN DNC ++   +L +P+D+V+  P    +   P   NR++LLH+ NMA++R FF+SYILQ   +  +  D  D PG+ YY+LS  ADVSANP  IN S+V+F  N  Y++  +   FN T P FGP+ +RLDD+ND I+ L+   T  T ++ D GA      + +YT+  YK N W +       +LPD V     +  T + +  +Y N T    +  F GP  PG +E   P++FTRPYFDC RS KW+V A+ P+ D   R+   Q  ++  P+   V+ +++DF RID N CP  EGN+  ++FA+ ARCK  T
Sbjct:   32 DAFDEIKRQFDKVNADNCPIQHHSDLFMPMDAVSHKPDIKEINVNPVFPNRTALLHLQNMALSRSFFWSYILQSRFIRPAINDTYD-PGMMYYFLSTVADVSANPH-INASAVYFSPNSSYSSSYRGF-FNKTFPRFGPRTFRLDDFNDPIH-LQKISTWNTFDVQDLGAHHPDSISKDYTHDLYKINEWYR------AWLPDNVEGRHDTKIT-YQVEIRYANNT--NETYTFHGP--PGSEENPGPIKFTRPYFDCGRSNKWLVAAVVPIADIYPRHT--QFRHIEYPKYTAVSVLEMDFERIDINQCPLGEGNKGPNHFADTARCKKET 346          

HSP 3 Score: 65.4698 bits (158), Expect = 2.146e-10
Identity = 30/69 (43.48%), Postives = 42/69 (60.87%), Query Frame = 3
Query: 1053 QCCKM*GDNNALFHFGFYRGGYQCNCRPGYRLPYYQNGPFQGVDIERATEEEYKSGFDCLPVSWKQVNP 1259
            +C K   +   L  +GF RGGYQC C+PG+RLP     P+ G  +ERA+ E+Y + +DCL + W Q  P
Sbjct:  341 RCKKETTECEPLQGWGFRRGGYQCRCKPGFRLPNVVRRPYLGEIVERASAEQYYNEYDCLKIGWIQKLP 409          

HSP 4 Score: 58.5362 bits (140), Expect = 2.324e-8
Identity = 36/108 (33.33%), Postives = 48/108 (44.44%), Query Frame = 3
Query: 2265 WSNPYFDCDGFVPNWIMMYSAPF---FGNVGSSGRVEFMGVVTVSV---PLSELDINQCP--SSFYTPNFFKNTATCDYRSTYCTPFPGRKFGLGNYKCECRQGFEYP 2564
            ++ PYFDC G    W++    P    +        +E+     VSV       +DINQCP       PN F +TA C   +T C P  G  F  G Y+C C+ GF  P
Sbjct:  267 FTRPYFDC-GRSNKWLVAAVVPIADIYPRHTQFRHIEYPKYTAVSVLEMDFERIDINQCPLGEGNKGPNHFADTARCKKETTECEPLQGWGFRRGGYQCRCKPGFRLP 373          
BLAST of Fras1 related extracellular matrix protein vs. Ensembl Fly
Match: CG43795 (gene:FBgn0264339 transcript:FBtr0331989)

HSP 1 Score: 112.849 bits (281), Expect = 5.899e-25
Identity = 99/361 (27.42%), Postives = 161/361 (44.60%), Query Frame = 3
Query: 1653 KLPKMDKMMQFINNVSI--GNCKSFTKDQLSLPGEVGYGSETHFEIQGRVALRLAHFLSAYYQNNIKNEKYGNLRPGRTINRE--HLFGEVFANVMADLNIKSSGVFFDRQKFVDDNDTRKDLFGPYAYKQDG-SLQAYAAIDLGSKAFSPYTENSWFKVLKERWGSNAYGLERFKGKPWIRSDINGSQIQRYFHYPLFYYAPRYQDGYWSNPYFDCDGFVPNWIMMYSAPFFGNVGSSGRVEFMGVVTVSVPLSELDINQCPSSFYTP------NFFKNTATCDYRSTYCTPFPGRKFGLGNYKCECRQGFEYP-FGDALWFYPGQLLEKEYRNKLIG------VANRYDTLQCRESVGS 2681
            K+  + K +Q+I    +   NC + T   L   G V   ++  F ++  VA+  A+ L+  ++             GR++  +   L   V + V  D +I ++G  FD     +++  +  LF P+AY+    +L A  A DL  +       + WF + ++         E++     + S+    +I+          A +Y+DG WS PY+DC G    W++ Y+ PFFG    +G   F G   + + L  +DI+QCP   +TP      N F  T  C  R+T C    G  F  G+YKC CR+GF +P       F+ G LLE+EY   ++G        + Y+ L C E   S
Sbjct:  401 KIDLVSKFLQYIEQQHLMGSNCVAGTSLNLG-EGVVDRYAQDRFRVEAEVAVNRANMLTRIFKTT-----------GRSVQEDVNLLHASVLSMVEFDDDIFAAGNCFDW----NEHPAQPGLFCPFAYRLPPPNLGAVFAKDLAMEYHYLGNTSEWFFLARKNAEKVIARNEQYLKSFHLYSNRTEERIEDD------TLAVKYEDGRWSKPYYDCGGG-NIWMLTYTVPFFGY--ENGTYHFKGTSGIDIDLRRVDIDQCPQR-HTPGTKRPLNIFAGTDKCKQRTTMCEAIMGLGFRRGSYKCLCRKGFYFPDIVSQHKFFNGSLLEEEYEKLMLGKNSTYNSNSEYECLPCAEGCDS 735          

HSP 2 Score: 40.0466 bits (92), Expect = 8.897e-7
Identity = 27/100 (27.00%), Postives = 42/100 (42.00%), Query Frame = 1
Query:  823 FQPVRFTRPYFDCKRSKKWIVTAIGPVVDYM-ARYVPPQVLNVRRPRIVGVTTMDIDFLRIDFNPCPT----AEGNEAHYFANVARCKA-TTMLYFILGF 1104
            ++  R+++PY+DC     W++T   P   Y    Y              G + +DID  R+D + CP           + FA   +CK  TTM   I+G 
Sbjct:  583 YEDGRWSKPYYDCGGGNIWMLTYTVPFFGYENGTY-----------HFKGTSGIDIDLRRVDIDQCPQRHTPGTKRPLNIFAGTDKCKQRTTMCEAIMGL 671          

HSP 3 Score: 33.4982 bits (75), Expect = 8.897e-7
Identity = 20/64 (31.25%), Postives = 29/64 (45.31%), Query Frame = 3
Query: 1083 ALFHFGFYRGGYQCNCRPGYRLP--YYQNGPFQGVDIERATEE---------EYKSGFDCLPVS 1241
            A+   GF RG Y+C CR G+  P    Q+  F G  +E   E+            S ++CLP +
Sbjct:  667 AIMGLGFRRGSYKCLCRKGFYFPDIVSQHKFFNGSLLEEEYEKLMLGKNSTYNSNSEYECLPCA 730          
BLAST of Fras1 related extracellular matrix protein vs. Ensembl Zebrafish
Match: gpr158b (G protein-coupled receptor 158b [Source:ZFIN;Acc:ZDB-GENE-130530-875])

HSP 1 Score: 86.2705 bits (212), Expect = 1.794e-17
Identity = 44/107 (41.12%), Postives = 63/107 (58.88%), Query Frame = 3
Query: 2265 WSNPYFDCDG--FVPNWIMMYSAPFFGNVGSSGRVEFMGVVTVSVPLSELDINQCPSSFYTPNFFKNTATCDYRSTYCTPFPGRKFGLGNYKCECRQGFEYPFGDAL 2579
            WS+PY +C+   FVP+W++  SA F+G + +    EF GVV V V L ++DI+QC +S     +F  T  C+  S  C P  G  F L  YKC+C++GF +P   AL
Sbjct:  261 WSSPYLECEHGRFVPHWLLTISAGFYG-LKNKTAPEFRGVVRVDVNLQDVDIDQCSNS----GWFAGTHRCNLTSMECNPIVGHGFVLDKYKCQCKRGFYHPSRVAL 362          
BLAST of Fras1 related extracellular matrix protein vs. Ensembl Zebrafish
Match: gpr158b (G protein-coupled receptor 158b [Source:ZFIN;Acc:ZDB-GENE-130530-875])

HSP 1 Score: 87.8113 bits (216), Expect = 4.062e-17
Identity = 42/102 (41.18%), Postives = 61/102 (59.80%), Query Frame = 3
Query: 2265 WSNPYFDCDG--FVPNWIMMYSAPFFGNVGSSGRVEFMGVVTVSVPLSELDINQCPSSFYTPNFFKNTATCDYRSTYCTPFPGRKFGLGNYKCECRQGFEYP 2564
            WS+PY +C+   FVP+W++  SA F+G + +    EF GVV V V L ++DI+QC +S     +F  T  C+  S  C P  G  F L  YKC+C++GF +P
Sbjct:  261 WSSPYLECEHGRFVPHWLLTISAGFYG-LKNKTAPEFRGVVRVDVNLQDVDIDQCSNS----GWFAGTHRCNLTSMECNPIVGHGFVLDKYKCQCKRGFYHP 357          
BLAST of Fras1 related extracellular matrix protein vs. Ensembl Zebrafish
Match: gpr158a (G protein-coupled receptor 158a [Source:ZFIN;Acc:ZDB-GENE-060130-18])

HSP 1 Score: 84.3445 bits (207), Expect = 4.427e-16
Identity = 38/103 (36.89%), Postives = 58/103 (56.31%), Query Frame = 3
Query: 2262 YWSNPYFDCDG--FVPNWIMMYSAPFFGNVGSSGRVEFMGVVTVSVPLSELDINQCPSSFYTPNFFKNTATCDYRSTYCTPFPGRKFGLGNYKCECRQGFEYP 2564
            +WS PY +C+   F+P W++  SA F+G +  +   +F GVV V V L ++DI+QC +      +F  T  C+  +  C P PG  F L  YKC C+ G+ +P
Sbjct:  246 HWSAPYLECENGNFIPRWLLTLSAGFYG-LKPNRNPDFRGVVRVDVSLQDVDIDQCSAD----GWFAGTHRCNITTMECLPVPGHGFVLDKYKCHCKSGYYHP 343          
BLAST of Fras1 related extracellular matrix protein vs. Ensembl Zebrafish
Match: gpr158a (G protein-coupled receptor 158a [Source:ZFIN;Acc:ZDB-GENE-060130-18])

HSP 1 Score: 84.3445 bits (207), Expect = 4.614e-16
Identity = 38/103 (36.89%), Postives = 58/103 (56.31%), Query Frame = 3
Query: 2262 YWSNPYFDCDG--FVPNWIMMYSAPFFGNVGSSGRVEFMGVVTVSVPLSELDINQCPSSFYTPNFFKNTATCDYRSTYCTPFPGRKFGLGNYKCECRQGFEYP 2564
            +WS PY +C+   F+P W++  SA F+G +  +   +F GVV V V L ++DI+QC +      +F  T  C+  +  C P PG  F L  YKC C+ G+ +P
Sbjct:  246 HWSAPYLECENGNFIPRWLLTLSAGFYG-LKPNRNPDFRGVVRVDVSLQDVDIDQCSAD----GWFAGTHRCNITTMECLPVPGHGFVLDKYKCHCKSGYYHP 343          
BLAST of Fras1 related extracellular matrix protein vs. Ensembl Zebrafish
Match: gpr158a (G protein-coupled receptor 158a [Source:ZFIN;Acc:ZDB-GENE-060130-18])

