SMED30035597

Overview
NameSMED30035597
Smed IDSMED30035597
Length (bp)1605
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30035597 (SMED30035597) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30035597 (SMED30035597) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30035597 (SMED30035597) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30035597 (SMED30035597) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035597

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30035597h1SMcG0012017 dd_Smed_v4_1765_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035597h1SMcG0012017 dd_Smed_v4_1765_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035597h1SMcG0012017 dd_Smed_v4_1765_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035597h1SMcG0012017 dd_Smed_v4_1765_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035597h1SMcG0012017 Contig37455uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035597h1SMcG0012017 Contig37455newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30035597h1SMcG0012017 dd_Smed_v4_1765_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30035597 vs. Ensembl Human
Match: PAK1 (p21 (RAC1) activated kinase 1 [Source:HGNC Symbol;Acc:HGNC:8590])

HSP 1 Score: 368.237 bits (944), Expect = 4.422e-121
Identity = 212/492 (43.09%), Postives = 287/492 (58.33%), Query Frame = -2
Query:  204 KFFKNL----KSGANKKEEPFEISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIFMKDYEEKHEKFLGNKENYEDKDETGEPRDNGL--KPVAE----------------EKTPPEI---------------------------VETENQKKLETNTSTP--------VKRKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRP---SPKAKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1499
            +F++++    K+   K++E  EIS P++ +  +HV FD  T +F G+P+ W +LL  ++ +K E+ K+P  + + + F   Y  K         ++ DK        N L  K V+E                + TPP +                           V T      E NT+ P         ++KK KMSD E    L  IV+  +P  KY   E++G GASGTV  A    TG +VAIK MNL +QP ++LI+ EI VM++ ++PNIVNY++S+L+ +  ELWVV+EYL GG+LTDVVTET MD G IA+V +ECL ALEFLH N +IHRDIKSDN+LLG  G VK+TDFGFCAQ+    S+R TMVGTPYWMAPEVV R   Y  K+DIWSLGIM IEM++GEPPY++E PL+A+Y I T G P   +P+ K+      FL+ CLE+D   R SA+ LL+H FLK  K L ++   I AA
Sbjct:   53 RFYRSILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEF---YNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGD--ELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKA-YGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPE-KLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAA 537          
BLAST of SMED30035597 vs. Ensembl Human
Match: PAK2 (p21 (RAC1) activated kinase 2 [Source:HGNC Symbol;Acc:HGNC:8591])

HSP 1 Score: 358.992 bits (920), Expect = 1.042e-117
Identity = 202/448 (45.09%), Postives = 271/448 (60.49%), Query Frame = -2
Query:  204 EISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIFMKDYEEKHEKFLGNKENYEDKDETGEPRDNGLKPVAEE-----------KTPPEIV-ETENQKKLETNT-----STPV--------------KRKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPK--AKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1448
            EIS P++ +  +HV FD  T +F G+P+ W +LL  ++ +K E+ K+P  + + + F  D     +K+L      +D   +G P  N     A               PP I    ++ K + T +       PV              ++KK KM+D E    L  IV+  +P  KY   E++G GASGTV  AT    G +VAIK +NL KQP ++LI+ EI VMK+ ++PNIVN+++S+L+ +  EL+VV+EYL GG+LTDVVTET MD   IA+V +ECL ALEFLH N +IHRDIKSDNVLLG  G VK+TDFGFCAQ+    S+R TMVGTPYWMAPEVV R   Y  K+DIWSLGIM IEM++GEPPY++E PL+A+Y I T G P  +   K+      FL+ CLE+D   R SA+ LL+H FLK  K L ++   I AA
Sbjct:   73 EISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVLDVLKFY-DSNTVKQKYLSFTPPEKDGFPSGTPALNAKGTEAPAVVTEEEDDDEETAPPVIAPRPDHTKSIYTRSVIDPVPAPVGDSHVDGAAKSLDKQKKKTKMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSYLVGD--ELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKA-YGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAA 516          
BLAST of SMED30035597 vs. Ensembl Human
Match: PAK1 (p21 (RAC1) activated kinase 1 [Source:HGNC Symbol;Acc:HGNC:8590])

HSP 1 Score: 355.14 bits (910), Expect = 2.436e-116
Identity = 203/472 (43.01%), Postives = 275/472 (58.26%), Query Frame = -2
Query:  261 KFFKNL----KSGANKKEEPFEISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIFMKDYEEKHEKFLGNKENYEDKDETGEPRDNGL--KPVAE----------------EKTPPEI---------------------------VETENQKKLETNTSTP--------VKRKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPK--AKVDGDLESFLHDCLEIDPNLRKSAESLLKH 1499
            +F++++    K+   K++E  EIS P++ +  +HV FD  T +F G+P+ W +LL  ++ +K E+ K+P  + + + F   Y  K         ++ DK        N L  K V+E                + TPP +                           V T      E NT+ P         ++KK KMSD E    L  IV+  +P  KY   E++G GASGTV  A    TG +VAIK MNL +QP ++LI+ EI VM++ ++PNIVNY++S+L+ +  ELWVV+EYL GG+LTDVVTET MD G IA+V +ECL ALEFLH N +IHRDIKSDN+LLG  G VK+TDFGFCAQ+    S+R TMVGTPYWMAPEVV R   Y  K+DIWSLGIM IEM++GEPPY++E PL+A+Y I T G P  +   K+      FL+ CLE+D   R SA+ LL+H
Sbjct:   53 RFYRSILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEF---YNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGD--ELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKA-YGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQH 518          
BLAST of SMED30035597 vs. Ensembl Human
Match: PAK3 (p21 (RAC1) activated kinase 3 [Source:HGNC Symbol;Acc:HGNC:8592])

HSP 1 Score: 353.214 bits (905), Expect = 2.552e-115
Identity = 205/481 (42.62%), Postives = 283/481 (58.84%), Query Frame = -2
Query:  204 KSGANKKEEPFEISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIFMKDYE----EKHEKFL-GNKENY----EDKDETGEPRDNGLKPVAE------------EKTPPEIV--ETENQKKLET-------------------------NTSTPVK---RKKNK--MSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPK--AKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1481
            K+   K++E  EIS P++ +  +HV FD  T +F G+P+ W +LL  ++ +K E+ K+P  + + + F    E    +K+  F  G+K  +         T    +  L P               E  PP ++    E+ K + T                         N+ST  +   R++ K  M+D E    L  IV+  +P  KY   E++G GASGTV  A    TG +VAIK MNL +QP ++LI+ EI VM++ ++PNIVNY++S+L+ +  ELWVV+EYL GG+LTDVVTET MD G IA+V +ECL AL+FLH N +IHRDIKSDN+LLG  G VK+TDFGFCAQ+    S+R TMVGTPYWMAPEVV R   Y  K+DIWSLGIM IEM++GEPPY++E PL+A+Y I T G P  +   ++      FL+ CLE+D + R SA+ LL+H FLK  K L ++   I AA
Sbjct:   57 KTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGIPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSKETVNNQKYMSFTSGDKSAHGYIAAHPSSTKTASEPPLAPPVSEEEDEEEEEEEDENEPPPVIAPRPEHTKSIYTRSVVESIASPAVPNKEVTPPSAENANSSTLYRNTDRQRKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGD--ELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKA-YGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLKLAKPLSSLTPLIIAA 534          
BLAST of SMED30035597 vs. Ensembl Human
Match: PAK3 (p21 (RAC1) activated kinase 3 [Source:HGNC Symbol;Acc:HGNC:8592])

HSP 1 Score: 353.214 bits (905), Expect = 2.991e-115
Identity = 205/481 (42.62%), Postives = 283/481 (58.84%), Query Frame = -2
Query:  204 KSGANKKEEPFEISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIFMKDYE----EKHEKFL-GNKENY----EDKDETGEPRDNGLKPVAE------------EKTPPEIV--ETENQKKLET-------------------------NTSTPVK---RKKNK--MSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPK--AKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1481
            K+   K++E  EIS P++ +  +HV FD  T +F G+P+ W +LL  ++ +K E+ K+P  + + + F    E    +K+  F  G+K  +         T    +  L P               E  PP ++    E+ K + T                         N+ST  +   R++ K  M+D E    L  IV+  +P  KY   E++G GASGTV  A    TG +VAIK MNL +QP ++LI+ EI VM++ ++PNIVNY++S+L+ +  ELWVV+EYL GG+LTDVVTET MD G IA+V +ECL AL+FLH N +IHRDIKSDN+LLG  G VK+TDFGFCAQ+    S+R TMVGTPYWMAPEVV R   Y  K+DIWSLGIM IEM++GEPPY++E PL+A+Y I T G P  +   ++      FL+ CLE+D + R SA+ LL+H FLK  K L ++   I AA
Sbjct:   58 KTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGIPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSKETVNNQKYMSFTSGDKSAHGYIAAHPSSTKTASEPPLAPPVSEEEDEEEEEEEDENEPPPVIAPRPEHTKSIYTRSVVESIASPAVPNKEVTPPSAENANSSTLYRNTDRQRKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGD--ELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKA-YGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLKLAKPLSSLTPLIIAA 535          
BLAST of SMED30035597 vs. Ensembl Celegans
Match: max-2 (Serine/threonine-protein kinase max-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ3])

HSP 1 Score: 325.865 bits (834), Expect = 1.552e-106
Identity = 159/296 (53.72%), Postives = 215/296 (72.64%), Query Frame = -2
Query:  204 KNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPKA--KVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1085
            + K+SD+E    L EIV   NPL KYE+ +++G GASGTV +A    + + VA+K M    QP ++++LTEIKVMKQ +HPN+VNYIES+L+  D +LWVV++YL+GG LTDVV +T +D G IA+V++ECL AL FLH ++I+HRDIKSDNVLLG +G+VK+TD GFCAQ+    S+R T+VGTPYWM+PE++N+  QY+ K+DIWSLGIM +EM+DGEPPY+ ETPLKAIY I   G+P  K   ++  +  +FL  CL +DP+ R     LL H FLK+ K L ++   I A 
Sbjct:  131 REKLSDSEVLNQLREIVNPSNPLGKYEMKKQIGVGASGTVFVANVAGSTDVVAVKRMAFKTQPKKEMLLTEIKVMKQYRHPNLVNYIESYLVDAD-DLWVVMDYLEGGNLTDVVVKTELDEGQIAAVLQECLKALHFLHRHSIVHRDIKSDNVLLGMNGEVKLTDMGFCAQI-QPGSKRDTVVGTPYWMSPEILNKK-QYNYKVDIWSLGIMALEMIDGEPPYLRETPLKAIYLIAQNGKPEIKQRDRLSSEFNNFLDKCLVVDPDQRADTTELLAHPFLKKAKPLSSLIPYIRAV 423          
BLAST of SMED30035597 vs. Ensembl Celegans
Match: max-2 (Serine/threonine-protein kinase max-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ3])