HSP 1 Score: 82.4185 bits (202), Expect = 1.780e-15
Identity = 38/103 (36.89%), Postives = 58/103 (56.31%), Query Frame = 3
Query: 2262 YWSNPYFDCDG--FVPNWIMMYSAPFFGNVGSSGRVEFMGVVTVSVPLSELDINQCPSSFYTPNFFKNTATCDYRSTYCTPFPGRKFGLGNYKCECRQGFEYP 2564
            +WS PY +C+   F+P W++  SA F+G +  +   +F GVV V V L ++DI+QC +      +F  T  C+  +  C P PG  F L  YKC C+ G+ +P
Sbjct:  246 HWSAPYLECENGNFIPRWLLTLSAGFYG-LKPNRNPDFRGVVRVDVSLQDVDIDQCSAD----GWFAGTHRCNITTMECLPVPGHGFVLDKYKCHCKSGYYHP 343          
BLAST of Fras1 related extracellular matrix protein vs. Ensembl Xenopus
Match: GPR158 (G protein-coupled receptor 158 [Source:NCBI gene;Acc:779597])

HSP 1 Score: 88.5817 bits (218), Expect = 3.209e-17
Identity = 55/172 (31.98%), Postives = 79/172 (45.93%), Query Frame = 3
Query: 2214 YFHYPLFYYAPRYQDGY--------------WSNPYFDCDG--FVPNWIMMYSAPFFGNVGSSGRVEFMGVVTVSVPLSELDINQCPSSFYTPNFFKNTATCDYRSTYCTPFPGRKFGLGNYKCECRQGFEYPFG----DALWFYPGQLLEKEYRNKLIGVANRYDTLQCRE 2669
            + H  L + A  + DG+              WS+PY +C+   + P+W++  SA F+G   +  R EF GV+ V V L  +DI+QC +      +F  T  C + S+ C P  G  F LG YKC C+ GF YP G    +     PG L       ++      Y  L CRE
Sbjct:  223 HLHKRLLHGAKTFDDGWKKGNSYVTDRSHVKWSSPYLECENGKYRPHWLLSLSAAFYGLKPNLVR-EFRGVLKVDVNLQNIDIDQCSNE----GWFSGTHRCQHNSSKCIPTKGLGFVLGAYKCTCKAGFYYPHGMFSENGFQSKPGPLWPHHKSGEI--SEEEYKCLPCRE 387          
BLAST of Fras1 related extracellular matrix protein vs. Ensembl Xenopus
Match: GPR158 (G protein-coupled receptor 158 [Source:NCBI gene;Acc:779597])

HSP 1 Score: 86.2705 bits (212), Expect = 1.801e-16
Identity = 51/154 (33.12%), Postives = 78/154 (50.65%), Query Frame = 3
Query: 2214 YFHYPLFYYAPRYQDGY--------------WSNPYFDCDG--FVPNWIMMYSAPFFGNVGSSGRVEFMGVVTVSVPLSELDINQCPSSFYTPNFFKNTATCDYRSTYCTPFPGRKFGLGNYKCECRQGFEYP---FGDALWFYPGQLLEKEYR 2618
            + H  L + A  + DG+              WS+PY +C+   + P+W++  SA F+G   +  R EF GV+ V V L  +DI+QC +      +F  T  C + S+ C P  G  F LG YKC C+ GF YP   F +  +   G++ E+EY+
Sbjct:  135 HLHKRLLHGAKTFDDGWKKGNSYVTDRSHVKWSSPYLECENGKYRPHWLLSLSAAFYGLKPNLVR-EFRGVLKVDVNLQNIDIDQCSNE----GWFSGTHRCQHNSSKCIPTKGLGFVLGAYKCTCKAGFYYPHGMFSENGFQSKGEISEEEYK 283          
BLAST of Fras1 related extracellular matrix protein vs. Ensembl Xenopus
Match: GPR158 (G protein-coupled receptor 158 [Source:NCBI gene;Acc:779597])

HSP 1 Score: 85.1149 bits (209), Expect = 4.291e-16
Identity = 56/179 (31.28%), Postives = 84/179 (46.93%), Query Frame = 3
Query: 2214 YFHYPLFYYAPRYQDGY--------------WSNPYFDCDG--FVPNWIMMYSAPFFGNVGSSGRVEFMGVVTVSVPLSELDINQCPSSFYTPNFFKNTATCDYRSTYCTPFPGRKFGLGNYKCECRQGFEYPFG----------DALWFYP-GQLLEKEYRNKLIGVANRYDTLQCRE 2669
            + H  L + A  + DG+              WS+PY +C+   + P+W++  SA F+G   +  R EF GV+ V V L  +DI+QC +      +F  T  C + S+ C P  G  F LG YKC C+ GF YP G          + +  +P G++ E+EY+            L CRE
Sbjct:  223 HLHKRLLHGAKTFDDGWKKGNSYVTDRSHVKWSSPYLECENGKYRPHWLLSLSAAFYGLKPNLVR-EFRGVLKVDVNLQNIDIDQCSNE----GWFSGTHRCQHNSSKCIPTKGLGFVLGAYKCTCKAGFYYPHGMFSENGFQRPNMVNHFPRGEISEEEYK-----------CLPCRE 385          
BLAST of Fras1 related extracellular matrix protein vs. Ensembl Xenopus
Match: GPR158 (G protein-coupled receptor 158 [Source:NCBI gene;Acc:779597])

HSP 1 Score: 84.7297 bits (208), Expect = 5.083e-16
Identity = 56/179 (31.28%), Postives = 84/179 (46.93%), Query Frame = 3
Query: 2214 YFHYPLFYYAPRYQDGY--------------WSNPYFDCDG--FVPNWIMMYSAPFFGNVGSSGRVEFMGVVTVSVPLSELDINQCPSSFYTPNFFKNTATCDYRSTYCTPFPGRKFGLGNYKCECRQGFEYPFG----------DALWFYP-GQLLEKEYRNKLIGVANRYDTLQCRE 2669
            + H  L + A  + DG+              WS+PY +C+   + P+W++  SA F+G   +  R EF GV+ V V L  +DI+QC +      +F  T  C + S+ C P  G  F LG YKC C+ GF YP G          + +  +P G++ E+EY+            L CRE
Sbjct:  223 HLHKRLLHGAKTFDDGWKKGNSYVTDRSHVKWSSPYLECENGKYRPHWLLSLSAAFYGLKPNLVR-EFRGVLKVDVNLQNIDIDQCSNE----GWFSGTHRCQHNSSKCIPTKGLGFVLGAYKCTCKAGFYYPHGMFSENGFQRPNMVNHFPRGEISEEEYK-----------CLPCRE 385          
BLAST of Fras1 related extracellular matrix protein vs. Ensembl Xenopus
Match: rpf2 (ribosome production factor 2 homolog [Source:Xenbase;Acc:XB-GENE-967404])

HSP 1 Score: 51.6026 bits (122), Expect = 7.728e-6
Identity = 27/76 (35.53%), Postives = 40/76 (52.63%), Query Frame = 3
Query: 2265 WSNPYFDCDG--FVPNWIMMYSAPFFGNVGSSGRVEFMGVVTVSVPLSELDINQCPSSFYTPNFFKNTATCDYRST 2486
            WS P+ +C+G  F+  W++  S  F+G +      EF G + V V L  L I+QC      P +F N+ +CD  ST
Sbjct:  258 WSKPFLECEGGHFLQGWMISLSTAFYG-LKPDLSPEFKGTLRVDVQLLNLGIDQCAKG---PGWFANSHSCDENST 329          
BLAST of Fras1 related extracellular matrix protein vs. Ensembl Mouse
Match: Gpr158 (G protein-coupled receptor 158 [Source:MGI Symbol;Acc:MGI:2441697])

HSP 1 Score: 76.6406 bits (187), Expect = 1.119e-13
Identity = 55/179 (30.73%), Postives = 77/179 (43.02%), Query Frame = 3
Query: 2064 DLGSKAF---SPYTENSWFKVLKERW-------GSNAYGLERFKGKPWIRSDINGSQIQRYFHYPLFYYAPRYQDGYWSNPYFDCD--GFVPNWIMMYSAPFFGNVGSSGRVEFMGVVTVSVPLSELDINQCPSSFYTPNFFKNTATCDYRSTYCTPFPGRKFGLGNYKCECRQGFEYP 2564
            DL S A    +   E  WF  L+ +W       GSN     R  G  W R D  G                      WS PY +C+   + P W++  SA F+G +  +   EF GV+ V + L ++DI+QC S      +F  T  C   ++ C P  G  F LG Y+C C+ GF +P
Sbjct:  205 DLSSSAHHLANATLETEWFHGLRRKWRPHLHRRGSNQG--PRGLGHSWRRRDGLGGDRSHV---------------KWSPPYLECENGSYKPGWLVTLSAAFYG-LQPNLVPEFRGVMKVDISLQKVDIDQCSSD----GWFSGTHKCHLNNSECMPIKGLGFVLGAYQCICKAGFYHP 361          
BLAST of Fras1 related extracellular matrix protein vs. Ensembl Mouse
Match: Gpr179 (G protein-coupled receptor 179 [Source:MGI Symbol;Acc:MGI:2443409])

HSP 1 Score: 72.0182 bits (175), Expect = 3.686e-12
Identity = 37/98 (37.76%), Postives = 49/98 (50.00%), Query Frame = 3
Query: 2268 SNPYFDCD--GFVPNWIMMYSAPFFGNVGSSGRVEFMGVVTVSVPLSELDINQCPSSFYTPNFFKNTATCDYRSTYCTPFPGRKFGLGNYKCECRQGF 2555
            S P+ +C      P W++  SA F+G +      E  G V + + L  +DINQC S    P ++ NT  CD  ST C P   + F LG Y C CR GF
Sbjct:  230 SPPFLECHEGQLRPGWLVTVSATFYG-LKPDLTPEVRGQVQMDIDLQSVDINQCASG---PGWYSNTHLCDLNSTQCVPLESQGFVLGRYLCRCRPGF 323          
BLAST of Fras1 related extracellular matrix protein vs. UniProt/SwissProt
Match: sp|Q8C419|GP158_MOUSE (Probable G-protein coupled receptor 158 OS=Mus musculus OX=10090 GN=Gpr158 PE=1 SV=2)

HSP 1 Score: 76.6406 bits (187), Expect = 7.826e-13
Identity = 55/179 (30.73%), Postives = 77/179 (43.02%), Query Frame = 3
Query: 2064 DLGSKAF---SPYTENSWFKVLKERW-------GSNAYGLERFKGKPWIRSDINGSQIQRYFHYPLFYYAPRYQDGYWSNPYFDCD--GFVPNWIMMYSAPFFGNVGSSGRVEFMGVVTVSVPLSELDINQCPSSFYTPNFFKNTATCDYRSTYCTPFPGRKFGLGNYKCECRQGFEYP 2564
            DL S A    +   E  WF  L+ +W       GSN     R  G  W R D  G                      WS PY +C+   + P W++  SA F+G +  +   EF GV+ V + L ++DI+QC S      +F  T  C   ++ C P  G  F LG Y+C C+ GF +P
Sbjct:  205 DLSSSAHHLANATLETEWFHGLRRKWRPHLHRRGSNQG--PRGLGHSWRRRDGLGGDRSHV---------------KWSPPYLECENGSYKPGWLVTLSAAFYG-LQPNLVPEFRGVMKVDISLQKVDIDQCSSD----GWFSGTHKCHLNNSECMPIKGLGFVLGAYQCICKAGFYHP 361          
BLAST of Fras1 related extracellular matrix protein vs. UniProt/SwissProt
Match: sp|E1BBQ2|GP158_BOVIN (Probable G-protein coupled receptor 158 OS=Bos taurus OX=9913 GN=GPR158 PE=3 SV=2)