HSP 1 Score: 327.405 bits (838), Expect = 5.380e-105
Identity = 159/295 (53.90%), Postives = 215/295 (72.88%), Query Frame = -2
Query:  207 KNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPKA--KVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDA 1085
            + K+SD+E    L EIV   NPL KYE+ +++G GASGTV +A    + + VA+K M    QP ++++LTEIKVMKQ +HPN+VNYIES+L+  D +LWVV++YL+GG LTDVV +T +D G IA+V++ECL AL FLH ++I+HRDIKSDNVLLG +G+VK+TD GFCAQ+    S+R T+VGTPYWM+PE++N+  QY+ K+DIWSLGIM +EM+DGEPPY+ ETPLKAIY I   G+P  K   ++  +  +FL  CL +DP+ R     LL H FLK+ K L ++   I A
Sbjct:  306 REKLSDSEVLNQLREIVNPSNPLGKYEMKKQIGVGASGTVFVANVAGSTDVVAVKRMAFKTQPKKEMLLTEIKVMKQYRHPNLVNYIESYLVDAD-DLWVVMDYLEGGNLTDVVVKTELDEGQIAAVLQECLKALHFLHRHSIVHRDIKSDNVLLGMNGEVKLTDMGFCAQI-QPGSKRDTVVGTPYWMSPEILNKK-QYNYKVDIWSLGIMALEMIDGEPPYLRETPLKAIYLIAQNGKPEIKQRDRLSSEFNNFLDKCLVVDPDQRADTTELLAHPFLKKAKPLSSLIPYIRA 597          
BLAST of SMED30035597 vs. Ensembl Celegans
Match: max-2 (Serine/threonine-protein kinase max-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ3])

HSP 1 Score: 327.405 bits (838), Expect = 5.461e-105
Identity = 159/295 (53.90%), Postives = 215/295 (72.88%), Query Frame = -2
Query:  207 KNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPKA--KVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDA 1085
            + K+SD+E    L EIV   NPL KYE+ +++G GASGTV +A    + + VA+K M    QP ++++LTEIKVMKQ +HPN+VNYIES+L+  D +LWVV++YL+GG LTDVV +T +D G IA+V++ECL AL FLH ++I+HRDIKSDNVLLG +G+VK+TD GFCAQ+    S+R T+VGTPYWM+PE++N+  QY+ K+DIWSLGIM +EM+DGEPPY+ ETPLKAIY I   G+P  K   ++  +  +FL  CL +DP+ R     LL H FLK+ K L ++   I A
Sbjct:  303 REKLSDSEVLNQLREIVNPSNPLGKYEMKKQIGVGASGTVFVANVAGSTDVVAVKRMAFKTQPKKEMLLTEIKVMKQYRHPNLVNYIESYLVDAD-DLWVVMDYLEGGNLTDVVVKTELDEGQIAAVLQECLKALHFLHRHSIVHRDIKSDNVLLGMNGEVKLTDMGFCAQI-QPGSKRDTVVGTPYWMSPEILNKK-QYNYKVDIWSLGIMALEMIDGEPPYLRETPLKAIYLIAQNGKPEIKQRDRLSSEFNNFLDKCLVVDPDQRADTTELLAHPFLKKAKPLSSLIPYIRA 594          
BLAST of SMED30035597 vs. Ensembl Celegans
Match: max-2 (Serine/threonine-protein kinase max-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ3])

HSP 1 Score: 327.405 bits (838), Expect = 1.685e-104
Identity = 159/295 (53.90%), Postives = 215/295 (72.88%), Query Frame = -2
Query:  207 KNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPKA--KVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDA 1085
            + K+SD+E    L EIV   NPL KYE+ +++G GASGTV +A    + + VA+K M    QP ++++LTEIKVMKQ +HPN+VNYIES+L+  D +LWVV++YL+GG LTDVV +T +D G IA+V++ECL AL FLH ++I+HRDIKSDNVLLG +G+VK+TD GFCAQ+    S+R T+VGTPYWM+PE++N+  QY+ K+DIWSLGIM +EM+DGEPPY+ ETPLKAIY I   G+P  K   ++  +  +FL  CL +DP+ R     LL H FLK+ K L ++   I A
Sbjct:  354 REKLSDSEVLNQLREIVNPSNPLGKYEMKKQIGVGASGTVFVANVAGSTDVVAVKRMAFKTQPKKEMLLTEIKVMKQYRHPNLVNYIESYLVDAD-DLWVVMDYLEGGNLTDVVVKTELDEGQIAAVLQECLKALHFLHRHSIVHRDIKSDNVLLGMNGEVKLTDMGFCAQI-QPGSKRDTVVGTPYWMSPEILNKK-QYNYKVDIWSLGIMALEMIDGEPPYLRETPLKAIYLIAQNGKPEIKQRDRLSSEFNNFLDKCLVVDPDQRADTTELLAHPFLKKAKPLSSLIPYIRA 645          
BLAST of SMED30035597 vs. Ensembl Celegans
Match: max-2 (Serine/threonine-protein kinase max-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ3])

HSP 1 Score: 327.405 bits (838), Expect = 1.972e-104
Identity = 159/295 (53.90%), Postives = 215/295 (72.88%), Query Frame = -2
Query:  207 KNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPKA--KVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDA 1085
            + K+SD+E    L EIV   NPL KYE+ +++G GASGTV +A    + + VA+K M    QP ++++LTEIKVMKQ +HPN+VNYIES+L+  D +LWVV++YL+GG LTDVV +T +D G IA+V++ECL AL FLH ++I+HRDIKSDNVLLG +G+VK+TD GFCAQ+    S+R T+VGTPYWM+PE++N+  QY+ K+DIWSLGIM +EM+DGEPPY+ ETPLKAIY I   G+P  K   ++  +  +FL  CL +DP+ R     LL H FLK+ K L ++   I A
Sbjct:  351 REKLSDSEVLNQLREIVNPSNPLGKYEMKKQIGVGASGTVFVANVAGSTDVVAVKRMAFKTQPKKEMLLTEIKVMKQYRHPNLVNYIESYLVDAD-DLWVVMDYLEGGNLTDVVVKTELDEGQIAAVLQECLKALHFLHRHSIVHRDIKSDNVLLGMNGEVKLTDMGFCAQI-QPGSKRDTVVGTPYWMSPEILNKK-QYNYKVDIWSLGIMALEMIDGEPPYLRETPLKAIYLIAQNGKPEIKQRDRLSSEFNNFLDKCLVVDPDQRADTTELLAHPFLKKAKPLSSLIPYIRA 642          
BLAST of SMED30035597 vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0334539)

HSP 1 Score: 340.502 bits (872), Expect = 1.065e-108
Identity = 170/297 (57.24%), Postives = 212/297 (71.38%), Query Frame = -2
Query:  204 KKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRP--SPKAKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1088
            KK KMSD E    L  IV+  +P  KY   E++G GASGTV  A    TG +VAIK MNL +QP ++LI+ EI VM++ +HPN+VNY++S+L+ E  ELWVV+EYL GG+LTDVVTET MD G IA+V +E L ALEFLH N +IHRDIKSDN+LLG  G VK+TDFGFCAQ+    S+R TMVGTPYWMAPEVV R  QY  K+D+WSLGIM IEM++GEPPY++E PLKA+Y I T G+P    K K+    + FL  CLE++ + R SA  LLKH FLK  + L ++   I AA
Sbjct:  404 KKKKMSDEEILEKLRTIVSVGDPNRKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSE--ELWVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTPYWMAPEVVTRK-QYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPFLKLARPLASLTPLIMAA 697          

HSP 2 Score: 53.1434 bits (126), Expect = 4.769e-7
Identity = 22/54 (40.74%), Postives = 35/54 (64.81%), Query Frame = -2
Query: 1284 ISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAV 1445
            IS PTN +  VHV FD  T +F G+P+ W +LL  ++ SK+E+ K+P  + + +
Sbjct:   83 ISYPTNFEHTVHVGFDAVTGEFTGMPEAWARLLMNSNISKQEQKKNPQAVLDVL 136          
BLAST of SMED30035597 vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0081714)

HSP 1 Score: 340.502 bits (872), Expect = 1.065e-108
Identity = 170/297 (57.24%), Postives = 212/297 (71.38%), Query Frame = -2
Query:  204 KKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRP--SPKAKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1088
            KK KMSD E    L  IV+  +P  KY   E++G GASGTV  A    TG +VAIK MNL +QP ++LI+ EI VM++ +HPN+VNY++S+L+ E  ELWVV+EYL GG+LTDVVTET MD G IA+V +E L ALEFLH N +IHRDIKSDN+LLG  G VK+TDFGFCAQ+    S+R TMVGTPYWMAPEVV R  QY  K+D+WSLGIM IEM++GEPPY++E PLKA+Y I T G+P    K K+    + FL  CLE++ + R SA  LLKH FLK  + L ++   I AA
Sbjct:  404 KKKKMSDEEILEKLRTIVSVGDPNRKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSE--ELWVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTPYWMAPEVVTRK-QYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPFLKLARPLASLTPLIMAA 697          

HSP 2 Score: 53.1434 bits (126), Expect = 4.769e-7
Identity = 22/54 (40.74%), Postives = 35/54 (64.81%), Query Frame = -2
Query: 1284 ISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAV 1445
            IS PTN +  VHV FD  T +F G+P+ W +LL  ++ SK+E+ K+P  + + +
Sbjct:   83 ISYPTNFEHTVHVGFDAVTGEFTGMPEAWARLLMNSNISKQEQKKNPQAVLDVL 136          
BLAST of SMED30035597 vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0081716)

HSP 1 Score: 340.502 bits (872), Expect = 1.065e-108
Identity = 170/297 (57.24%), Postives = 212/297 (71.38%), Query Frame = -2
Query:  204 KKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRP--SPKAKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1088
            KK KMSD E    L  IV+  +P  KY   E++G GASGTV  A    TG +VAIK MNL +QP ++LI+ EI VM++ +HPN+VNY++S+L+ E  ELWVV+EYL GG+LTDVVTET MD G IA+V +E L ALEFLH N +IHRDIKSDN+LLG  G VK+TDFGFCAQ+    S+R TMVGTPYWMAPEVV R  QY  K+D+WSLGIM IEM++GEPPY++E PLKA+Y I T G+P    K K+    + FL  CLE++ + R SA  LLKH FLK  + L ++   I AA
Sbjct:  404 KKKKMSDEEILEKLRTIVSVGDPNRKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSE--ELWVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTPYWMAPEVVTRK-QYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPFLKLARPLASLTPLIMAA 697          

HSP 2 Score: 53.1434 bits (126), Expect = 4.769e-7
Identity = 22/54 (40.74%), Postives = 35/54 (64.81%), Query Frame = -2
Query: 1284 ISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAV 1445
            IS PTN +  VHV FD  T +F G+P+ W +LL  ++ SK+E+ K+P  + + +
Sbjct:   83 ISYPTNFEHTVHVGFDAVTGEFTGMPEAWARLLMNSNISKQEQKKNPQAVLDVL 136          
BLAST of SMED30035597 vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0081715)

HSP 1 Score: 340.502 bits (872), Expect = 1.065e-108
Identity = 170/297 (57.24%), Postives = 212/297 (71.38%), Query Frame = -2
Query:  204 KKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRP--SPKAKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1088
            KK KMSD E    L  IV+  +P  KY   E++G GASGTV  A    TG +VAIK MNL +QP ++LI+ EI VM++ +HPN+VNY++S+L+ E  ELWVV+EYL GG+LTDVVTET MD G IA+V +E L ALEFLH N +IHRDIKSDN+LLG  G VK+TDFGFCAQ+    S+R TMVGTPYWMAPEVV R  QY  K+D+WSLGIM IEM++GEPPY++E PLKA+Y I T G+P    K K+    + FL  CLE++ + R SA  LLKH FLK  + L ++   I AA
Sbjct:  404 KKKKMSDEEILEKLRTIVSVGDPNRKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSE--ELWVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTPYWMAPEVVTRK-QYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPFLKLARPLASLTPLIMAA 697          

HSP 2 Score: 53.1434 bits (126), Expect = 4.769e-7
Identity = 22/54 (40.74%), Postives = 35/54 (64.81%), Query Frame = -2
Query: 1284 ISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAV 1445
            IS PTN +  VHV FD  T +F G+P+ W +LL  ++ SK+E+ K+P  + + +
Sbjct:   83 ISYPTNFEHTVHVGFDAVTGEFTGMPEAWARLLMNSNISKQEQKKNPQAVLDVL 136          
BLAST of SMED30035597 vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0334544)

HSP 1 Score: 340.502 bits (872), Expect = 1.065e-108
Identity = 170/297 (57.24%), Postives = 212/297 (71.38%), Query Frame = -2
Query:  204 KKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRP--SPKAKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1088
            KK KMSD E    L  IV+  +P  KY   E++G GASGTV  A    TG +VAIK MNL +QP ++LI+ EI VM++ +HPN+VNY++S+L+ E  ELWVV+EYL GG+LTDVVTET MD G IA+V +E L ALEFLH N +IHRDIKSDN+LLG  G VK+TDFGFCAQ+    S+R TMVGTPYWMAPEVV R  QY  K+D+WSLGIM IEM++GEPPY++E PLKA+Y I T G+P    K K+    + FL  CLE++ + R SA  LLKH FLK  + L ++   I AA
Sbjct:  404 KKKKMSDEEILEKLRTIVSVGDPNRKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSE--ELWVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTPYWMAPEVVTRK-QYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPFLKLARPLASLTPLIMAA 697          

HSP 2 Score: 53.1434 bits (126), Expect = 4.769e-7
Identity = 22/54 (40.74%), Postives = 35/54 (64.81%), Query Frame = -2
Query: 1284 ISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAV 1445
            IS PTN +  VHV FD  T +F G+P+ W +LL  ++ SK+E+ K+P  + + +
Sbjct:   83 ISYPTNFEHTVHVGFDAVTGEFTGMPEAWARLLMNSNISKQEQKKNPQAVLDVL 136          
BLAST of SMED30035597 vs. Ensembl Zebrafish
Match: pak2a (p21 protein (Cdc42/Rac)-activated kinase 2a [Source:ZFIN;Acc:ZDB-GENE-021011-2])

HSP 1 Score: 365.155 bits (936), Expect = 2.032e-120
Identity = 201/453 (44.37%), Postives = 270/453 (59.60%), Query Frame = -2
Query:  204 KEEPFEISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIFMKDYEEKHEKFLGNKENYEDKDETGEPRDNGLKPVAEEK-------------------------------TPPEIVETENQKKLETNTSTPVKRKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPK--AKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1463
            KE P EISNP++ +  +HV FD  T +F G+P+ W +LL  ++ +K E+ K+P  + + + F        +K+L    ++ DKD     + +   PV +                                  P  I +T+  K  +       K+ K KM+D E    L  IV+  +P  KY   E++G GASGTV  A    TG +VAIK +NL KQP ++LI+ EI VMK+ ++PNIVN+++SFL+ +  EL+VV+EYL GG+LTDVVTET MD   IA+V +ECL ALEFLH N +IHRDIKSDNVLLG  G VK+TDFGFCAQ+    S+R TMVGTPYWMAPEVV R   Y  K+DIWSLGIM IEM++GEPPY++E PL+A+Y I T G P  +   K+      FL+ CLE+D   R   + LL+H FLK  K L ++   I AA
Sbjct:   70 KERP-EISNPSDFEHTIHVGFDSVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLKFYDSTGNSRQKYL----SFTDKDAPQAKKGSEQSPVKDPDDDDEDAPPPVVAPRPQHTISVYTRSVIDPIPAPAAIADTDGSKAADKQ-----KKGKGKMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVYTAIDVATGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSFLVGD--ELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKA-YGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGGGKELLQHPFLKLAKPLSSLTPLILAA 509          
BLAST of SMED30035597 vs. Ensembl Zebrafish
Match: pak2a (p21 protein (Cdc42/Rac)-activated kinase 2a [Source:ZFIN;Acc:ZDB-GENE-021011-2])

HSP 1 Score: 365.155 bits (936), Expect = 2.032e-120
Identity = 201/453 (44.37%), Postives = 270/453 (59.60%), Query Frame = -2
Query:  204 KEEPFEISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIFMKDYEEKHEKFLGNKENYEDKDETGEPRDNGLKPVAEEK-------------------------------TPPEIVETENQKKLETNTSTPVKRKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPK--AKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1463
            KE P EISNP++ +  +HV FD  T +F G+P+ W +LL  ++ +K E+ K+P  + + + F        +K+L    ++ DKD     + +   PV +                                  P  I +T+  K  +       K+ K KM+D E    L  IV+  +P  KY   E++G GASGTV  A    TG +VAIK +NL KQP ++LI+ EI VMK+ ++PNIVN+++SFL+ +  EL+VV+EYL GG+LTDVVTET MD   IA+V +ECL ALEFLH N +IHRDIKSDNVLLG  G VK+TDFGFCAQ+    S+R TMVGTPYWMAPEVV R   Y  K+DIWSLGIM IEM++GEPPY++E PL+A+Y I T G P  +   K+      FL+ CLE+D   R   + LL+H FLK  K L ++   I AA
Sbjct:   70 KERP-EISNPSDFEHTIHVGFDSVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLKFYDSTGNSRQKYL----SFTDKDAPQAKKGSEQSPVKDPDDDDEDAPPPVVAPRPQHTISVYTRSVIDPIPAPAAIADTDGSKAADKQ-----KKGKGKMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVYTAIDVATGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSFLVGD--ELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKA-YGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGGGKELLQHPFLKLAKPLSSLTPLILAA 509          
BLAST of SMED30035597 vs. Ensembl Zebrafish
Match: pak2a (p21 protein (Cdc42/Rac)-activated kinase 2a [Source:ZFIN;Acc:ZDB-GENE-021011-2])

HSP 1 Score: 365.155 bits (936), Expect = 2.032e-120
Identity = 201/453 (44.37%), Postives = 270/453 (59.60%), Query Frame = -2
Query:  204 KEEPFEISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIFMKDYEEKHEKFLGNKENYEDKDETGEPRDNGLKPVAEEK-------------------------------TPPEIVETENQKKLETNTSTPVKRKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPK--AKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1463
            KE P EISNP++ +  +HV FD  T +F G+P+ W +LL  ++ +K E+ K+P  + + + F        +K+L    ++ DKD     + +   PV +                                  P  I +T+  K  +       K+ K KM+D E    L  IV+  +P  KY   E++G GASGTV  A    TG +VAIK +NL KQP ++LI+ EI VMK+ ++PNIVN+++SFL+ +  EL+VV+EYL GG+LTDVVTET MD   IA+V +ECL ALEFLH N +IHRDIKSDNVLLG  G VK+TDFGFCAQ+    S+R TMVGTPYWMAPEVV R   Y  K+DIWSLGIM IEM++GEPPY++E PL+A+Y I T G P  +   K+      FL+ CLE+D   R   + LL+H FLK  K L ++   I AA
Sbjct:   70 KERP-EISNPSDFEHTIHVGFDSVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLKFYDSTGNSRQKYL----SFTDKDAPQAKKGSEQSPVKDPDDDDEDAPPPVVAPRPQHTISVYTRSVIDPIPAPAAIADTDGSKAADKQ-----KKGKGKMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVYTAIDVATGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSFLVGD--ELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKA-YGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGGGKELLQHPFLKLAKPLSSLTPLILAA 509          
BLAST of SMED30035597 vs. Ensembl Zebrafish
Match: pak2a (p21 protein (Cdc42/Rac)-activated kinase 2a [Source:ZFIN;Acc:ZDB-GENE-021011-2])

HSP 1 Score: 362.459 bits (929), Expect = 2.249e-119
Identity = 201/453 (44.37%), Postives = 268/453 (59.16%), Query Frame = -2
Query:  204 KEEPFEISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIFMKDYEEKHEKFLGNKENYEDKDETGEPRDNGLKPVAEEK-------------------------------TPPEIVETENQKKLETNTSTPVKRKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPK--AKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1463
            KE P EISNP++ +  +HV FD  T +F G+P+ W +LL  ++ +K E+ K+P  + + + F        +K+L       DKD     + +   PV +                                  P  I +T+  K  +       K+ K KM+D E    L  IV+  +P  KY   E++G GASGTV  A    TG +VAIK +NL KQP ++LI+ EI VMK+ ++PNIVN+++SFL+ +  EL+VV+EYL GG+LTDVVTET MD   IA+V +ECL ALEFLH N +IHRDIKSDNVLLG  G VK+TDFGFCAQ+    S+R TMVGTPYWMAPEVV R   Y  K+DIWSLGIM IEM++GEPPY++E PL+A+Y I T G P  +   K+      FL+ CLE+D   R   + LL+H FLK  K L ++   I AA
Sbjct:   70 KERP-EISNPSDFEHTIHVGFDSVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLKFYDSTGNSRQKYLSFTA---DKDAPQAKKGSEQSPVKDPDDDDEDAPPPVVAPRPQHTISVYTRSVIDPIPAPAAIADTDGSKAADKQ-----KKGKGKMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVYTAIDVATGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSFLVGD--ELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKA-YGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGGGKELLQHPFLKLAKPLSSLTPLILAA 510          
BLAST of SMED30035597 vs. Ensembl Zebrafish
Match: pak2b (p21 protein (Cdc42/Rac)-activated kinase 2b [Source:ZFIN;Acc:ZDB-GENE-030131-3759])