HSP 1 Score: 75.485 bits (184), Expect = 2.091e-12
Identity = 52/178 (29.21%), Postives = 80/178 (44.94%), Query Frame = 3
Query: 2064 DLGSKAF---SPYTENSWFKVLKERWGSNAYGL-----ERFKGKPWIRSD-INGSQIQRYFHYPLFYYAPRYQDGYWSNPYFDCD--GFVPNWIMMYSAPFFGNVGSSGRVEFMGVVTVSVPLSELDINQCPSSFYTPNFFKNTATCDYRSTYCTPFPGRKFGLGNYKCECRQGFEYP 2564
            DL S A    +   E  WF  L+ +W ++ +        R  G  W R D ++G +                    WS PY +C+   + P W++  SA F+G +  +   EF GV+ V + L ++DI+QC S      +F  T  C   ++ C P  G  F LG Y+C C+ GF +P
Sbjct:  205 DLSSSAHHLANATLETEWFHGLRRKWRTHLHRRGSNQGPRGLGHSWRRRDGLSGDK----------------SHVKWSPPYLECENGSYKPGWLVTLSAAFYG-LQPNLVPEFRGVMKVDINLQKVDIDQCSSD----GWFSGTHKCHLNNSECMPIKGLGFVLGAYQCICKAGFYHP 361          
BLAST of Fras1 related extracellular matrix protein vs. UniProt/SwissProt
Match: sp|D4A6L0|GP158_RAT (Probable G-protein coupled receptor 158 OS=Rattus norvegicus OX=10116 GN=Gpr158 PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 3.132e-12
Identity = 54/179 (30.17%), Postives = 77/179 (43.02%), Query Frame = 3
Query: 2064 DLGSKAF---SPYTENSWFKVLKERW-------GSNAYGLERFKGKPWIRSDINGSQIQRYFHYPLFYYAPRYQDGYWSNPYFDCD--GFVPNWIMMYSAPFFGNVGSSGRVEFMGVVTVSVPLSELDINQCPSSFYTPNFFKNTATCDYRSTYCTPFPGRKFGLGNYKCECRQGFEYP 2564
            DL S A    +   E  WF  L+ +W       GSN     R  G  W R D  G                      WS P+ +C+   + P W++  SA F+G +  +   EF GV+ V + L ++DI+QC S      +F  T  C   ++ C P  G  F LG Y+C C+ GF +P
Sbjct:  205 DLSSSAHHLANATLETEWFHGLRRKWRPHLHRRGSNQG--PRGLGHSWRRRDGLGGDRSHV---------------KWSPPFLECENGSYKPGWLVTLSAAFYG-LQPNLVPEFRGVMKVDINLQKVDIDQCSSD----GWFSGTHKCHLNNSECMPIKGLGFVLGAYQCVCKAGFYHP 361          
BLAST of Fras1 related extracellular matrix protein vs. UniProt/SwissProt
Match: sp|Q5T848|GP158_HUMAN (Probable G-protein coupled receptor 158 OS=Homo sapiens OX=9606 GN=GPR158 PE=1 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.736e-11
Identity = 50/177 (28.25%), Postives = 76/177 (42.94%), Query Frame = 3
Query: 2064 DLGSKA---FSPYTENSWFKVLKERWGSNAYGL-----ERFKGKPWIRSDINGSQIQRYFHYPLFYYAPRYQDGYWSNPYFDCD--GFVPNWIMMYSAPFFGNVGSSGRVEFMGVVTVSVPLSELDINQCPSSFYTPNFFKNTATCDYRSTYCTPFPGRKFGLGNYKCECRQGFEYP 2564
            DL S A    +   E  WF  L+ +W  + +        R  G  W R D  G     +                WS PY +C+   + P W++  S+  +G +  +   EF GV+ V + L ++DI+QC S      +F  T  C   ++ C P  G  F LG Y+C C+ GF +P
Sbjct:  205 DLSSSAPHLANATLETEWFHGLRRKWRPHLHRRGPNQGPRGLGHSWRRKDGLGGDKSHF---------------KWSPPYLECENGSYKPGWLVTLSSAIYG-LQPNLVPEFRGVMKVDINLQKVDIDQCSSD----GWFSGTHKCHLNNSECMPIKGLGFVLGAYECICKAGFYHP 361          
BLAST of Fras1 related extracellular matrix protein vs. UniProt/SwissProt
Match: sp|Q6PRD1|GP179_HUMAN (Probable G-protein coupled receptor 179 OS=Homo sapiens OX=9606 GN=GPR179 PE=1 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 1.894e-11
Identity = 38/98 (38.78%), Postives = 49/98 (50.00%), Query Frame = 3
Query: 2268 SNPYFDCDG--FVPNWIMMYSAPFFGNVGSSGRVEFMGVVTVSVPLSELDINQCPSSFYTPNFFKNTATCDYRSTYCTPFPGRKFGLGNYKCECRQGF 2555
            S P+ +C      P W++  SA F+G +      E  G V + V L  +DINQC S    P ++ NT  CD  ST C P   + F LG Y C CR GF
Sbjct:  230 SPPFLECQEGRLRPGWLITLSATFYG-LKPDLSPEVRGQVQMDVDLQSVDINQCASG---PGWYSNTHLCDLNSTQCVPLESQGFVLGRYLCRCRPGF 323          
BLAST of Fras1 related extracellular matrix protein vs. TrEMBL
Match: A0A0X3Q0R0 (Putative G-protein coupled receptor 158 (Fragment) OS=Schistocephalus solidus OX=70667 GN=GP158 PE=4 SV=1)

HSP 1 Score: 508.449 bits (1308), Expect = 0.000e+0
Identity = 259/570 (45.44%), Postives = 353/570 (61.93%), Query Frame = 3
Query: 1095 FGFYRGGYQCNCRPGYRLPYYQNGPFQGVDIERATEEEYKSGFDCLPVSWKQVNPTVDGITDEDSTRKKRSVDE-------ENIDPWSDETTKWLRTEAKKASINRWNKLTVKQFGSKLKTKFAXXXXXXXXXXXXXXXXIQTVVHPKHPEPEILKAYRKKLEDKKTP----------------SPKLVQSRRKRSLDY--VGRLSGFEPDKLPKMDKMMQFINNVSIGNCKSFTKDQLSLPGEVGYGSETHFEIQGRVALRLAHFLSAYYQNNIKNEKYGNLRPGRTINREHLFGEVFANVMADLNIKSSGVFFDRQKFVDDNDTRKDLFGPYAYKQDGSLQAYAAIDLGSKAFSPYTENSWFKVLKERWGSNAYGLERFKGKPWIRSDINGSQIQRYFHYPLFYYAPRYQDGYWSNPYFDCDGFVPNWIMMYSAPFFGNVGSSGRVEFMGVVTVSVPLSELDINQCPSSFYTPNFFKNTATCDYRSTYCTPFPGRKFGLGNYKCECRQGFEYPFGDALWFYPGQLLEKEYRNKLIGVANRYDTLQCRESVGSRIYI--SSVLFCLSFL 2723
            FGF RGGY+C C+PGYRLP  QNGPF+G+DIE+ATE EY++GFDCLP+ W++V P    I      R +RS +E       E  D   D   + L+   +KAS        +   G +L+                      T+V PK  E E   +   KL     P                S +L + RR+ S+ +  +G    F      ++ +++ +++ V+  NC +   + L++PG V YG+E  FE++GR+ALRLAHFLSAYYQNNI  E YGNL+ G  +NR  LFGEV+A V++   I S GVFFD Q F D +    DLF PYAYK   S Q   AID+  + F  YT+  WF++LKERW S+ +GLER   KP+IRS+ING+Q+QRYF++PLFY  PRY+DGYW+ PY+ C GF   W++ Y+APFFG + +   ++FMGVVTVSV L+ LD+NQCP SFYTPNFFKN+A CD+++TYC P PGR+F  G+YKC CRQGFEYPF D  WF+ G+ +E+EY  KL+G  +RYD L+CR+ + +R+ I  S+VL  L+ +
Sbjct:  402 FGFARGGYECVCQPGYRLPMQQNGPFRGIDIEQATELEYQNGFDCLPIGWREVVPHEISIRG-SLQRVRRSTNESAEAATNEKEDDSDDLLCEILKQTVRKASA------FLSSVGYELRRALLYFSN-------------STIVRPKVVENENTSSVDWKLAPSVFPYAAEWEATRENPVSRDSTELNRPRREISIPFYFIGGGYTFSQQAFGEVQRLITYVDTVTPENCAAKAPEDLTMPGGVSYGAEVQFEMEGRMALRLAHFLSAYYQNNIVGELYGNLKSGSPLNRFELFGEVYATVLSSFQIVSCGVFFDHQAFTDHDGVTWDLFAPYAYKPTMSTQVAEAIDMSVQTFRNYTQQPWFRILKERWVSSRFGLERMTTKPYIRSNINGTQVQRYFNFPLFYRVPRYEDGYWTEPYYVCYGFQNGWVITYAAPFFGFLDNRKTLDFMGVVTVSVSLAHLDLNQCPQSFYTPNFFKNSAVCDFKNTYCEPIPGRRFRSGSYKCMCRQGFEYPFNDLSWFFDGETMEREYELKLLGKPSRYDLLKCRQGIAARLPIARSTVLLLLAVV 951          

HSP 2 Score: 342.043 bits (876), Expect = 0.000e+0
Identity = 174/342 (50.88%), Postives = 222/342 (64.91%), Query Frame = 1
Query:   85 PFTFYPHDTYEEIMIKMDSVNRDNCLLKSWDELTLPVDSVAMLPVFNTLFKTPWVANRSSLLHMHNMAMNRGFFYSYILQKLNTSDADFPDLPGLHYYYLSASADVSANPGIINGSSVFFDTNCQYANWIQNLEFNHTLPLFGPKAWRLDDWNDEINWLRGEPTNFTIEIIDYGAGPNNNYTNPQYKFNPWMKDKEMNIDFLPDYVYSNARSHQ--TDFVIYEKYENGTMGQVSLNFFGPPQPGVKEVFQPVRFTRPYFDCKRSKKWIVTAIGPVVDYMARYVPPQVLNVRRPRIVGVTTMDIDFLRIDFNPCPTAEGNEAHYFANVARCKATTMLYFILGF 1104
            PF++YP D ++ IM KM   N +NC   S  +LTLP  SV  LP +N +    W +NRS L+H+HN+A+NR +FYSYILQ+LN +D   P LP L YYY +ASADVS+ P  +N S +F DTNC YA+W      N T PLF P A RLD+WNDE N LR  P+N TIE+ D GAGPNNNYT P YK NP++ DKEM I ++PD+  +    +Q  T   + + Y         +NFFGP  PG+KE F PVRFTRPY+DC  S +WIV+A+  + DYM RY P  +  +R PR+VGV    +DFLRIDFNPC  + GN  H+ A V+RCK TTM   + GF
Sbjct:   64 PFSWYPRDNFDYIMEKMSRANPNNCPYLSEADLTLPATSVNQLPAYNRIPLQIWFSNRSKLMHLHNVALNRAYFYSYILQRLNATDTAPPLLPSLLYYYFAASADVSSAPNALNVSGMFMDTNCSYASWYVVESVNTTFPLFAPIARRLDNWNDETNILR-VPSNKTIELTDMGAGPNNNYTAPWYKNNPYIHDKEMGITYIPDHRGTALGKNQYSTRSQLADIYGRPLEQLEIVNFFGPNAPGIKETFLPVRFTRPYYDCGHSNRWIVSAVSALSDYMPRYSP--IDRLRGPRMVGVIVTSMDFLRIDFNPCKASLGNPTHFLAGVSRCKPTTMCVPLPGF 402          
BLAST of Fras1 related extracellular matrix protein vs. TrEMBL
Match: A0A0X3NYB9 (Putative G-protein coupled receptor 158 (Fragment) OS=Schistocephalus solidus OX=70667 GN=GP158 PE=4 SV=1)