HSP 1 Score: 361.688 bits (927), Expect = 7.959e-119
Identity = 211/480 (43.96%), Postives = 283/480 (58.96%), Query Frame = -2
Query:  204 FFKNLKSGANKKE---EPFEISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIFMKDYEEKHEKFLGNKENYEDKDETGE--PRDNGLKPVAEEK------------------TPPEIV--ETENQKKLETNTST------PV---------------KRKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRP---SPKAKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1496
             F   + G  +K+   E  EIS P++ +  +HV FD  T +F G+P+ W +LL  ++ +K E+ K+P  + + + F        +K+L +  + +D   +GE  P     +P +  K                  TPP +V    E+ K + T  S       PV               + KK KM+D E    L  IV+  +P  KY   E++G GASGTV  A    TG +VAIK +NL KQP ++LI+ EI VMK+ ++PNIVN+++SFL+ E  EL+VV+EYL GG+LTDVVTET MD   IA+V +ECL ALEFLH N +IHRDIKSDNVLLG  G VK+TDFGFCAQ+    S+R TMVGTPYWMAPEVV R   Y  K+DIWSLGIM IEM++GEPPY++E PL+A+Y I T G P   SP+ K+      FL  CLE+D   R  ++ LL+H FLK  K L ++   I AA
Sbjct:   55 IFSGAEKGGRRKDRDKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLKFYDSTGNGRQKYL-SFSSEKDSFPSGEQSPAKKTPEPSSPVKAVDDEDNGEDEDDDDDEETPPPVVAPRPEHTKSVYTRPSVIDPLPPPVTSPESDAASKATDRQRPKKGKMTDEEIMDKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTAIDVATGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSFLVGE--ELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKA-YGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQSPE-KLSPIFRDFLGRCLEMDVEKRGGSKELLQHPFLKLAKPLSSLTPLILAA 529          
BLAST of SMED30035597 vs. Ensembl Xenopus
Match: taf3 (TATA-box binding protein associated factor 3 [Source:Xenbase;Acc:XB-GENE-940280])

HSP 1 Score: 368.622 bits (945), Expect = 1.306e-121
Identity = 210/470 (44.68%), Postives = 284/470 (60.43%), Query Frame = -2
Query:  204 MLKFFKNLKSGANKKE-EPFEISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIFMKDYEEKH---EKFLGNKENYEDKDETG---EPRDNGLKPVAEE--------KTPPEIV--ETENQKKLETNT-----------------STPVKRKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPKA--KVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1505
            ++  F   + G+ KKE E  EIS P++ +  +HV FD  T +F G+P+ W +LL  ++ +K E+ K+P  + + + F   Y+ KH   +K+L      +D   +G    P   G +P            K PP ++    E+ K + T +                 +   ++KK KMSD E    L  IV+  +P  KY   E++G GASGTV  A    TG +VAIK +NL KQP ++LI+ EI VMK+ ++PNIVN+++SFL+ +  EL+VV+EYL GG+LTDVVTET MD   IA+V +ECL ALEFLH N +IHRDIKSDNVLLG  G VK+TDFGFCAQ+    S+R TMVGTPYWMAPEVV R   Y  K+DIWSLGIM IEM++GEPPY++E PL+A+Y I T G P  +   K+      FL+  LE+D   R SA  LL+H FLK  K L ++   I AA
Sbjct:   47 IISMFSGTEKGSRKKERERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVLDVLKF---YDSKHTDKQKYLSFSAPDKDGLPSGVSSAPNAKGSEPSTAATDDDSDDDKAPPPVIAPRPEHTKSMYTRSVIDPIPPPPGDSDSAAKAGDRQKKKTKMSDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTAIDVATGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSFLVSD--ELYVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKA-YGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQKPEKLSPIFRDFLNRSLEMDVEKRGSARELLQHPFLKLAKPLSSLTPLILAA 510          
BLAST of SMED30035597 vs. Ensembl Xenopus
Match: qsox2 (quiescin sulfhydryl oxidase 2 [Source:Xenbase;Acc:XB-GENE-986398])

HSP 1 Score: 365.54 bits (937), Expect = 2.243e-120
Identity = 202/456 (44.30%), Postives = 269/456 (58.99%), Query Frame = -2
Query:  213 KEEPFEISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIFMK-DYEEKHEKFLGNKENYEDK-------DETGEPRDNGLKPVAEEKTPP---------------EIVE-----------TENQKKLETNTSTPV--KRKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPS---PKAKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASI 1463
            K  P  IS+P   +   HV  DP T +F G+P  W +LL  A+ SK ++ K+P  + + + F   +   K +K++   +N  +        D    P    + PV E + PP                ++E           TEN   +     + V   +KK KM+D E    L  IV+  +P  KY   E++G GASGTV +A    TG +VAIK MNL +QP ++LI+ EI VM++ +HPNIVNY++S+L+ E  ELWVV+EYL GG+LTDVVTET M  G IA+V +ECL ALEFLH N +IHRDIKSDN+LLG  G VK+TDFGFCAQ+    ++R TMVGTPYWMAPEVV R   Y  K+D+WSLGIM IEM++GEPPY++E PL+A+Y I T G P    P+ K       FL  CLE+D   R SA  LL+H FLK  K + ++   I
Sbjct:   59 KNPPLVISSPFGYEHIYHVGIDPSTGEFTGMPKQWAQLLQTANISKIDQKKNPQVVLDVLNFYSSETTSKSQKYMSFTDNSREAYNSNSVLDAKPVPEVAEVLPVPEAEDPPAFPPRPDHTKSIYTRSVIEPPVPPLAAKPTTENGSSVTDGAESSVDKTKKKPKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYIAVDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKHPNIVNYLDSYLVGE--ELWVVMEYLAGGSLTDVVTETCMQEGEIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGAVKLTDFGFCAQISPEQNKRSTMVGTPYWMAPEVVTRKA-YGPKVDVWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPQLQEPEKKSPA-FRDFLSRCLEMDVEKRGSARDLLQHPFLKVAKPMSSLTPYI 510          
BLAST of SMED30035597 vs. Ensembl Xenopus
Match: qsox2 (quiescin sulfhydryl oxidase 2 [Source:Xenbase;Acc:XB-GENE-986398])

HSP 1 Score: 351.673 bits (901), Expect = 4.130e-116
Identity = 192/412 (46.60%), Postives = 254/412 (61.65%), Query Frame = -2
Query:  213 VHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIFMKD----YEEKHEKFLGNKENYEDKDETGEPRDNGLKPVAEEKTPPEIVE--TENQKKLETNTSTPV--KRKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPS---PKAKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASI 1415
            V  T   E     G+P  W +LL  A+ SK ++ K+P  + + + F         +K+  F G +   + K+  G+      + V E   PP   +  TEN   +     + V   +KK KM+D E    L  IV+  +P  KY   E++G GASGTV +A    TG +VAIK MNL +QP ++LI+ EI VM++ +HPNIVNY++S+L+ E  ELWVV+EYL GG+LTDVVTET M  G IA+V +ECL ALEFLH N +IHRDIKSDN+LLG  G VK+TDFGFCAQ+    ++R TMVGTPYWMAPEVV R   Y  K+D+WSLGIM IEM++GEPPY++E PL+A+Y I T G P    P+ K       FL  CLE+D   R SA  LL+H FLK  K + ++   I
Sbjct:   25 VLSTIQQEQPPKFGMPKQWAQLLQTANISKIDQKKNPQVVLDVLNFYSSETTSKSQKYMSFTGKRFWQKPKEALGQIYT---RSVIEPPVPPLAAKPTTENGSSVTDGAESSVDKTKKKPKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYIAVDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKHPNIVNYLDSYLVGE--ELWVVMEYLAGGSLTDVVTETCMQEGEIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGAVKLTDFGFCAQISPEQNKRSTMVGTPYWMAPEVVTRKA-YGPKVDVWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPQLQEPEKKSPA-FRDFLSRCLEMDVEKRGSARDLLQHPFLKVAKPMSSLTPYI 429          
BLAST of SMED30035597 vs. Ensembl Xenopus
Match: flii (FLII actin remodeling protein [Source:Xenbase;Acc:XB-GENE-478681])

HSP 1 Score: 341.273 bits (874), Expect = 5.118e-111
Identity = 192/451 (42.57%), Postives = 262/451 (58.09%), Query Frame = -2
Query:  204 KSGANKKEEPFEISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIFMKDYEEKHEKFLGNKENYED-----------------------KDETGEPRDNGLKPVAEEKTPPEIVETENQKKLETNTSTPVKRKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPK--AKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1481
            K+   K++E  EIS P++ +  +HV FD  T +F G+P+ W +LL  ++ +K E+ K+P  + + + F    E      L N +   +                             PR    K +        +  T   K+  T+  TP     N  S +  Y   D    K    D+ E+ E+L    S TV  A    TG +VAIK MNL +QP ++LI+ EI VM++ ++PNIVNY++S+L+ +  ELWVV+EYL GG+LTDVVTET MD G IA+V +ECL AL+FLH N +IHRDIKSDN+LLG  G VK+TDFGFCAQ+    S+R TMVGTPYWMAPEVV R   Y  K+DIWSLGIM IEM++GEPPY++E PL+A+Y I T G P  +   ++      FL+ CLE+D + R SA+ LL+H FLK  K L ++   I AA
Sbjct:   58 KTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGIPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSKETFLSHVLQNAKTASEPPLAPPVSEEEDEEEEEEEDDNEPPPVIAPRPEHTKSIYTRSVIEPVALTAPAKEASTSPVTPQPENSNS-STSTLYRNTDRQRKKSKMTDE-EILEKLRTFLSRTVYTAIDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGD--ELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKA-YGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPERLSAIFRDFLNRCLEMDVDRRGSAKELLQHPFLKLAKPLSSLTPLIIAA 503          
BLAST of SMED30035597 vs. Ensembl Xenopus
Match: flii (FLII actin remodeling protein [Source:Xenbase;Acc:XB-GENE-478681])

HSP 1 Score: 340.117 bits (871), Expect = 7.089e-111
Identity = 176/330 (53.33%), Postives = 227/330 (68.79%), Query Frame = -2
Query:  204 PVAEEKTPPEIVETENQKKLETNT---STPVKRKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPK--AKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1178
            P  E  T P   + EN     T+T   +T  +RKK+KM+D E    L  IV+  +P  KY   E++G GASGTV  A    TG +VAIK MNL +QP ++LI+ EI VM++ ++PNIVNY++S+L+ +  ELWVV+EYL GG+LTDVVTET MD G IA+V +ECL AL+FLH N +IHRDIKSDN+LLG  G VK+TDFGFCAQ+    S+R TMVGTPYWMAPEVV R   Y  K+DIWSLGIM IEM++GEPPY++E PL+A+Y I T G P  +   ++      FL+ CLE+D + R SA+ LL+H FLK  K L ++   I AA
Sbjct:  163 PAKEASTSPVTPQPENSNS-STSTLYRNTDRQRKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAIDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGD--ELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKA-YGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPERLSAIFRDFLNRCLEMDVDRRGSAKELLQHPFLKLAKPLSSLTPLIIAA 488          

HSP 2 Score: 52.373 bits (124), Expect = 1.340e-6
Identity = 25/67 (37.31%), Postives = 42/67 (62.69%), Query Frame = -2
Query: 1278 ANKKEEP--FEISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIF 1472
            ANKK+E    EIS P++ +  +HV FD  T +F G+P+ W +LL  ++ +K E+ K+P  + + + F
Sbjct:    7 ANKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGIPEQWARLLQTSNITKLEQKKNPQAVLDVLKF 73          
BLAST of SMED30035597 vs. Ensembl Mouse
Match: Pak1 (p21 (RAC1) activated kinase 1 [Source:MGI Symbol;Acc:MGI:1339975])

HSP 1 Score: 368.237 bits (944), Expect = 2.617e-121
Identity = 210/487 (43.12%), Postives = 285/487 (58.52%), Query Frame = -2
Query:  204 KFFKNL----KSGANKKEEPFEISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIFMKDYEEKH-EKFLG------------NKENYEDKDETGE---------------------PRDNGLKPVAEEK-------TPPEIVETENQKKLETNTSTP--------VKRKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPK--AKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1499
            +F++++    K+   K++E  EIS P++ +  +HV FD  T +F G+P+ W +LL  ++ +K E+ K+P  + + + F    +  + +K++             N  N +   ET                       PR    K V           TP   V T      E NT+ P         ++KK KMSD E    L  IV+  +P  KY   E++G GASGTV  A    TG +VAIK MNL +QP ++LI+ EI VM++ ++PNIVNY++S+L+ +  ELWVV+EYL GG+LTDVVTET MD G IA+V +ECL ALEFLH N +IHRDIKSDN+LLG  G VK+TDFGFCAQ+    S+R TMVGTPYWMAPEVV R   Y  K+DIWSLGIM IEM++GEPPY++E PL+A+Y I T G P  +   K+      FL+ CLE+D   R SA+ LL+H FLK  K L ++   I AA
Sbjct:   53 RFYRSILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNTLNVKTVSETPAVPPVSEDEDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGD--ELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKA-YGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAA 536          
BLAST of SMED30035597 vs. Ensembl Mouse
Match: Pak1 (p21 (RAC1) activated kinase 1 [Source:MGI Symbol;Acc:MGI:1339975])

HSP 1 Score: 368.237 bits (944), Expect = 2.617e-121
Identity = 210/487 (43.12%), Postives = 285/487 (58.52%), Query Frame = -2
Query:  204 KFFKNL----KSGANKKEEPFEISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIFMKDYEEKH-EKFLG------------NKENYEDKDETGE---------------------PRDNGLKPVAEEK-------TPPEIVETENQKKLETNTSTP--------VKRKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPK--AKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1499
            +F++++    K+   K++E  EIS P++ +  +HV FD  T +F G+P+ W +LL  ++ +K E+ K+P  + + + F    +  + +K++             N  N +   ET                       PR    K V           TP   V T      E NT+ P         ++KK KMSD E    L  IV+  +P  KY   E++G GASGTV  A    TG +VAIK MNL +QP ++LI+ EI VM++ ++PNIVNY++S+L+ +  ELWVV+EYL GG+LTDVVTET MD G IA+V +ECL ALEFLH N +IHRDIKSDN+LLG  G VK+TDFGFCAQ+    S+R TMVGTPYWMAPEVV R   Y  K+DIWSLGIM IEM++GEPPY++E PL+A+Y I T G P  +   K+      FL+ CLE+D   R SA+ LL+H FLK  K L ++   I AA
Sbjct:   53 RFYRSILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNTLNVKTVSETPAVPPVSEDEDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGD--ELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKA-YGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAA 536          
BLAST of SMED30035597 vs. Ensembl Mouse
Match: Pak2 (p21 (RAC1) activated kinase 2 [Source:MGI Symbol;Acc:MGI:1339984])

HSP 1 Score: 357.451 bits (916), Expect = 2.172e-117
Identity = 204/448 (45.54%), Postives = 275/448 (61.38%), Query Frame = -2
Query:  204 EISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIFMKDYEEKHEKFLGNKENYEDKDETGEPRDN--GLKPVA---------EEKTPPEIV-ETENQKKLETNT-----STPV--------------KRKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPK--AKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1448
            EIS P++ +  +HV FD  T +F G+P+ W +LL  ++ +K E+ K+P  + + + F  D     +K+L      +D   +G P  N  G +  A         E+  PP I    ++ K + T +       PV              ++KK KM+D E    L  IV+  +P  KY   E++G GASGTV  AT    G +VAIK +NL KQP ++LI+ EI VMK+ ++PNIVN+++S+L+ +  EL+VV+EYL GG+LTDVVTET MD   IA+V +ECL ALEFLH N +IHRDIKSDNVLLG  G VK+TDFGFCAQ+    S+R TMVGTPYWMAPEVV R   Y  K+DIWSLGIM IEM++GEPPY++E PL+A+Y I T G P  +   K+      FL+ CLE+D   R SA+ LL+H FLK  K L ++   I AA
Sbjct:   73 EISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVLDVLKFY-DSNTVKQKYLSFTPPEKDGFPSGTPALNTKGSETSAVVTEEDDDDEDAAPPVIAPRPDHTKSIYTRSVIDPIPAPVGDSNVDSGAKSSDKQKKKAKMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSYLVGD--ELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKA-YGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLILAA 516          
BLAST of SMED30035597 vs. Ensembl Mouse
Match: Pak3 (p21 (RAC1) activated kinase 3 [Source:MGI Symbol;Acc:MGI:1339656])

HSP 1 Score: 340.502 bits (872), Expect = 1.794e-110
Identity = 175/324 (54.01%), Postives = 224/324 (69.14%), Query Frame = -2
Query:  204 EEKTPPEIVETENQKKLETNTSTPVKRKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPK--AKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1169
            +E  PP   E  N   L  NT    +RKK+KM+D E    L  IV+  +P  KY   E++G GASGTV  A    TG +VAIK MNL +QP ++LI+ EI VM++ ++PNIVNY++S+L+ +  ELWVV+EYL GG+LTDVVTET MD G IA+V +ECL AL+FLH N +IHRDIKSDN+LLG  G VK+TDFGFCAQ+    S+R TMVGTPYWMAPEVV R   Y  K+DIWSLGIM IEM++GEPPY++E PL+A+Y I T G P  +   ++      FL+ CLE+D + R SA+ LL+H FLK  K L ++   I AA
Sbjct:  218 KEDIPPS-AENANSTTLYRNTDR--QRKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGD--ELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKA-YGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLKLAKPLSSLTPLIIAA 535          

HSP 2 Score: 52.373 bits (124), Expect = 1.035e-6
Identity = 23/68 (33.82%), Postives = 42/68 (61.76%), Query Frame = -2
Query: 1278 KSGANKKEEPFEISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIF 1481
            K+   K++E  EIS P++ +  +HV FD  T +F G+P+ W +LL  ++ +K E+ K+P  + + + F
Sbjct:   58 KTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGIPEQWARLLQTSNITKLEQKKNPQAVLDVLKF 125          
BLAST of SMED30035597 vs. Ensembl Mouse
Match: Pak3 (p21 (RAC1) activated kinase 3 [Source:MGI Symbol;Acc:MGI:1339656])

HSP 1 Score: 340.502 bits (872), Expect = 1.794e-110
Identity = 175/324 (54.01%), Postives = 224/324 (69.14%), Query Frame = -2
Query:  204 EEKTPPEIVETENQKKLETNTSTPVKRKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPK--AKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1169
            +E  PP   E  N   L  NT    +RKK+KM+D E    L  IV+  +P  KY   E++G GASGTV  A    TG +VAIK MNL +QP ++LI+ EI VM++ ++PNIVNY++S+L+ +  ELWVV+EYL GG+LTDVVTET MD G IA+V +ECL AL+FLH N +IHRDIKSDN+LLG  G VK+TDFGFCAQ+    S+R TMVGTPYWMAPEVV R   Y  K+DIWSLGIM IEM++GEPPY++E PL+A+Y I T G P  +   ++      FL+ CLE+D + R SA+ LL+H FLK  K L ++   I AA
Sbjct:  218 KEDIPPS-AENANSTTLYRNTDR--QRKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGD--ELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKA-YGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLKLAKPLSSLTPLIIAA 535          

HSP 2 Score: 52.373 bits (124), Expect = 1.035e-6
Identity = 23/68 (33.82%), Postives = 42/68 (61.76%), Query Frame = -2
Query: 1278 KSGANKKEEPFEISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIF 1481
            K+   K++E  EIS P++ +  +HV FD  T +F G+P+ W +LL  ++ +K E+ K+P  + + + F
Sbjct:   58 KTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGIPEQWARLLQTSNITKLEQKKNPQAVLDVLKF 125          
BLAST of SMED30035597 vs. UniProt/SwissProt
Match: sp|P35465|PAK1_RAT (Serine/threonine-protein kinase PAK 1 OS=Rattus norvegicus OX=10116 GN=Pak1 PE=1 SV=3)

HSP 1 Score: 369.007 bits (946), Expect = 1.045e-120
Identity = 212/487 (43.53%), Postives = 286/487 (58.73%), Query Frame = -2
Query:  204 KFFKNLKSG--ANKKEEP--FEISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIFMKDYEEKH-EKFLG------------NKENYEDKDETGE---------------------PRDNGLKPVAEEK-------TPPEIVETENQKKLETNTSTP--------VKRKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPK--AKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1499
            +F++++ +G   NKK+E    EIS P++ +  +HV FD  T +F G+P+ W +LL  ++ +K E+ K+P  + + + F    +  + +K++             N  N +   ET                       PR    K V           TP   V T      E NT+ P         ++KK KMSD E    L  IV+  +P  KY   E++G GASGTV  A    TG +VAIK MNL +QP ++LI+ EI VM++ ++PNIVNY++S+L+ +  ELWVV+EYL GG+LTDVVTET MD G IA+V +ECL ALEFLH N +IHRDIKSDN+LLG  G VK+TDFGFCAQ+    S+R TMVGTPYWMAPEVV R   Y  K+DIWSLGIM IEM++GEPPY++E PL+A+Y I T G P  +   K+      FL+ CLE+D   R SA+ LL+H FLK  K L ++   I AA
Sbjct:   53 RFYRSILAGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNTLNVKTVSETPAVPPVSEDEDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGD--ELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKA-YGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAA 536          
BLAST of SMED30035597 vs. UniProt/SwissProt
Match: sp|Q13153|PAK1_HUMAN (Serine/threonine-protein kinase PAK 1 OS=Homo sapiens OX=9606 GN=PAK1 PE=1 SV=2)

HSP 1 Score: 368.237 bits (944), Expect = 2.124e-120
Identity = 212/492 (43.09%), Postives = 287/492 (58.33%), Query Frame = -2
Query:  204 KFFKNL----KSGANKKEEPFEISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIFMKDYEEKHEKFLGNKENYEDKDETGEPRDNGL--KPVAE----------------EKTPPEI---------------------------VETENQKKLETNTSTP--------VKRKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRP---SPKAKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1499
            +F++++    K+   K++E  EIS P++ +  +HV FD  T +F G+P+ W +LL  ++ +K E+ K+P  + + + F   Y  K         ++ DK        N L  K V+E                + TPP +                           V T      E NT+ P         ++KK KMSD E    L  IV+  +P  KY   E++G GASGTV  A    TG +VAIK MNL +QP ++LI+ EI VM++ ++PNIVNY++S+L+ +  ELWVV+EYL GG+LTDVVTET MD G IA+V +ECL ALEFLH N +IHRDIKSDN+LLG  G VK+TDFGFCAQ+    S+R TMVGTPYWMAPEVV R   Y  K+DIWSLGIM IEM++GEPPY++E PL+A+Y I T G P   +P+ K+      FL+ CLE+D   R SA+ LL+H FLK  K L ++   I AA
Sbjct:   53 RFYRSILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEF---YNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGD--ELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKA-YGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPE-KLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAA 537          
BLAST of SMED30035597 vs. UniProt/SwissProt
Match: sp|Q08E52|PAK1_BOVIN (Serine/threonine-protein kinase PAK 1 OS=Bos taurus OX=9913 GN=PAK1 PE=1 SV=1)