HSP 1 Score: 508.449 bits (1308), Expect = 0.000e+0
Identity = 259/570 (45.44%), Postives = 353/570 (61.93%), Query Frame = 3
Query: 1095 FGFYRGGYQCNCRPGYRLPYYQNGPFQGVDIERATEEEYKSGFDCLPVSWKQVNPTVDGITDEDSTRKKRSVDE-------ENIDPWSDETTKWLRTEAKKASINRWNKLTVKQFGSKLKTKFAXXXXXXXXXXXXXXXXIQTVVHPKHPEPEILKAYRKKLEDKKTP----------------SPKLVQSRRKRSLDY--VGRLSGFEPDKLPKMDKMMQFINNVSIGNCKSFTKDQLSLPGEVGYGSETHFEIQGRVALRLAHFLSAYYQNNIKNEKYGNLRPGRTINREHLFGEVFANVMADLNIKSSGVFFDRQKFVDDNDTRKDLFGPYAYKQDGSLQAYAAIDLGSKAFSPYTENSWFKVLKERWGSNAYGLERFKGKPWIRSDINGSQIQRYFHYPLFYYAPRYQDGYWSNPYFDCDGFVPNWIMMYSAPFFGNVGSSGRVEFMGVVTVSVPLSELDINQCPSSFYTPNFFKNTATCDYRSTYCTPFPGRKFGLGNYKCECRQGFEYPFGDALWFYPGQLLEKEYRNKLIGVANRYDTLQCRESVGSRIYI--SSVLFCLSFL 2723
            FGF RGGY+C C+PGYRLP  QNGPF+G+DIE+ATE EY++GFDCLP+ W++V P    I      R +RS +E       E  D   D   + L+   +KAS        +   G +L+                      T+V PK  E E   +   KL     P                S +L + RR+ S+ +  +G    F      ++ +++ +++ V+  NC +   + L++PG V YG+E  FE++GR+ALRLAHFLSAYYQNNI  E YGNL+ G  +NR  LFGEV+A V++   I S GVFFD Q F D +    DLF PYAYK   S Q   AID+  + F  YT+  WF++LKERW S+ +GLER   KP+IRS+ING+Q+QRYF++PLFY  PRY+DGYW+ PY+ C GF   W++ Y+APFFG + +   ++FMGVVTVSV L+ LD+NQCP SFYTPNFFKN+A CD+++TYC P PGR+F  G+YKC CRQGFEYPF D  WF+ G+ +E+EY  KL+G  +RYD L+CR+ + +R+ I  S+VL  L+ +
Sbjct:  399 FGFARGGYECVCQPGYRLPMQQNGPFRGIDIEQATELEYQNGFDCLPIGWREVVPHEISIRG-SLQRVRRSTNESAEAATNEKEDDSDDLLCEILKQTVRKASA------FLSSVGYELRRALLYFSN-------------STIVRPKVVENENTSSVDWKLAPSVFPYAAEWEATRENPVSRDSTELNRPRREISIPFYFIGGGYTFSQQAFGEVQRLITYVDTVTPENCAAKAPEDLTMPGGVSYGAEVQFEMEGRMALRLAHFLSAYYQNNIVGELYGNLKSGSPLNRFELFGEVYATVLSSFQIVSCGVFFDHQAFTDHDGVTWDLFAPYAYKPTMSTQVAEAIDMSVQTFRNYTQQPWFRILKERWVSSRFGLERMTTKPYIRSNINGTQVQRYFNFPLFYRVPRYEDGYWTEPYYVCYGFQNGWVITYAAPFFGFLDNRKTLDFMGVVTVSVSLAHLDLNQCPQSFYTPNFFKNSAVCDFKNTYCEPIPGRRFRSGSYKCMCRQGFEYPFNDLSWFFDGETMEREYELKLLGKPSRYDLLKCRQGIAARLPIARSTVLLLLAVV 948          

HSP 2 Score: 342.043 bits (876), Expect = 0.000e+0
Identity = 174/342 (50.88%), Postives = 222/342 (64.91%), Query Frame = 1
Query:   85 PFTFYPHDTYEEIMIKMDSVNRDNCLLKSWDELTLPVDSVAMLPVFNTLFKTPWVANRSSLLHMHNMAMNRGFFYSYILQKLNTSDADFPDLPGLHYYYLSASADVSANPGIINGSSVFFDTNCQYANWIQNLEFNHTLPLFGPKAWRLDDWNDEINWLRGEPTNFTIEIIDYGAGPNNNYTNPQYKFNPWMKDKEMNIDFLPDYVYSNARSHQ--TDFVIYEKYENGTMGQVSLNFFGPPQPGVKEVFQPVRFTRPYFDCKRSKKWIVTAIGPVVDYMARYVPPQVLNVRRPRIVGVTTMDIDFLRIDFNPCPTAEGNEAHYFANVARCKATTMLYFILGF 1104
            PF++YP D ++ IM KM   N +NC   S  +LTLP  SV  LP +N +    W +NRS L+H+HN+A+NR +FYSYILQ+LN +D   P LP L YYY +ASADVS+ P  +N S +F DTNC YA+W      N T PLF P A RLD+WNDE N LR  P+N TIE+ D GAGPNNNYT P YK NP++ DKEM I ++PD+  +    +Q  T   + + Y         +NFFGP  PG+KE F PVRFTRPY+DC  S +WIV+A+  + DYM RY P  +  +R PR+VGV    +DFLRIDFNPC  + GN  H+ A V+RCK TTM   + GF
Sbjct:   61 PFSWYPRDNFDYIMEKMSRANPNNCPYLSEADLTLPATSVNQLPAYNRIPLQIWFSNRSKLMHLHNVALNRAYFYSYILQRLNATDTAPPLLPSLLYYYFAASADVSSAPNALNVSGMFMDTNCSYASWYVVESVNTTFPLFAPIARRLDNWNDETNILR-VPSNKTIELTDMGAGPNNNYTAPWYKNNPYIHDKEMGITYIPDHRGTALGKNQYSTRSQLADIYGRPLEQLEIVNFFGPNAPGIKETFLPVRFTRPYYDCGHSNRWIVSAVSALSDYMPRYSP--IDRLRGPRMVGVIVTSMDFLRIDFNPCKASLGNPTHFLAGVSRCKPTTMCVPLPGF 399          
BLAST of Fras1 related extracellular matrix protein vs. TrEMBL
Match: A0A068WY24 (Fras1 related extracellular matrix protein OS=Echinococcus granulosus OX=6210 GN=EgrG_000086300 PE=4 SV=1)

HSP 1 Score: 507.679 bits (1306), Expect = 0.000e+0
Identity = 258/562 (45.91%), Postives = 350/562 (62.28%), Query Frame = 3
Query: 1095 FGFYRGGYQCNCRPGYRLPYYQNGPFQGVDIERATEEEYKSGFDCLPVSWKQVNPTVDGITDEDSTRKKRSVDEENIDPWSDETTKWLRTEAKKASINRWNKLTVKQFGSKLKTKFAXXXXXXXXXXXXXXXXIQ-TVVH----PKHPEPEILKAY----RKKLEDKKTPS---------PKLVQSRRKRSLD----YVGRLSGFEPDKLPKMDKMMQFINNVSIGNCKSFTKDQLSLPGEVGYGSETHFEIQGRVALRLAHFLSAYYQNNIKNEKYGNLRPGRTINREHLFGEVFANVMADLNIKSSGVFFDRQKFVDDNDTRKDLFGPYAYKQDGSLQAYAAIDLGSKAFSPYTENSWFKVLKERWGSNAYGLERFKGKPWIRSDINGSQIQRYFHYPLFYYAPRYQDGYWSNPYFDCDGFVPNWIMMYSAPFFGNVGSSGRVEFMGVVTVSVPLSELDINQCPSSFYTPNFFKNTATCDYRSTYCTPFPGRKFGLGNYKCECRQGFEYPFGDALWFYPGQLLEKEYRNKLIGVANRYDTLQCRESVGSRIYISSVLFCL 2714
            +GF RGGY+C C+PGYRLP  QNGPF+G+DIE+ATEEEYK+GFDCLPV W+QV P       E +  + +S   + I       + W  T  +  ++   N L+++   ++   KF                ++  T  H    P  P  EI   Y    R +   ++T +           +V  R++R +D    Y+G    F  +   ++ +++ +I+ V+  NC S +  +L +P  V YG+E  FE++GRVALRLAHFLSAYYQNNI  E YGNLR G  +NR  LFGEV+ANV++   I SSG+FFDRQ FVD      DLF P+AYK   + Q   AID+ ++    YTE +WF+VLKERW S+  GLE    KP+IRS+ING+QIQRYF++PLFY  PRY++GYW+ PY+ CDGF   W++ Y+ PFFG + +   ++FMGVVTVSV L +LDINQCP SFYTPNFFKNTA CD+++TYC   PGR+F  G+YKC CRQGFEYP  D  WF+ G+ +EKEY  K+ G  +RYD L+CR+     + +S VL  +
Sbjct: 1872 YGFARGGYECVCQPGYRLPMQQNGPFRGIDIEQATEEEYKNGFDCLPVGWRQVVP------HEIAKDRLQSAGGDQIPVQRPRRSPWYSTPLEFVTLPT-NYLSLQM--TRFLNKFGFLNAKKMSPLDDIFHKVDDTAGHHDARPVEPSLEIKSMYQGVNRSRSLARRTRNWSHRAASGGLAVVVKRKRRDVDIPFYYLGNGYTFNEEAYNEVIRLIAYIDTVTPENCASKSPAELQMPSGVSYGAEAQFEMEGRVALRLAHFLSAYYQNNIVGELYGNLRSGVPLNRFELFGEVYANVLSSFQIVSSGIFFDRQAFVDHEGITWDLFAPFAYKPSMATQVAEAIDMSARDHRNYTEQAWFRVLKERWESSRQGLESITTKPYIRSNINGTQIQRYFNFPLFYRVPRYEEGYWTEPYYVCDGFFNGWVITYATPFFGYLDNRRTLDFMGVVTVSVDLHQLDINQCPQSFYTPNFFKNTARCDFQNTYCEHIPGRQFRSGSYKCMCRQGFEYPLNDLTWFFDGETMEKEYELKMSGQPSRYDLLKCRQGHAMTVQVSMVLILV 2424          

HSP 2 Score: 305.064 bits (780), Expect = 0.000e+0
Identity = 164/343 (47.81%), Postives = 219/343 (63.85%), Query Frame = 1
Query:   82 SPFTFYPHDTYEEIMIKMDSVNRDNCLLKSWDELTLPVDSVAMLPVFNTLFKTPWVANRSSLLHMHNMAMNRGFFYSYILQKLNTSDADFPDLPGLHYYYLSASADVSANPGIINGSSVFFDTNCQYANWIQNLEFNHTLPLFGPKAWRLDDWNDEINWLRGEPTNFTIEIIDYGAGPNNNYTNPQYKFNPWMKDKEMNIDFLPDYVYSNARSHQ--TDFVIYEKYENGTMGQVSLNFFGPPQPGVKEVFQPVRFTRPYFDCKRSKKWIVTAIGPVVDYMARYVPPQVLNVRRPRIVGVTTMDIDFLRIDFNPCPTAEGNEAHYFANVARCKATTMLYFILGF 1104
            SP+++YP D ++ IM KM   N +NC   S  +LTLP  +++ +P +N +    W ANRS LLH+HN+A+NR FF+SYILQ+LN +      LP   YYY S +AD+S+ P  +N S ++ DTNC YA+W  +   N T PLF P   RLDDWNDE N+LR  PTN TIE  D GAGP +NYT P Y+ N ++ D EM I+F+PD   +    +Q  T   + + Y N      + NFFGP  PG+KE F PVRFTRPY+DC  S +WIV+A+  + DYM RY P  +  +R PR+VGVT   +DFLRIDFNPCP + GN  ++ A  ARCK +TM   + G+
Sbjct: 1533 SPYSWYPRDNFDLIMEKMSRANPNNCKYLSEADLTLPTTTISQMPKYNQIPLQVWYANRSKLLHLHNLALNRAFFFSYILQRLNDTRTGPALLPSHIYYYFSGAADISSAPNAVNTSGIYMDTNCSYASWYVSDSVNTTFPLFAPVTRRLDDWNDETNFLR-IPTNNTIESTDMGAGPYSNYTAPWYRNNFFIHDTEMGINFIPDNRGTAIGKNQYATRTRLADLYGNLVEMLEAFNFFGPNAPGIKETFLPVRFTRPYYDCGHSNRWIVSAVSALSDYMPRYSP--IDRLRGPRMVGVTVTSMDFLRIDFNPCPQSMGNPDYFLAGTARCKPSTMCVPLSGY 1872          
BLAST of Fras1 related extracellular matrix protein vs. TrEMBL
Match: A0A087VY23 (Fras1 related extracellular matrix protein OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000086300 PE=4 SV=1)