HSP 1 Score: 367.466 bits (942), Expect = 4.882e-120
Identity = 211/488 (43.24%), Postives = 286/488 (58.61%), Query Frame = -2
Query:  204 KFFKNL----KSGANKKEEPFEISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIFMKDYEEKH-EKFLG------------NKENYEDKDETGE---------------------PRDNGLKPVAEEK-------TPPEIVETENQKKLETNTSTP--------VKRKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRP---SPKAKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1499
            +F++ +    K+   K++E  EIS P++ +  +HV FD  T +F G+P+ W +LL  ++ +K E+ K+P  + + + F    +  + +K++             N  N +   ET                       PR    K V           TP   V T      E NT+ P         ++KK KMSD E    L  IV+  +P  KY   E++G GASGTV  A    TG +VAIK MNL +QP ++LI+ EI VM++ ++PNIVNY++S+L+ +  ELWVV+EYL GG+LTDVVTET MD G IA+V +ECL ALEFLH N +IHRDIKSDN+LLG  G VK+TDFGFCAQ+    S+R TMVGTPYWMAPEVV R   Y  K+DIWSLGIM IEM++GEPPY++E PL+A+Y I T G P   +P+ K+      FL+ CLE+D   R SA+ LL+H FLK  K L ++   I AA
Sbjct:   53 RFYRAILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNTLNVKAVSETPAVPPVSEDEDDDDDGTPPPVIAPRPEHTKSVYTRSVIEPLPITPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGD--ELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKA-YGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPE-KLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAA 536          
BLAST of SMED30035597 vs. UniProt/SwissProt
Match: sp|O88643|PAK1_MOUSE (Serine/threonine-protein kinase PAK 1 OS=Mus musculus OX=10090 GN=Pak1 PE=1 SV=1)

HSP 1 Score: 365.155 bits (936), Expect = 3.011e-119
Identity = 211/488 (43.24%), Postives = 280/488 (57.38%), Query Frame = -2
Query:  204 KFFKNLKSG--ANKKEEP--FEISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIFMKDYEEKHEKFL-------------GNKENYEDKDETGE----------------------PRDNGLKPVAEEK-------TPPEIVETENQKKLETNTSTP--------VKRKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPK--AKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1499
            +F++++  G   NKK E    EIS P++ +  +HV FD  T +F G+P+ W +LL  ++ +K E+ K+P  + + + F    +  + K                N  N +   ET                        PR    K V           TP   V T      E NT+ P         ++KK KMSD E    L  IV+  +P  KY   E++G GASGTV  A    TG +VAIK MNL +QP ++LI+ EI VM++ ++PNIVNY++S+L+ +  ELWVV+EYL GG+LTDVVTET MD G IA+V +ECL ALEFLH N +IHRDIKSDN+LLG  G VK+TDFGFCAQ+    S+R TMVGTPYWMAPEVV R   Y  K+DIWSLGIM IEM++GEPPY++E PL+A+Y I T G P  +   K+      FL  CLE+D   R SA+ LL+H FLK  K L ++   + AA
Sbjct:   53 RFYRSILPGDKTNKKREKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSKKYMSFTDKSAEDYNSSNTLNVKTVSETPAVPPVSEDDEDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTPFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGD--ELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKA-YGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLQCCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLMHAA 537          
BLAST of SMED30035597 vs. UniProt/SwissProt
Match: sp|Q13177|PAK2_HUMAN (Serine/threonine-protein kinase PAK 2 OS=Homo sapiens OX=9606 GN=PAK2 PE=1 SV=3)

HSP 1 Score: 358.992 bits (920), Expect = 5.006e-117
Identity = 202/448 (45.09%), Postives = 271/448 (60.49%), Query Frame = -2
Query:  204 EISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIFMKDYEEKHEKFLGNKENYEDKDETGEPRDNGLKPVAEE-----------KTPPEIV-ETENQKKLETNT-----STPV--------------KRKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPK--AKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1448
            EIS P++ +  +HV FD  T +F G+P+ W +LL  ++ +K E+ K+P  + + + F  D     +K+L      +D   +G P  N     A               PP I    ++ K + T +       PV              ++KK KM+D E    L  IV+  +P  KY   E++G GASGTV  AT    G +VAIK +NL KQP ++LI+ EI VMK+ ++PNIVN+++S+L+ +  EL+VV+EYL GG+LTDVVTET MD   IA+V +ECL ALEFLH N +IHRDIKSDNVLLG  G VK+TDFGFCAQ+    S+R TMVGTPYWMAPEVV R   Y  K+DIWSLGIM IEM++GEPPY++E PL+A+Y I T G P  +   K+      FL+ CLE+D   R SA+ LL+H FLK  K L ++   I AA
Sbjct:   73 EISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVLDVLKFY-DSNTVKQKYLSFTPPEKDGFPSGTPALNAKGTEAPAVVTEEEDDDEETAPPVIAPRPDHTKSIYTRSVIDPVPAPVGDSHVDGAAKSLDKQKKKTKMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSYLVGD--ELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKA-YGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAA 516          
BLAST of SMED30035597 vs. TrEMBL
Match: A0A0X3PTP0 (Serine/threonine-protein kinase PAK 3 OS=Schistocephalus solidus OX=70667 GN=PAK3 PE=4 SV=1)

HSP 1 Score: 485.337 bits (1248), Expect = 3.588e-164
Identity = 266/508 (52.36%), Postives = 337/508 (66.34%), Query Frame = -2
Query:  204 MLKFFKNLKSGANKKEEPFEISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIFMKDYE-----EKHEKFL---------GNKENYEDKD----ETGEPRDNGLKPVAEEKTPPE------------------------IVETENQKKLETNTS----------------TPV---------------KRKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPKAK-VDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1505
            M+K F++L+     K    EIS PTNV+K +HVT+DP T +F G+PDYWK+L++ A+FS+EEKT HP EI NAV   K YE     +K +KFL         G ++ +E K+    E G+P        +E   PPE                        +V T  + +L  +TS                 PV               +R K KM+D EF+ AL++I+T  +P +KY ++E+LG+GASGTVRLA + +T   VAIKIMNL KQPNRDLI++EI+VM+ T+H NIVNYIESFL+ +  ELWVV+E+LDGG LTDVVTETIM+  LIA+VVKE L AL FLH+ NIIHRDIKSDN+LLGKSG+VK+TDFGFCAQLGSR S+RQT+VG+PYWMAPEVVN++VQY  KIDIWSLGIMIIEMLDGEPPY++ETPLKAIY IQT  RP PK + VD  L+ FL  CL+++P  R +A  LL+H FLK  KSL  + A I+AA
Sbjct:    1 MMKPFRHLRQRWTDKTI-TEISMPTNVEKMIHVTYDPVTGEFCGMPDYWKELINGANFSQEEKTNHPKEIINAV---KTYEVTLKNQKSDKFLGVSVGSIPDGEEDEHERKNASTSENGKPEHESTG--SESSIPPEAPRPTLLEVAGNSPRSTKTGRALPVVHTNPKNQLPKSTSDKDIASESNPPDAFKKQPVPNTNTELKVQAPAVRRRAKKKMTDAEFFEALEKIITTGDPHEKYVMDEKLGSGASGTVRLARSVQTNEPVAIKIMNLSKQPNRDLIISEIQVMEHTRHENIVNYIESFLLRDKNELWVVMEFLDGGPLTDVVTETIMETPLIAAVVKEVLKALAFLHQANIIHRDIKSDNILLGKSGRVKLTDFGFCAQLGSRLSKRQTIVGSPYWMAPEVVNKSVQYGPKIDIWSLGIMIIEMLDGEPPYLNETPLKAIYLIQTHDRPEPKTEGVDPSLKDFLDRCLQVNPEKRAAAAELLEHPFLKNTKSLAGLQALIEAA 502          
BLAST of SMED30035597 vs. TrEMBL
Match: A0A5K3EIT4 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 469.159 bits (1206), Expect = 5.877e-158
Identity = 255/498 (51.20%), Postives = 319/498 (64.06%), Query Frame = -2
Query:  204 LKFFKNLKSGANKKEEPF-EISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVI----FMKDYEEKHEKFLGNKENYEDKD------------ETGEPRDNG-----------------LKPV-----------AEEKTPPEIVETENQKK-------LETNTSTPV------------KRKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPKA-KVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1502
            +K F   +   N+K+    EIS PT+V+K +HV FDP T  F+G+P YW++L+ QA+FS EE+  HP EI NA      F+K  E   +  + +  + +D D            E G+P  +                  L  V           +E  +P E    + QKK       L+     PV            +R K KM+D EF+ AL +I++  NPLDKY L   LG+GASGTVR A  K T   VAIKIMNL KQPNRDLI++EI+VM+ T+H NIVNY+ES+L+ +D ELWVV+EYLDGG LTDVVTET+M+  LIA+VVKECL A+ FLHE NIIHRDIKSDN+LLGKSG+VK+TDFGFCAQ+GSR S+RQTMVGTPYWMAPEVVN+ V+Y  KIDIWSLGIMIIEMLDGEPPY++E PLKAIY IQT  RP PK+ +V   +  FL  CL++DP  R SA  LL H FLK+ K L  + A I+AA
Sbjct:    1 MKPFSRFRQRWNEKQGNISEISMPTSVEKLIHVEFDPATGKFMGMPAYWQELISQANFSDEEQRNHPAEIINACQTHDNFIKQQEHNEKFLVASGSSLDDLDESDRKLSDLSGTENGKPGHSSTGSESSNVPDASSPQSLLAKVMTGSNFQKNQQSETSSPAEPTSGDTQKKTYKPLPVLKQPAEAPVVQNEKAKDAYVRRRNKKKMTDEEFFDALSKIISSGNPLDKYCLESVLGSGASGTVRRAHNKITNEPVAIKIMNLAKQPNRDLIISEIQVMEHTRHENIVNYVESYLLRDDGELWVVMEYLDGGPLTDVVTETVMETPLIAAVVKECLKAIHFLHEKNIIHRDIKSDNILLGKSGRVKLTDFGFCAQMGSRHSKRQTMVGTPYWMAPEVVNKAVKYGPKIDIWSLGIMIIEMLDGEPPYLNEPPLKAIYLIQTHERPEPKSTEVSPLMRDFLDKCLQVDPEKRASAAELLLHPFLKETKPLAGLCALIEAA 498          
BLAST of SMED30035597 vs. TrEMBL
Match: A0A564YIV2 (Protein kinase domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS6262 PE=3 SV=1)

HSP 1 Score: 468.389 bits (1204), Expect = 9.790e-158
Identity = 260/486 (53.50%), Postives = 326/486 (67.08%), Query Frame = -2
Query:  204 MLKFFKNLKSGANKKEEPFEISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVI----FMKDYEEKHEKFLG-NKENYEDKDE------TGEPRDNG--------------LKPVAEEKTPPEIVETE-NQKKLETNTST-----PV--------------------KRKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPKA-KVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1505
            M  F +  +  ++K+    EIS PTNV K +HV FDP+T  F GLP+ W++L+ QA+F+ EE+  H  EI +A      FMK  +E +EKFLG +  + +D DE      TG   +NG                PV+ +    +++ TE N+ K   N ++     PV                    +R K KM+D EF+ AL  I++  +PLDKY L   LG+GASGTVR A  KET   VAIKIMNL KQPNRDLI++EI+VM+ T+H NIVNYIESFL+ ++ ELWVV+EYLDGG LTDVVTET+M+  LIA+VVKECL A+ FLHE NIIHRDIKSDN+LLGKSG+VK+TDFGFCAQ+GSR S+RQTMVGTPYWMAPEVVN+ V+Y  KIDIWSLGIMIIEMLDGEPPY++E PLKAIY+IQT+ RP PK+ +V   +  FL  CL+IDP  R SA  LLKH FL   K L  + A I+AA
Sbjct:    1 MKPFSRIRQRWSDKQSNISEISLPTNVAKLIHVEFDPKTKTFKGLPETWQELIAQANFTTEEQISHQAEIISACQTHDKFMKQ-QEHNEKFLGVSGSSLDDLDESNRKLSTGSGLENGNVDHNSTGSESSSLQDPVSPQSLLAKLMNTEINKDKHSDNFNSNKHAKPVPLVKPPIPPTPATEKTAQVRRRIKKKMTDFEFFDALAYIISTGDPLDKYCLESVLGSGASGTVRRAHNKETKEPVAIKIMNLSKQPNRDLIISEIQVMEHTRHENIVNYIESFLLKDEDELWVVMEYLDGGPLTDVVTETVMEGPLIAAVVKECLKAIHFLHEKNIIHRDIKSDNILLGKSGRVKLTDFGFCAQMGSRQSKRQTMVGTPYWMAPEVVNKAVKYGPKIDIWSLGIMIIEMLDGEPPYLNEPPLKAIYHIQTQERPEPKSTEVSPLMRDFLDRCLQIDPEKRASAAELLKHPFLLDTKPLSGLCALIEAA 485          
BLAST of SMED30035597 vs. TrEMBL
Match: A0A158R6P8 (Protein kinase domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS646 PE=3 SV=1)

HSP 1 Score: 465.692 bits (1197), Expect = 1.170e-156
Identity = 256/492 (52.03%), Postives = 313/492 (63.62%), Query Frame = -2
Query:  204 LKFFKNLKSGANKKEEPF-EISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVI----FMKDYEE-------------------------------KHE----------------------KFLGNKENYEDKDETGEPRDNGLKPVAEEKTPPEIVETENQKKLETNTSTPVKRKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPKA-KVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1502
            +K F  ++   N+K+    EIS PT+V+K +HV FDP T  F G+PD W++L+ QA+F+ EE+  H  EI +A      F+K  E                                KHE                      + + N +  + K   G      LKP A  K PP    T  +K        P++RK  +M+D EFY AL +IV+  +PLDKY L   LG+GASGTVR AT K T   VAIKIMNL KQPNRDLI++EI+VM+ T+H NIVNYIESFL+  + ELWVV+EYLDGG LTDVVTETIM+  LIA+VVKECL A+ FLHE NIIHRDIKSDN+LLGKSG+VK+TDFGFCAQLGSR S+RQTMVGTPYWMAPEVVN++V+Y  KIDIWSLGIMIIEMLDGEPPY++E PLKAIY IQT+ RP PK+ +V   L  FL  CL++DP  R +A  LLKH FL   K L  + A I AA
Sbjct:    1 MKPFSRIRQRWNEKQCNISEISMPTSVEKLLHVEFDPVTKKFKGMPDAWQELISQANFTDEERICHHKEIIDACQVHDNFIKQQEHNEKFIRVSGSSLDDLDDSDRKLSDGSGIENGKHEHNSTGSESSNNPDHSSSQVLLSRLMMNSDRSKSKAVEGHAPAKPLKPSASLK-PPLAQPTPPEK----CKDAPLRRKTKRMNDAEFYEALSKIVSPGDPLDKYTLEAVLGSGASGTVRRATRKATNEPVAIKIMNLSKQPNRDLIISEIQVMEHTRHENIVNYIESFLMRNEDELWVVMEYLDGGPLTDVVTETIMEQPLIAAVVKECLKAINFLHEKNIIHRDIKSDNILLGKSGRVKLTDFGFCAQLGSRQSKRQTMVGTPYWMAPEVVNKSVKYGPKIDIWSLGIMIIEMLDGEPPYLNEPPLKAIYLIQTRERPEPKSTEVGPMLRDFLDRCLQVDPEQRATAAELLKHPFLSDTKPLSGLGALIKAA 487          
BLAST of SMED30035597 vs. TrEMBL
Match: A0A0R3X8P4 (Protein kinase domain-containing protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS9904 PE=3 SV=1)

HSP 1 Score: 464.922 bits (1195), Expect = 2.060e-156
Identity = 248/469 (52.88%), Postives = 305/469 (65.03%), Query Frame = -2
Query:  204 EISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVI----FMKDYEEKHEKFLGN--------------------------KENYEDKDETGEPR----------------------DNGLKPVAEEKTPPEIVETENQKKL-ETNTSTPVKRKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPKA-KVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1448
            EIS PT+V+K +HV +DP T  F G+P+ W++L+ Q++F+ EE+  HP EI NA      F+K  +E +EKFLG                           + N    D +  P                        +GL P    K    I  +  Q  + E     P++RK  KM+D EFY AL +I++  +PLDKY L   LG+GASGTVR A  K T   VAIKIMNL KQPNRDLI++EI+VM+ T+H NIVNYIESFL+  + ELWVV+EYLDGG LTDVVTETIM+  LIA+VVKECL A+ FLHE NIIHRDIKSDN+LLGKSG VK+TDFGFCAQ+GSR S+RQTMVGTPYWMAPEVVN++V+Y  KIDIWSLGIMIIEMLDGEPPY++E PLKAIY IQT+ RP PK+ +V   L  FL  CL++DP  R +A  LL H FL   K L  ++A I AA
Sbjct:   20 EISMPTSVEKLLHVEYDPVTKKFKGMPEAWQELISQSNFTDEEQICHPEEIINACQTHDKFIKQ-QEHNEKFLGVSGSSLDDLDDSDRKLSDGSGIENGKLEHNSTGSDSSNNPDATSAQTLLAKVMMNSERNKPKVADGLAPTNPLKPSSSIKPSVAQTAVPEKAKDAPLRRKAKKMTDPEFYEALSKIISPGDPLDKYSLETVLGSGASGTVRRARCKATNEPVAIKIMNLSKQPNRDLIISEIQVMEHTRHENIVNYIESFLMRNEDELWVVMEYLDGGPLTDVVTETIMETPLIAAVVKECLKAINFLHEKNIIHRDIKSDNILLGKSGHVKLTDFGFCAQMGSRQSKRQTMVGTPYWMAPEVVNKSVKYGPKIDIWSLGIMIIEMLDGEPPYLNEPPLKAIYLIQTRERPEPKSTEVSPLLRDFLDKCLQVDPEKRATAAELLNHPFLSDTKPLSGLSALIKAA 487          
BLAST of SMED30035597 vs. Ensembl Cavefish
Match: pak2a (p21 protein (Cdc42/Rac)-activated kinase 2a [Source:ZFIN;Acc:ZDB-GENE-021011-2])

HSP 1 Score: 365.155 bits (936), Expect = 3.130e-119
Identity = 206/449 (45.88%), Postives = 274/449 (61.02%), Query Frame = -2
Query:  204 EISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIFMKDYEEKHEKFLGNKENYEDKD-----ETGEPRDNGLK---PVAEEKTPPEIV--ETENQKKLETNTST----PV-----------------KRKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRP---SPKAKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1448
            EIS P++ +  +HV FD  T +F G+P+ W +LL  ++ +K E+ K+P  + + + F        +K+L    ++ DKD     +  EP   G K      ++  PP IV    E+ K + T  S     P+                 K  K KM+D E    L  IV+  +P  KY   E++G GASGTV  A    TG +VAIK +NL KQP ++LI+ EI VMK+ ++PNIVN+++SFL+ E  EL+VV+EYL GG+LTDVVTET MD   IA+V +ECL ALEFLH N +IHRDIKSDNVLLG  G VK+TDFGFCAQ+    S+R TMVGTPYWMAPEVV R   Y  K+DIWSLGIM IEM++GEPPY++E PL+A+Y I T G P   +P+ K+      FL+ CLE+D   R   + LL+H FLK  K L ++   I AA
Sbjct:  164 EISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLKFYDSTGNGKQKYL----SFTDKDAPPAMKGSEPSPGGAKEFDDQDDDDAPPPIVAPRPEHTKSVLTRPSMIDPLPLPAASADSDASRAADRQKKNPKGKMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTAIDVATGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSFLVGE--ELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKA-YGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPE-KLSPIFRDFLNRCLEMDVEKRGGGKELLQHPFLKLAKPLSSLTPLILAA 604          
BLAST of SMED30035597 vs. Ensembl Cavefish
Match: pak1 (p21 protein (Cdc42/Rac)-activated kinase 1 [Source:ZFIN;Acc:ZDB-GENE-030826-29])

HSP 1 Score: 351.288 bits (900), Expect = 4.438e-115
Identity = 208/479 (43.42%), Postives = 278/479 (58.04%), Query Frame = -2
Query:  204 KFFKNLKSGANKKEEPFEISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIFMKDYE----EKHEKFLGNKENYEDKDET---GEPRDNGLKPVAE--------------EKTPPEIV--ETENQKKLETN--------------TSTPV--------KRKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPK--AKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1499
            +  +++ +GANKK+E  EIS P++ +  +HV FD  T +F G+P+ W +LL  ++ +K E+ K+P  + + + F    E    +K+  F G  EN+     +     P  N  K V+E              E  PP ++    E+ K + T+              T TP         K +K KMSD E    L  IV+  +P  KY   E++G GASGTV  A    TG +VAIK MNL +QP ++LI+ EI VM++ + P +V            ELWVV+EYL GG+LTDVVTET MD   IA+V +ECL ALEFLH N +IHRDIKSDN+LLG  G VK+TDFGFCAQ+    S+R TMVGTPYWMAPEVV R   Y  K+DIWSLGIM IEM++GEPPY++E PL+A+Y I T G P  +   K+      FL+ CLE+D   R SA+ LL+H FLK  K L ++   I AA
Sbjct:   52 RSIRSILTGANKKKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSKETANSQKYMSFTG--ENFTPHFLSVFFPRPLQNS-KTVSETPAVATVSEDEDENEAAPPPVIAPRPEHTKSVSTSYIYISLTHINGGSPTPTPSSTAPRSADKTRKKKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAIDIATGQEVAIKQMNLQQQPKKELIINEILVMRENK-PYLVG----------DELWVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKA-YGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSSVFRDFLNRCLEMDVEKRGSAKELLQHQFLKVAKPLSSLTPLILAA 515          
BLAST of SMED30035597 vs. Ensembl Cavefish
Match: pak2b (p21 protein (Cdc42/Rac)-activated kinase 2b [Source:ZFIN;Acc:ZDB-GENE-030131-3759])