HSP 1 Score: 500.745 bits (1288), Expect = 0.000e+0
Identity = 254/562 (45.20%), Postives = 349/562 (62.10%), Query Frame = 3
Query: 1095 FGFYRGGYQCNCRPGYRLPYYQNGPFQGVDIERATEEEYKSGFDCLPVSWKQVNPTVDGITDEDSTRKKRSVDEENIDPWSDETTKWLRTEAKKASINRWNKLTVKQFGSKLKTKFAXXXXXXXXXXXXXXXXIQ-TVVH----PKHPEPEILKAY----RKKLEDKKTPSPK---------LVQSRRKRSLD----YVGRLSGFEPDKLPKMDKMMQFINNVSIGNCKSFTKDQLSLPGEVGYGSETHFEIQGRVALRLAHFLSAYYQNNIKNEKYGNLRPGRTINREHLFGEVFANVMADLNIKSSGVFFDRQKFVDDNDTRKDLFGPYAYKQDGSLQAYAAIDLGSKAFSPYTENSWFKVLKERWGSNAYGLERFKGKPWIRSDINGSQIQRYFHYPLFYYAPRYQDGYWSNPYFDCDGFVPNWIMMYSAPFFGNVGSSGRVEFMGVVTVSVPLSELDINQCPSSFYTPNFFKNTATCDYRSTYCTPFPGRKFGLGNYKCECRQGFEYPFGDALWFYPGQLLEKEYRNKLIGVANRYDTLQCRESVGSRIYISSVLFCL 2714
            +GF RGGY+C C+PGYRLP  QNGPF+G+DIE+ATEEEYK+GFDCLPV W+QV P       E +  + +S   + I       + W  T  +  ++   N L+++   +    KF                ++  T  H    P  P  +I   Y    + +   ++T + K         +V  R+++ +D    Y+G    F  +   ++ +++ +I+ V+  NC S ++ +L +P  V YG+E  FE++GRVALRLAHFLSAYYQNNI  E YGNLR G  +NR  LFGEV+ANV++   I SSG+FFDRQ FVD      DLF P+AYK   + Q   AID+ ++    YTE +WF+VLKERW S+  GLE    KP+IRS+ING+QIQRYF++PLFY  PRY++GYW+ PY+ C GF   W++ Y+ PFFG + +   ++FMGVVTVSV L +LDINQCP SFYTPNFFKNTA CD+++TYC   PGR+F  G+YKC CRQGFEYP  D  WF+ G+ +EKEY  K+ G  +RYD L+CR+     + +S  L  +
Sbjct: 1872 YGFARGGYECVCQPGYRLPMQQNGPFRGIDIEQATEEEYKNGFDCLPVGWRQVVP------HEIAKDRLQSAGGDQIPVQRPRRSPWYSTPLEFVTLPT-NYLSLQM--TMFLNKFGFLNAKKMSPLSDIFHKVDDTAGHQDARPMEPSLQIRSMYQGVNKTRTLARRTRNWKHRAADGGLAVVVKRKRKDVDIPFYYLGNGYTFNEEAYNEVIRLIAYIDTVTPENCASKSRAELQMPSGVSYGAEAQFEMEGRVALRLAHFLSAYYQNNIVGELYGNLRSGVPLNRFELFGEVYANVLSSFQIVSSGIFFDRQAFVDHEGITWDLFAPFAYKPSMATQVAEAIDMSARDHRNYTEQAWFRVLKERWKSSRQGLESITTKPYIRSNINGTQIQRYFNFPLFYRVPRYEEGYWTEPYYVCYGFFNGWVITYATPFFGYLDNRRTLDFMGVVTVSVDLHQLDINQCPQSFYTPNFFKNTARCDFQNTYCEHIPGRQFRSGSYKCMCRQGFEYPLNDLTWFFDGETMEKEYELKMSGQPSRYDLLKCRQGHAMTVQVSMALILV 2424          

HSP 2 Score: 303.908 bits (777), Expect = 0.000e+0
Identity = 165/345 (47.83%), Postives = 218/345 (63.19%), Query Frame = 1
Query:   76 GKSPFTFYPHDTYEEIMIKMDSVNRDNCLLKSWDELTLPVDSVAMLPVFNTLFKTPWVANRSSLLHMHNMAMNRGFFYSYILQKLNTSDADFPDLPGLHYYYLSASADVSANPGIINGSSVFFDTNCQYANWIQNLEFNHTLPLFGPKAWRLDDWNDEINWLRGEPTNFTIEIIDYGAGPNNNYTNPQYKFNPWMKDKEMNIDFLPDYVYSNARSHQ--TDFVIYEKYENGTMGQVSLNFFGPPQPGVKEVFQPVRFTRPYFDCKRSKKWIVTAIGPVVDYMARYVPPQVLNVRRPRIVGVTTMDIDFLRIDFNPCPTAEGNEAHYFANVARCKATTMLYFILGF 1104
              SP+++YP D ++ IM KM   N +NC   S  +LTLP  +++ +P +N +    W ANRS LLH+HN+A+NR FF+SYILQ+LN +      LP   YYY S +AD+S+ P  +N S ++ DTNC YA+W  +   N T PLF P   RLDDWNDE N LR  PTN TIE  D GAGP +NYT P Y+ N ++ D EM I+F+PD   +    +Q  T   + + Y N      + NFFGP  PG+KE F PVRFTRPY+DC  S +WIV+A+  + DYM RY P  +  +R PR+VGVT   +DFLRIDFNPCP + GN  ++ A  ARCK TTM   + G+
Sbjct: 1531 AHSPYSWYPRDNFDFIMEKMSRANPNNCKYLSEADLTLPTTTISQMPKYNQIPLQVWYANRSKLLHLHNLALNRAFFFSYILQRLNDTRTGPALLPSHIYYYFSGAADISSAPNAVNTSGIYMDTNCSYASWYVSDSVNTTFPLFAPVTRRLDDWNDETNVLR-IPTNNTIESTDMGAGPYSNYTAPWYRNNFFIHDTEMGINFIPDNRGTAIGKNQYATRTHLADLYGNLVEMLEAFNFFGPNAPGIKETFLPVRFTRPYYDCGHSNRWIVSAVSALSDYMPRYSP--IDRLRGPRMVGVTVTSMDFLRIDFNPCPQSMGNPDYFLAGTARCKPTTMCVPLSGY 1872          
BLAST of Fras1 related extracellular matrix protein vs. TrEMBL
Match: A0A1S3H197 (uncharacterized protein LOC106151208 OS=Lingula unguis OX=7574 GN=LOC106151208 PE=4 SV=1)

HSP 1 Score: 430.254 bits (1105), Expect = 0.000e+0
Identity = 229/566 (40.46%), Postives = 335/566 (59.19%), Query Frame = 3
Query: 1086 LFHFGFYRGGYQCNCRPGYRLPYYQNGPFQGVDIERATEEEYKSGFDCLPVSWKQVNPTVD--------GITDED----------STRKKRSVDEENIDPWSDETT-KWLRTEAKKASINRWNKLTVKQFGSKLKTKFAXXXXXXXXXXXXXXXXIQTVVHPKHPEPEILKAYRKKLEDKKTPSPKLVQSRRKRSLDYVGRLSGFEPDKLPKMDKMMQFINNVSIGNCKSFTKDQLSLPGEVGYGSETHFEIQGRVALRLAHFLSAYYQNNIKNEKYGNLRPGRTINREHLFGEVFANVMADLNIKSSGVFFDRQKFVDDNDTRKDLFGPYAYKQDGSLQAYAAIDLGSKAFSPYTENSWFKVLKERWGSNAYGLERFKGKPWIRSDINGSQIQRYFHYPLFYYAPRYQDGYWSNPYFDCDGFVPNWIMMYSAPFFGNVGSSGRVEFMGVVTVSVPLSELDINQCPSSFYTPNFFKNTATCDYRSTYCTPFPGRKFGLGNYKCECRQGFEYPFGDALWFYPGQLLEKEYRNKLIGVANRYDTLQCRESVGSRIYISSVLFCLSFLI 2726
            L  FGF RGGY+C CRPGYRLP++QNG FQGVDIE AT EEYK+GFDCLPV ++ V P +         G+  E           +T +  +     + P ++ ++ +  R+ A  A  +  + + + +   +L+ K                   +     +  + EI+K  ++K+  +K    + V+ RRKR       +  F  +   +++ +++ +++V+  NC+S T+++L LPG++ YG++  FE QGRVA+RLA FLS + QN  + E +GNL     ++ E +FGEV +NVM ++ I   GVFFD  KF++ N T +  FGPYA+K  G    Y A+D        Y +  WF  +++RW +N YGL RF   PW+R+DI G+ ++++  YPLFYYA  Y+ G W  PYFDCDG+V +W+M YS PFFG + S  R+EF GVV V V L +LDINQCP  FY PN FK TA CDY STYC   P +KF  G YKCEC+QG+EYPF D  W++ G+ +E+EYR   +G+ +RYDTL+CR +   +I  S V+  +  L+
Sbjct:  356 LSGFGFQRGGYECVCRPGYRLPHWQNGAFQGVDIELATTEEYKNGFDCLPVGYRMVVPQIQNKEGGPSGGVIVEKFTTTTTTTTTTTPRPVTTTAAPVTPSNNTSSGRRKRSIAAHAPKDVLDAIELNKMREELRKK------------------RRVASKIRQEDVEIIKRNKRKINKEK--ERQEVKRRRKRE----AVVQAFNEESSIRVNLLIEKMDSVTSANCRSKTQEELELPGDMAYGTKEQFESQGRVAVRLAQFLSNFMQNVDEKEDFGNLLGDNKLHVEQMFGEVGSNVMGNVEISGCGVFFDHNKFLERNGTMRSYFGPYAWKSLGD--QYLAVDFAGDP-EGYADEVWFSDVRDRWRANTYGLTRFTMNPWMRADIAGTALRKFDQYPLFYYAASYELGEWFGPYFDCDGYVDDWLMTYSVPFFG-LNSLKRIEFKGVVIVDVKLRDLDINQCPQEFYVPNAFKGTARCDYESTYCKFEPSQKFEKGGYKCECKQGYEYPFIDQGWYFDGKEMEEEYRKLKLGIFSRYDTLKCRIAGAPKIASSGVIMTVLALM 893          

HSP 2 Score: 290.812 bits (743), Expect = 0.000e+0
Identity = 159/348 (45.69%), Postives = 211/348 (60.63%), Query Frame = 1
Query:   82 SPFTFYPHDTYEEIMIKMDSVNRDNCLLKSWDELTLPVDSVAMLPVFNTLFKTPWVANRSSLLHMHNMAMNRGFFYSYILQKLNTSDADFPDLPGLHYYYLSASADVSANPGIINGSSVFFDTNCQYANWIQNLEFNHTLPLFGPKAWRLDDWNDEINWLRGEPTNFTIEIIDYGAGPNNNYTNPQYKFNPWMKDKEMNIDFLPDYVYSNARSHQTDFVIYEKYENGTMGQVS-----LNFFGPPQPGVKEV-FQPVRFTRPYFDCKRSKKWIVTAIGPVVDYMARYVPPQVLNVRRPRIVGVTTMDIDFLRIDFNPCPTAEGNEA-HYFANVARCKATTMLYFILGF 1104
             PF +   D+++++   M++V  +NC  K    L LP   V   P  N L    + ANR+S++H+HNMA++R F+ SY+  K N S  +F   PG  YYY+S +ADV ANPG INGSSV+F+ N  + N+  NL  NHTL LFGP A+RLDD+ D +NWLR EPTN TI ++D GAG  +NYT+ QYK N W         FLPD+  S     +  +    KY N T   VS       FFGPP P   E  + PV +T PYFDC ++ KWI++A+ PVVD+++RY      ++RRPR   V TMD+DFLRIDFNPCP  +GN   ++ A  ARCK TTM   + GF
Sbjct:   22 GPFDWMTEDSFDQLDRMMNAVTAENCETKPASALKLPTSVVTHQPRANDLLSQKFFANRTSMIHLHNMALSRSFYLSYMNYKANES-WNFGQQPGFLYYYMSLAADVGANPGWINGSSVYFEYNLTFPNFYSNLPLNHTLLLFGPHAYRLDDYKDPMNWLR-EPTNNTINVVDIGAGSESNYTSTQYKTNDWYS------LFLPDFSKSGDSLKKFTYSYAIKYSNETGKFVSNEFQEKTFFGPPNPSALETQYLPVLYTAPYFDCGKTNKWIISAVSPVVDHLSRY--HDFDHIRRPRYSAVVTMDMDFLRIDFNPCPIGQGNPIPNFLAGTARCKPTTMCQPLSGF 359          

HSP 3 Score: 74.3294 bits (181), Expect = 1.087e-9
Identity = 91/359 (25.35%), Postives = 139/359 (38.72%), Query Frame = 3
Query: 1650 DKLPKMDKMMQFINNVSIGNCKSFTKDQLSLPGEVG--------------YGSETHFEIQGRVALRLAHFLSAYYQNNIKNEKYG-NLRPGRTINREHLFGEVFANVMADLNIKSSGVFFDRQKFVDD-------NDTRKDLFGPYAYKQDG-----------SLQAYAAIDLGSKAFSPYTE-----NSWFKVLKERWGSNAYGLERFKGKPWIR-SDINGSQIQRYFHYPLFYYAP-------RYQDGYWSNPYFDCDGFVPNWIMMYSAPFFGNVGSSG------RVEFMGVVTVSVPLSELDINQCP--SSFYTPNFFKNTATCDYRSTYCTPFPGRKFGLGNYKCECRQGFEYP 2564
            D   ++D+MM   N V+  NC++     L LP  V               + + T       +AL  + +LS  Y N   NE +    +PG       L  +V AN      I  S V+F+      +       N T   LFGP+AY+ D            +      +D+G+ + S YT      N W+ +    +  +   L++F     I+ S+  G  +   F    F+  P       +Y    ++ PYFDC G    WI+   +P   ++          R  +  VVT+ +    +D N CP       PNF   TA C   +T C P  G  F  G Y+C CR G+  P
Sbjct:   30 DSFDQLDRMM---NAVTAENCETKPASALKLPTSVVTHQPRANDLLSQKFFANRTSMIHLHNMALSRSFYLS--YMNYKANESWNFGQQPGFLYYYMSLAADVGANPGW---INGSSVYFEYNLTFPNFYSNLPLNHTLL-LFGPHAYRLDDYKDPMNWLREPTNNTINVVDIGAGSESNYTSTQYKTNDWYSLFLPDFSKSGDSLKKFTYSYAIKYSNETGKFVSNEFQEKTFFGPPNPSALETQYLPVLYTAPYFDC-GKTNKWIISAVSPVVDHLSRYHDFDHIRRPRYSAVVTMDMDFLRIDFNPCPIGQGNPIPNFLAGTARCK-PTTMCQPLSGFGFQRGGYECVCRPGYRLP 377          
BLAST of Fras1 related extracellular matrix protein vs. Ensembl Cavefish
Match: gpr158a (G protein-coupled receptor 158a [Source:ZFIN;Acc:ZDB-GENE-060130-18])

HSP 1 Score: 83.9593 bits (206), Expect = 5.495e-16
Identity = 39/102 (38.24%), Postives = 58/102 (56.86%), Query Frame = 3
Query: 2265 WSNPYFDCDG--FVPNWIMMYSAPFFGNVGSSGRVEFMGVVTVSVPLSELDINQCPSSFYTPNFFKNTATCDYRSTYCTPFPGRKFGLGNYKCECRQGFEYP 2564
            WS+PY +C+   +VP W++  SA F+G +     ++F GVV V V + ++DI+QC     T  +F  T  C+  S  C P PG  F L  YKC+C+  F +P
Sbjct:  217 WSSPYLECENGYYVPRWLLTLSAGFYG-LTPDLTLDFRGVVRVDVSVQDVDIDQCS----TEGWFAGTHRCNVTSMECLPIPGHGFVLDKYKCQCKGDFYHP 313          
BLAST of Fras1 related extracellular matrix protein vs. Ensembl Cavefish
Match: gpr158b (G protein-coupled receptor 158b [Source:ZFIN;Acc:ZDB-GENE-130530-875])

HSP 1 Score: 83.5741 bits (205), Expect = 7.326e-16
Identity = 40/107 (37.38%), Postives = 56/107 (52.34%), Query Frame = 3
Query: 2265 WSNPYFDCD--GFVPNWIMMYSAPFFGNVGSSGRVEFMGVVTVSVPLSELDINQCPSSFYTPNFFKNTATCDYRSTYCTPFPGRKFGLGNYKCECRQGFEYPFGDAL 2579
            WS PY +C+   F P+W++  SA  +     +   E  G+V V V L + DI+QC SS     +F  T  C+  +  C P PG  F L  YKC+C++GF  P   AL
Sbjct:  211 WSAPYLECEHGSFAPHWLLTLSAGIYSPAKDAAVPELRGIVKVDVNLQDEDIDQCSSS----GWFAGTHRCNLTTMECKPVPGHGFVLDKYKCQCKRGFYSPRRVAL 313          
BLAST of Fras1 related extracellular matrix protein vs. Ensembl Cavefish
Match: gpr158a (G protein-coupled receptor 158a [Source:ZFIN;Acc:ZDB-GENE-060130-18])

HSP 1 Score: 81.6481 bits (200), Expect = 2.848e-15
Identity = 39/102 (38.24%), Postives = 58/102 (56.86%), Query Frame = 3
Query: 2265 WSNPYFDCDG--FVPNWIMMYSAPFFGNVGSSGRVEFMGVVTVSVPLSELDINQCPSSFYTPNFFKNTATCDYRSTYCTPFPGRKFGLGNYKCECRQGFEYP 2564
            WS+PY +C+   +VP W++  SA F+G +     ++F GVV V V + ++DI+QC     T  +F  T  C+  S  C P PG  F L  YKC+C+  F +P
Sbjct:  217 WSSPYLECENGYYVPRWLLTLSAGFYG-LTPDLTLDFRGVVRVDVSVQDVDIDQC----STEGWFAGTHRCNVTSMECLPIPGHGFVLDKYKCQCKGDFYHP 313          
BLAST of Fras1 related extracellular matrix protein vs. Ensembl Cavefish
Match: si:ch211-156l18.8 (probable G-protein coupled receptor 158 [Source:NCBI gene;Acc:103022023])

HSP 1 Score: 71.633 bits (174), Expect = 3.627e-12
Identity = 36/99 (36.36%), Postives = 54/99 (54.55%), Query Frame = 3
Query: 2274 PYFDC-DG-FVPNWIMMYSAPFFGNVGSSGRVEFMGVVTVSVPLSELDINQCPSSFYTPNFFKNTATCDYRSTYCTPFPGRKFGLGNYKCECRQGFEYP 2564
            P+ +C DG ++P W++  S PF+G +      EF GVV V V +   D++QC S      +F +T  C+  S  C P P + F LG Y C C++G+  P
Sbjct:  285 PFLECEDGRYLPGWLLTLSIPFYG-LKPDLSPEFRGVVRVDVNIQGFDVDQCASGNV---WFSDTHQCNRTSMECDPIPRQGFRLGQYCCRCKEGYYSP 379          
BLAST of Fras1 related extracellular matrix protein vs. Ensembl Nematostella
Match: EDO46341 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQD0])

HSP 1 Score: 62.3882 bits (150), Expect = 2.330e-11
Identity = 33/122 (27.05%), Postives = 60/122 (49.18%), Query Frame = 3
Query: 2373 GVVTVSVPLSELDINQCPSSF---YTPNFFKNTATCDYRSTYCTPFPGRKFGLGNYKCECRQGFEYPFGDALWFYPGQLLEK---EYRNKLIGVANRYDTLQCRESVGSRIYISSVLFCLSF 2720
            GV T+ + L+ +DINQC  +    +    F  T  C   +T C P  GR F  G+YKC C+ G+ +P      ++ G  +E+   + +++    A  ++ L C++   + +  S  L  L++
Sbjct:    2 GVTTIDIELTNVDINQCEETLGGTFQFGVFAGTHHCKNETTQCVPVTGRGFRAGSYKCICKPGYYFPLLTPQKYFNGTDIERYASDNQSEYYTTAGSFECLPCKKGCTTCVDNSPCLVTLNW 123          

HSP 2 Score: 41.5874 bits (96), Expect = 1.578e-6
Identity = 22/53 (41.51%), Postives = 27/53 (50.94%), Query Frame = 3
Query: 1098 GFYRGGYQCNCRPGYRLPYYQ-NGPFQGVDIER---ATEEEYKS---GFDCLP 1235
            GF  G Y+C C+PGY  P       F G DIER     + EY +    F+CLP
Sbjct:   51 GFRAGSYKCICKPGYYFPLLTPQKYFNGTDIERYASDNQSEYYTTAGSFECLP 103          

HSP 3 Score: 29.6462 bits (65), Expect = 1.578e-6
Identity = 15/40 (37.50%), Postives = 19/40 (47.50%), Query Frame = 1
Query:  967 GVTTMDIDFLRIDFNPCPTAEGNEAHY--FANVARCKATT 1080
            GVTT+DI+   +D N C    G    +  FA    CK  T
Sbjct:    2 GVTTIDIELTNVDINQCEETLGGTFQFGVFAGTHHCKNET 41          
BLAST of Fras1 related extracellular matrix protein vs. Ensembl Medaka
Match: ENSORLT00000011760.2 (probable G-protein coupled receptor 158 [Source:NCBI gene;Acc:101168242])

HSP 1 Score: 92.0485 bits (227), Expect = 1.804e-18
Identity = 49/107 (45.79%), Postives = 62/107 (57.94%), Query Frame = 3
Query: 2265 WSNPYFDCD--GFVPNWIMMYSAPFFGNVGSSGRVEFMGVVTVSVPLSELDINQCPSSFYTPNFFKNTATCDYRSTYCTPFPGRKFGLGNYKCECRQGFEYPFGDAL 2579
            WS PY +CD   FVP W++  SA F+G + S+  +EF GVV V V L  LDINQC +S     +F  T  C+  S  C P  G  F L  YKC+CR+GF +P   AL
Sbjct:  240 WSAPYLECDHGTFVPYWLLTLSAAFYG-LKSNSALEFRGVVRVDVNLQNLDINQCSNS----GWFAGTHRCNLTSMECIPVGGHGFVLDKYKCQCRRGFYHPSRVAL 341          
BLAST of Fras1 related extracellular matrix protein vs. Ensembl Medaka
Match: gpr158a (G protein-coupled receptor 158 [Source:NCBI gene;Acc:101171369])

HSP 1 Score: 82.0333 bits (201), Expect = 6.861e-16
Identity = 40/111 (36.04%), Postives = 60/111 (54.05%), Query Frame = 3
Query: 2238 YAPRYQDGYWSNPYFDCDG--FVPNWIMMYSAPFFGNVGSSGRVEFMGVVTVSVPLSELDINQCPSSFYTPNFFKNTATCDYRSTYCTPFPGRKFGLGNYKCECRQGFEYP 2564
            + P      WS PY +C+   +VP+W++  SA F+G + S    EF GVV V V L ++DI+QC +      +F  T  C+  +  C P  G  F L  Y+C C++GF +P
Sbjct:  241 FIPDRTHVRWSAPYLECENGNYVPHWLLTLSAAFYG-LKSDLVPEFRGVVRVDVNLQDVDIDQCSAD----GWFAGTHRCNLTTMECLPLRGHGFVLDKYQCHCKKGFYHP 346          
BLAST of Fras1 related extracellular matrix protein vs. Ensembl Medaka
Match: gpr158a (G protein-coupled receptor 158 [Source:NCBI gene;Acc:101171369])

HSP 1 Score: 82.4185 bits (202), Expect = 1.629e-15
Identity = 39/102 (38.24%), Postives = 58/102 (56.86%), Query Frame = 3
Query: 2265 WSNPYFDCDG--FVPNWIMMYSAPFFGNVGSSGRVEFMGVVTVSVPLSELDINQCPSSFYTPNFFKNTATCDYRSTYCTPFPGRKFGLGNYKCECRQGFEYP 2564
            WS PY +C+   +VP+W++  SA F+G + S    EF GVV V V L ++DI+QC +      +F  T  C+  +  C P  G  F L  Y+C C++GF +P
Sbjct:  250 WSAPYLECENGNYVPHWLLTLSAAFYG-LKSDLVPEFRGVVRVDVNLQDVDIDQCSAD----GWFAGTHRCNLTTMECLPLRGHGFVLDKYQCHCKKGFYHP 346          
BLAST of Fras1 related extracellular matrix protein vs. Ensembl Medaka
Match: gpr158a (G protein-coupled receptor 158 [Source:NCBI gene;Acc:101171369])

HSP 1 Score: 82.4185 bits (202), Expect = 1.641e-15
Identity = 39/102 (38.24%), Postives = 58/102 (56.86%), Query Frame = 3
Query: 2265 WSNPYFDCDG--FVPNWIMMYSAPFFGNVGSSGRVEFMGVVTVSVPLSELDINQCPSSFYTPNFFKNTATCDYRSTYCTPFPGRKFGLGNYKCECRQGFEYP 2564
            WS PY +C+   +VP+W++  SA F+G + S    EF GVV V V L ++DI+QC +      +F  T  C+  +  C P  G  F L  Y+C C++GF +P
Sbjct:  250 WSAPYLECENGNYVPHWLLTLSAAFYG-LKSDLVPEFRGVVRVDVNLQDVDIDQCSAD----GWFAGTHRCNLTTMECLPLRGHGFVLDKYQCHCKKGFYHP 346          
BLAST of Fras1 related extracellular matrix protein vs. Planmine SMEST
Match: SMESG000032220.1 (SMESG000032220.1)

HSP 1 Score: 1111.67 bits (2874), Expect = 0.000e+0
Identity = 554/561 (98.75%), Postives = 554/561 (98.75%), Query Frame = 3
Query: 1059 CKM*GDNNALFHFGFYRGGYQCNCRPGYRLPYYQNGPFQGVDIERATEEEYKSGFDCLPVSWKQVNPTVDGITDEDSTRKKRSVDEENIDPWSDETTKWLRTEAKKASINRWNKLTVKQFGSKLKTKFAXXXXXXXXXXXXXXXXIQTVVHPKHPEPEILKAYRKKLEDKKTPSPKLVQSRRKRSLDYVGRLSGFEPDKLPKMDKMMQFINNVSIGNCKSFTKDQLSLPGEVGYGSETHFEIQGRVALRLAHFLSAYYQNNIKNEKYGNLRPGRTINREHLFGEVFANVMADLNIKSSGVFFDRQKFVDDNDTRKDLFGPYAYKQDGSLQAYAAIDLGSKAFSPYTENSWFKVLKERWGSNAYGLERFKGKPWIRSDINGSQIQRYFHYPLFYYAPRYQDGYWSNPYFDCDGFVPNWIMMYSAPFFGNVGSSGRVEFMGVVTVSVPLSELDINQCPSSFYTPNFFKNTATCDYRSTYCTPFPGRKFGLGNYKCECRQGFEYPFGDALWFYPGQLLEKEYRNKLIGVANRYDTLQCRESVGSRIYISSVLFCLSFLISVWRI 2741
            CK      ALFHFGFYRGGYQCNCRPGYRLPYYQNGPFQGVDIERATEEEYKSGFDCLPVSWKQVNPTVDGITDEDSTRKKRSVDEENIDPWSDETTKWLRTEAKKASINRWNKLTVKQFGSKLKTKFAPPPKPDEEKPKTDEPEIQTVVHPKHPEPEILKAYRKKLEDKK PSPKLVQSRRKRSLDYVGRLSGFEPDKLPKMDKMMQFINNVSIGNCKSFTKDQLSLPGEVGYGSETHFEIQGRVALRLAHFLSAYYQNNIKNEKYGNLRPGRTINREHLFGEVFANVMADLNIKSSGVFFDRQKFVDDNDTRKDLFGPYAYKQDGSLQAYAAIDLGSKAFSPYTENSWFKVLKERWGSNAYGLERFKGKPWIRSDINGSQIQRYFHYPLFYYAPRYQDGYWSNPYFDCDGFVPNWIMMYSAPFFGNVGSSGRVEFMGVVTVSVPLSELDINQCPSSFYTPNFFKNTATCDYRSTYCTPFPGRKFGLGNYKCECRQGFEYPFGDALWFYPGQLLEKEYRNKLIGVANRYDTLQCRESVGSRIYISSVLFCLSFLISVWRI
Sbjct:  349 CKATTMCEALFHFGFYRGGYQCNCRPGYRLPYYQNGPFQGVDIERATEEEYKSGFDCLPVSWKQVNPTVDGITDEDSTRKKRSVDEENIDPWSDETTKWLRTEAKKASINRWNKLTVKQFGSKLKTKFAPPPKPDEEKPKTDEPEIQTVVHPKHPEPEILKAYRKKLEDKKKPSPKLVQSRRKRSLDYVGRLSGFEPDKLPKMDKMMQFINNVSIGNCKSFTKDQLSLPGEVGYGSETHFEIQGRVALRLAHFLSAYYQNNIKNEKYGNLRPGRTINREHLFGEVFANVMADLNIKSSGVFFDRQKFVDDNDTRKDLFGPYAYKQDGSLQAYAAIDLGSKAFSPYTENSWFKVLKERWGSNAYGLERFKGKPWIRSDINGSQIQRYFHYPLFYYAPRYQDGYWSNPYFDCDGFVPNWIMMYSAPFFGNVGSSGRVEFMGVVTVSVPLSELDINQCPSSFYTPNFFKNTATCDYRSTYCTPFPGRKFGLGNYKCECRQGFEYPFGDALWFYPGQLLEKEYRNKLIGVANRYDTLQCRESVGSRIYISSVLFCLSFLISVWRI 909          

HSP 2 Score: 719.153 bits (1855), Expect = 0.000e+0
Identity = 355/361 (98.34%), Postives = 356/361 (98.61%), Query Frame = 1
Query:   22 MKKFTXXXXXXXXXXXSFGKSPFTFYPHDTYEEIMIKMDSVNRDNCLLKSWDELTLPVDSVAMLPVFNTLFKTPWVANRSSLLHMHNMAMNRGFFYSYILQKLNTSDADFPDLPGLHYYYLSASADVSANPGIINGSSVFFDTNCQYANWIQNLEFNHTLPLFGPKAWRLDDWNDEINWLRGEPTNFTIEIIDYGAGPNNNYTNPQYKFNPWMKDKEMNIDFLPDYVYSNARSHQTDFVIYEKYENGTMGQVSLNFFGPPQPGVKEVFQPVRFTRPYFDCKRSKKWIVTAIGPVVDYMARYVPPQVLNVRRPRIVGVTTMDIDFLRIDFNPCPTAEGNEAHYFANVARCKATTMLYFILGF 1104
            MKKFTLLLAYLTCLGLSFGKSPFTFYPHDTYEEIMIKMDSVNRDNCLLKSWDELTLPVDSVAMLPVFNTLFKTPWVANRSSLLHMHNMAMNRGFFYSYILQKLNTSDADFPDLPGLHYYYLSASADVSANPGIINGSSVFFDTNCQYANWIQNLEFNHTLPLFGPKAWRLDDWNDEINWLRGEPTNFTIEIIDYGAGPNNNYTNPQYKFNPWMKDKEMNIDFLPDYVYSNARSHQTDFVIYEKYENGTMGQVSLNFFGPPQPGVKEVFQPVRFTRPYFDCKRSKKWIVTAIGPVVDYMARYVPPQVLNVRRPRIVGVTTMDIDFLRIDFNPCPTAEGNEAHYFANVARCKATTM   +  F
Sbjct:    1 MKKFTLLLAYLTCLGLSFGKSPFTFYPHDTYEEIMIKMDSVNRDNCLLKSWDELTLPVDSVAMLPVFNTLFKTPWVANRSSLLHMHNMAMNRGFFYSYILQKLNTSDADFPDLPGLHYYYLSASADVSANPGIINGSSVFFDTNCQYANWIQNLEFNHTLPLFGPKAWRLDDWNDEINWLRGEPTNFTIEIIDYGAGPNNNYTNPQYKFNPWMKDKEMNIDFLPDYVYSNARSHQTDFVIYEKYENGTMGQVSLNFFGPPQPGVKEVFQPVRFTRPYFDCKRSKKWIVTAIGPVVDYMARYVPPQVLNVRRPRIVGVTTMDIDFLRIDFNPCPTAEGNEAHYFANVARCKATTMCEALFHF 361          
The following BLAST results are available for this feature:
BLAST of Fras1 related extracellular matrix protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GPR1583.504e-1228.25G protein-coupled receptor 158 [Source:HGNC Symbol... [more]
GPR1583.615e-1228.25G protein-coupled receptor 158 [Source:HGNC Symbol... [more]
GPR1793.844e-1238.78G protein-coupled receptor 179 [Source:HGNC Symbol... [more]
GPR1793.943e-1238.78G protein-coupled receptor 179 [Source:HGNC Symbol... [more]
GPR1791.465e-1137.76G protein-coupled receptor 179 [Source:HGNC Symbol... [more]
back to top
BLAST of Fras1 related extracellular matrix protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Fras1 related extracellular matrix protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG311951.461e-8040.39gene:FBgn0051195 transcript:FBtr0302188[more]
CG437955.899e-2527.42gene:FBgn0264339 transcript:FBtr0331989[more]
back to top
BLAST of Fras1 related extracellular matrix protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gpr158b1.794e-1741.12G protein-coupled receptor 158b [Source:ZFIN;Acc:Z... [more]
gpr158b4.062e-1741.18G protein-coupled receptor 158b [Source:ZFIN;Acc:Z... [more]
gpr158a4.427e-1636.89G protein-coupled receptor 158a [Source:ZFIN;Acc:Z... [more]
gpr158a4.614e-1636.89G protein-coupled receptor 158a [Source:ZFIN;Acc:Z... [more]
gpr158a1.780e-1536.89G protein-coupled receptor 158a [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Fras1 related extracellular matrix protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GPR1583.209e-1731.98G protein-coupled receptor 158 [Source:NCBI gene;A... [more]
GPR1581.801e-1633.12G protein-coupled receptor 158 [Source:NCBI gene;A... [more]
GPR1584.291e-1631.28G protein-coupled receptor 158 [Source:NCBI gene;A... [more]
GPR1585.083e-1631.28G protein-coupled receptor 158 [Source:NCBI gene;A... [more]
rpf27.728e-635.53ribosome production factor 2 homolog [Source:Xenba... [more]
back to top
BLAST of Fras1 related extracellular matrix protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Gpr1581.119e-1330.73G protein-coupled receptor 158 [Source:MGI Symbol;... [more]
Gpr1793.686e-1237.76G protein-coupled receptor 179 [Source:MGI Symbol;... [more]
back to top
BLAST of Fras1 related extracellular matrix protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8C419|GP158_MOUSE7.826e-1330.73Probable G-protein coupled receptor 158 OS=Mus mus... [more]
sp|E1BBQ2|GP158_BOVIN2.091e-1229.21Probable G-protein coupled receptor 158 OS=Bos tau... [more]
sp|D4A6L0|GP158_RAT3.132e-1230.17Probable G-protein coupled receptor 158 OS=Rattus ... [more]
sp|Q5T848|GP158_HUMAN1.736e-1128.25Probable G-protein coupled receptor 158 OS=Homo sa... [more]
sp|Q6PRD1|GP179_HUMAN1.894e-1138.78Probable G-protein coupled receptor 179 OS=Homo sa... [more]
back to top
BLAST of Fras1 related extracellular matrix protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3Q0R00.000e+045.44Putative G-protein coupled receptor 158 (Fragment)... [more]
A0A0X3NYB90.000e+045.44Putative G-protein coupled receptor 158 (Fragment)... [more]
A0A068WY240.000e+045.91Fras1 related extracellular matrix protein OS=Echi... [more]
A0A087VY230.000e+045.20Fras1 related extracellular matrix protein OS=Echi... [more]
A0A1S3H1971.087e-940.46uncharacterized protein LOC106151208 OS=Lingula un... [more]
back to top
BLAST of Fras1 related extracellular matrix protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
gpr158a5.495e-1638.24G protein-coupled receptor 158a [Source:ZFIN;Acc:Z... [more]
gpr158b7.326e-1637.38G protein-coupled receptor 158b [Source:ZFIN;Acc:Z... [more]
gpr158a2.848e-1538.24G protein-coupled receptor 158a [Source:ZFIN;Acc:Z... [more]
si:ch211-156l18.83.627e-1236.36probable G-protein coupled receptor 158 [Source:NC... [more]
back to top
BLAST of Fras1 related extracellular matrix protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Fras1 related extracellular matrix protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Fras1 related extracellular matrix protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO463412.330e-1127.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Fras1 related extracellular matrix protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSORLT00000011760.21.804e-1845.79probable G-protein coupled receptor 158 [Source:NC... [more]
gpr158a6.861e-1636.04G protein-coupled receptor 158 [Source:NCBI gene;A... [more]
gpr158a1.629e-1538.24G protein-coupled receptor 158 [Source:NCBI gene;A... [more]
gpr158a1.641e-1538.24G protein-coupled receptor 158 [Source:NCBI gene;A... [more]
back to top
BLAST of Fras1 related extracellular matrix protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000032220.10.000e+098.75SMESG000032220.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035611 ID=SMED30035611|Name=Fras1 related extracellular matrix protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2794bp
CTATATAAATCTTATATGATTATGAAAAAATTTACTTTGTTATTGGCATA
TTTGACTTGCTTGGGCCTATCCTTTGGCAAATCACCTTTCACGTTTTATC
CTCATGATACGTATGAAGAAATAATGATTAAAATGGACTCTGTAAATAGA
GACAATTGTCTTTTAAAATCATGGGACGAACTTACACTTCCGGTAGATTC
CGTCGCAATGCTTCCTGTATTTAATACACTATTTAAAACTCCTTGGGTGG
CCAACAGATCCAGTCTTCTTCATATGCACAACATGGCTATGAATAGAGGG
TTCTTCTATAGTTATATTCTTCAAAAATTAAACACTTCAGATGCTGATTT
TCCTGATTTACCTGGCTTGCATTATTATTATTTATCAGCGTCGGCGGATG
TTTCAGCTAATCCTGGTATTATCAATGGTAGTTCGGTATTTTTCGATACT
AACTGTCAATATGCTAACTGGATACAAAACCTTGAATTCAATCACACACT
TCCTCTTTTCGGTCCCAAAGCTTGGCGATTAGATGATTGGAACGATGAAA
TAAATTGGCTCAGAGGTGAACCGACCAATTTCACAATAGAGATAATTGAT
TATGGAGCTGGTCCAAATAACAATTATACGAATCCTCAATACAAGTTTAA
TCCTTGGATGAAGGACAAGGAGATGAACATAGATTTCTTGCCGGATTACG
TCTATTCTAATGCTCGATCGCATCAAACAGATTTCGTGATTTACGAAAAA
TATGAAAATGGAACTATGGGCCAAGTTTCATTGAATTTCTTTGGTCCTCC
GCAGCCCGGTGTTAAAGAAGTTTTTCAACCTGTCAGATTCACTCGACCTT
ATTTTGATTGCAAACGTAGTAAGAAGTGGATTGTTACAGCAATTGGTCCA
GTAGTAGATTACATGGCAAGATATGTACCGCCTCAAGTATTGAACGTCCG
TCGTCCAAGAATTGTTGGAGTTACTACGATGGATATTGATTTTCTGCGAA
TCGATTTCAATCCGTGCCCCACTGCTGAGGGCAATGAAGCTCATTACTTC
GCCAATGTTGCAAGATGTAAGGCGACAACAATGCTCTATTTCATTTTGGG
TTTTATCGTGGTGGCTATCAGTGTAATTGCAGACCCGGATACCGATTACC
TTATTATCAAAACGGACCGTTTCAAGGTGTAGATATTGAAAGAGCTACCG
AAGAAGAATATAAATCCGGATTTGATTGCTTGCCAGTAAGCTGGAAGCAG
GTTAATCCTACTGTTGATGGAATCACAGATGAAGATAGTACTCGTAAAAA
GCGAAGTGTTGATGAAGAGAATATCGATCCATGGAGCGATGAAACAACAA
AGTGGCTAAGGACCGAGGCAAAGAAGGCCTCTATCAATCGGTGGAATAAA
TTAACAGTTAAACAATTTGGCAGCAAGTTAAAAACTAAATTTGCTCCACC
ACCGAAACCAGACGAAGAAAAACCGAAAACCGACGAACCAGAAATTCAAA
CTGTGGTTCATCCGAAACATCCGGAACCAGAAATCCTAAAAGCATATCGT
AAAAAACTTGAAGATAAAAAAACACCGTCACCGAAATTAGTACAATCTCG
AAGAAAACGATCTTTAGATTATGTGGGAAGATTAAGCGGATTCGAGCCAG
ATAAACTGCCAAAGATGGATAAGATGATGCAATTCATTAACAATGTGTCG
ATCGGCAATTGTAAATCATTCACCAAGGACCAATTGAGTCTGCCTGGTGA
AGTTGGCTATGGGAGTGAGACGCATTTCGAAATTCAGGGTCGTGTCGCAC
TGAGGTTGGCACATTTTTTAAGCGCATATTATCAGAATAATATTAAAAAT
GAAAAATACGGAAATCTTCGACCCGGTAGAACAATTAATAGGGAACACTT
GTTCGGAGAAGTGTTTGCAAACGTCATGGCTGATCTTAATATCAAATCAA
GTGGAGTGTTTTTCGATCGACAAAAGTTCGTCGATGATAATGATACTCGT
AAAGATCTGTTTGGTCCATATGCCTACAAACAAGACGGATCCTTGCAAGC
ATATGCTGCCATTGATTTGGGCTCAAAGGCTTTTTCTCCATATACTGAGA
ATTCATGGTTTAAAGTGTTGAAAGAACGATGGGGTTCAAATGCTTACGGA
TTAGAACGATTTAAAGGTAAACCATGGATCAGATCAGATATAAACGGTAG
TCAAATACAGCGCTACTTTCATTATCCATTGTTTTACTATGCGCCACGTT
ATCAAGATGGATATTGGTCGAATCCATACTTTGATTGCGATGGTTTTGTG
CCAAATTGGATCATGATGTATTCGGCGCCATTTTTTGGAAATGTAGGCTC
TTCAGGTCGAGTCGAATTCATGGGTGTTGTCACCGTTTCTGTGCCTTTGT
CGGAATTGGACATCAATCAGTGCCCATCCTCATTCTACACACCAAATTTC
TTTAAAAACACCGCCACCTGTGATTATCGATCGACTTATTGTACACCGTT
TCCCGGTCGAAAATTTGGATTAGGTAATTACAAATGTGAATGTAGACAAG
GTTTCGAGTATCCATTCGGTGATGCGTTGTGGTTTTATCCTGGACAACTG
TTGGAGAAAGAATACCGGAACAAGTTGATCGGTGTTGCCAATCGATATGA
CACTTTGCAGTGCCGAGAATCTGTCGGTTCACGGATATACATTTCATCGG
TGCTTTTCTGCTTATCATTCCTCATATCAGTTTGGCGAATTTGAAAAATA
TAATAAAGAAATATTTCAATGTAAAAAATTCCTTTCTAGAGATC
back to top

protein sequence of SMED30035611-orf-1

>SMED30035611-orf-1 ID=SMED30035611-orf-1|Name=SMED30035611-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=360bp
MDKMMQFINNVSIGNCKSFTKDQLSLPGEVGYGSETHFEIQGRVALRLAH
FLSAYYQNNIKNEKYGNLRPGRTINREHLFGEVFANVMADLNIKSSGVFF
DRQKFVDDNDTRKDLFGPYAYKQDGSLQAYAAIDLGSKAFSPYTENSWFK
VLKERWGSNAYGLERFKGKPWIRSDINGSQIQRYFHYPLFYYAPRYQDGY
WSNPYFDCDGFVPNWIMMYSAPFFGNVGSSGRVEFMGVVTVSVPLSELDI
NQCPSSFYTPNFFKNTATCDYRSTYCTPFPGRKFGLGNYKCECRQGFEYP
FGDALWFYPGQLLEKEYRNKLIGVANRYDTLQCRESVGSRIYISSVLFCL
SFLISVWRI*
back to top

protein sequence of SMED30035611-orf-2

>SMED30035611-orf-2 ID=SMED30035611-orf-2|Name=SMED30035611-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=394bp
LYKSYMIMKKFTLLLAYLTCLGLSFGKSPFTFYPHDTYEEIMIKMDSVNR
DNCLLKSWDELTLPVDSVAMLPVFNTLFKTPWVANRSSLLHMHNMAMNRG
FFYSYILQKLNTSDADFPDLPGLHYYYLSASADVSANPGIINGSSVFFDT
NCQYANWIQNLEFNHTLPLFGPKAWRLDDWNDEINWLRGEPTNFTIEIID
YGAGPNNNYTNPQYKFNPWMKDKEMNIDFLPDYVYSNARSHQTDFVIYEK
YENGTMGQVSLNFFGPPQPGVKEVFQPVRFTRPYFDCKRSKKWIVTAIGP
VVDYMARYVPPQVLNVRRPRIVGVTTMDIDFLRIDFNPCPTAEGNEAHYF
ANVARCKATTMLYFILGFIVVAISVIADPDTDYLIIKTDRFKV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR32546:SF25MIP05539Pcoord: 22..361
NoneNo IPR availablePANTHERPTHR32546G-PROTEIN COUPLED RECEPTOR 158-RELATEDcoord: 22..361
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.791
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
NoneNo IPR availableTMHMMTMhelixcoord: 352..371