HSP 1 Score: 344.739 bits (883), Expect = 6.703e-113
Identity = 190/405 (46.91%), Postives = 256/405 (63.21%), Query Frame = -2
Query:  204 GLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIFMKDYEEKHEKFLG--NKENYEDKDET---------GEPRDNGLKPVAEEKTPPEIVETENQKKLETNTSTPVKRKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRP---SPKAKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1376
            G+P+ W +LL  ++ +K E+ K+P  + + + F        +K+L   + E +  +++          G  R    + V +   PP +  T+    + +  +   K KK KM+D E    L  IV+  +P  KY   E++G GASGTV  A    TG +VAIK +NL KQP ++LI+ EI VMK+ ++PNIVN+++SFL+ E  EL+VV+EYL GG+LTDVVTET MD   IA+V +ECL ALEFLH N +IHRDIKSDNVLLG  G VK+TDFGFCAQ+    S+R TMVGTPYWMAPEVV R   Y  K+DIWSLGIM IEM++GEPPY++E PL+A+Y I T G P   SP+ K+      FL  CLE+D   R S++ LL+H FLK  K L ++   I AA
Sbjct:   84 GMPEQWARLLQTSNITKYEQKKNPQAVLDVLKFYDSTGNGRQKYLSFSSGELFVSREKVRETVYLSVGGNFRYANTRSVLDP-IPPPVCTTDGD--VASKAADKQKPKKGKMTDEEIMDKLRTIVSIGDPKKKYTRYEKIGQGASGTVYTAIDVATGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSFLVGE--ELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKA-YGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQSPE-KLSPIFRDFLARCLEMDVEKRGSSKELLQHPFLKLAKPLSSLTPLILAA 481          
BLAST of SMED30035597 vs. Ensembl Cavefish
Match: pak1 (p21 protein (Cdc42/Rac)-activated kinase 1 [Source:ZFIN;Acc:ZDB-GENE-030826-29])

HSP 1 Score: 339.347 bits (869), Expect = 9.454e-111
Identity = 198/451 (43.90%), Postives = 262/451 (58.09%), Query Frame = -2
Query:  204 NKKEEPFEISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIFMKDYE----EKHEKFLGNKENYEDKDETGEPRDNGLKPVAEEKTPPEIV--ETENQKKLET----------NTSTP---------VKRKKNKMSDNEFYAA--LDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPK--AKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1469
            NKK+E  EIS P++ +  +HV FD  T +F G+P+ W +LL  ++ +K E+ K+P  + + + F    E    +K+  F G  EN+ D+DE              E  PP ++    E+ K + T          N S P                 SD    +   +  IV+  +P  KY   E++G GASGTV  A    TG +VAIK MNL +QP ++LI+ EI VM++ + P +V            ELWVV+EYL GG+LTDVVTET MD   IA+V +ECL ALEFLH N +IHRDIKSDN+LLG  G VK+TDFGFCAQ+    S+R TMVGTPYWMAPEVV R   Y  K+DIWSLGIM IEM++GEPPY++E PL+A+Y I T G P  +   K+      FL+ CLE+D   R SA+ LL+H FLK  K L ++   I AA
Sbjct:   66 NKKKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSKETANSQKYMSFTG--ENFTDEDEN-------------EAAPPPVIAPRPEHTKSVSTSYIYISLTHINLSPPPCCPTCISYSLILLLLFSDCLCVSCVFIGSIVSVGDPKKKYTRFEKIGQGASGTVYTAIDIATGQEVAIKQMNLQQQPKKELIINEILVMRENK-PYLVG----------DELWVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKA-YGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSSVFRDFLNRCLEMDVEKRGSAKELLQHQFLKVAKPLSSLTPLILAA 489          
BLAST of SMED30035597 vs. Ensembl Cavefish
Match: pak2a (p21 protein (Cdc42/Rac)-activated kinase 2a [Source:ZFIN;Acc:ZDB-GENE-021011-2])

HSP 1 Score: 322.013 bits (824), Expect = 5.143e-104
Identity = 203/495 (41.01%), Postives = 271/495 (54.75%), Query Frame = -2
Query:  204 LFSLLNYFGSYFFMLKFFKNLKSGANKKEEPFEISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIFMKDYEEKHEKFLGNKENYEDKD-----ETGEPRDNGLK---PVAEEKTPPEIV--ETENQKKLETNTST----PV-----------------KRKKNKMSDNEFYAALDEIV---TKENPLDKYELNE------------RLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPK--AKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1544
            LF L     +    L F    K   +K E P EIS P++ +  +HV FD  T +F G+P+ W +LL  ++ +K E+ K+P  + + + F        +K+L    ++ DKD     +  EP   G K      ++  PP IV    E+ K + T  S     P+                 K  K KM+D E    L  IV   T+        + E                     V +        +VAIK +NL KQP ++LI+ EI VMK+ ++PNIVN+++SFL+ E  EL+VV+EYL GG+LTDVVTET MD   IA+V +ECL ALEFLH N +IHRDIKSDNVLLG  G VK+TDFGFCAQ+    S+R TMVGTPYWMAPEVV R   Y  K+DIWSLGIM IEM++GEPPY++E PL+A+Y I T G P  +   K+      FL+ CLE+D   R   + LL+H FLK  K L ++   I AA
Sbjct:    3 LFKLTLLISTPSLSLSFLGGRKKDKDK-ERP-EISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLKFYDSTGNGKQKYL----SFTDKDAPPAMKGSEPSPGGAKEFDDQDDDDAPPPIVAPRPEHTKSVLTRPSMIDPLPLPAASADSDASRAADRQKKNPKGKMTDEEIMEKLRTIVKEHTESRCTCAMTIKEFVLCVCVWCVCVCGVCVCVCCVCVCVRVRVRVQVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSFLVGE--ELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKA-YGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGGGKELLQHPFLKLAKPLSSLTPLILAA 488          
BLAST of SMED30035597 vs. Ensembl Sea Lamprey
Match: pak4 (p21 protein (Cdc42/Rac)-activated kinase 4 [Source:ZFIN;Acc:ZDB-GENE-040704-69])

HSP 1 Score: 267.314 bits (682), Expect = 1.212e-81
Identity = 130/291 (44.67%), Postives = 192/291 (65.98%), Query Frame = -2
Query:  225 RKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPK--AKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTI 1091
            R+  ++S  +F AAL ++V   +P +  E   ++G G++G V LA  + +G +VA+K M+L KQ  R+L+  E+ +M++  H N+V+   S+L+ +  ELWVV+E+L+GGALTD+VT T M+   IA+V    L AL +LH   +IHRDIKSD++LL   G++K++DFGFCAQ+    +RR+++VGTPYWMAPEV++R + Y  ++D+WSLGIM+IEM+DGEPPY +E PL+A+  I+    P  K   K    L  FL   L  DP LR +A  LL+H FL+       I
Sbjct:  392 REPPRISHEQFRAALQQVVDPGDPSEYLENFIKIGEGSTGVVCLAVDRRSGRQVAVKKMHLRKQQRRELLFNEVVIMREYHHENVVDMYNSYLVAD--ELWVVMEFLEGGALTDIVTHTRMNEEQIATVCVSVLRALAYLHGQGVIHRDIKSDSILLTADGRIKLSDFGFCAQVSKEVTRRKSLVGTPYWMAPEVISR-LPYGPEVDVWSLGIMVIEMVDGEPPYFNEPPLQAMRRIRDNVPPKMKNIQKASPLLRGFLDQMLVRDPALRATALELLQHPFLQNAGPPACI 679          
BLAST of SMED30035597 vs. Ensembl Sea Lamprey
Match: stk25a (serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-GENE-041010-92])

HSP 1 Score: 184.496 bits (467), Expect = 6.798e-53
Identity = 98/263 (37.26%), Postives = 151/263 (57.41%), Query Frame = -2
Query:  246 NPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILT-EIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIK--SDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPKAKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQ 1025
            +P + +   ER+G G+ G V       T   VAIKI++L +  +    +  EI V+ Q   P + +Y  S+L  +  +LW+++EYL GG+  D++    ++   IA++++E L  L++LH    IHRDIK  + NVLL + G VK+ DFG   QL     +R T VGTP+WMAPEV+ ++  YD K DIWSLGI  IE+  GEPP  +  P++ ++ I     P+ +       + F+  CL  DP  R +A+ LLKH F+++
Sbjct:   21 DPEELFTKQERIGKGSFGEVFKGIDNRTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTHYFGSYL--KGTKLWIIMEYLGGGSALDLIKPGPLEEHQIATILREILKGLDYLHSERKIHRDIKGPAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSA-YDFKADIWSLGITAIELAKGEPPNSELHPMRVLFLIPKNNPPTLEGNYSKAFKEFVDSCLNKDPQFRPTAKELLKHKFIQR 280          
BLAST of SMED30035597 vs. Ensembl Sea Lamprey
Match: MAP4K3 (mitogen-activated protein kinase kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6865])

HSP 1 Score: 184.111 bits (466), Expect = 2.597e-50
Identity = 99/272 (36.40%), Postives = 157/272 (57.72%), Query Frame = -2
Query:  246 VTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDV--VTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEV--VNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPKAKVDGDLESFLHDCLEI----DPNLRKSAESLLKHDFLKQ 1037
            +++    + +EL ERLG+G  G V  A   +TG  VAIKI+ L    +  +I  EI +MK+ +H NIV Y  S+L     +LW+ +E+  GG+L D+  VT  + +   IA V +E L  L +LH    +HRDIK  N+LL   G VK+ DFG  AQ+ +  ++R++ +GTPYWMAPEV  V R   Y+ + D+W++GI  IE+ + +PP  D  P++A++ +   G   PK +         H+ +++    +P  R +AE +L H +++Q
Sbjct:    5 ISRRTLQEDFELAERLGSGTYGDVHKARNVQTGELVAIKIIKLEPGDDFSVIQQEIVMMKECKHTNIVAYYGSYL--RHDKLWICMEHCGGGSLQDIYHVTGPLTERQ-IAYVTRETLQGLAYLHSEGKMHRDIKGANILLTDDGDVKLADFGVSAQITATIAKRKSFIGTPYWMAPEVAAVERKGGYNHQCDVWAVGITAIELAELQPPMFDLHPMRALFLMSKSGFQPPKLRDKQKWSPVFHNFIKMALTKNPKKRPTAEKMLTHSYVQQ 273          
BLAST of SMED30035597 vs. Ensembl Sea Lamprey
Match: myo3a (myosin IIIA [Source:ZFIN;Acc:ZDB-GENE-041026-4])

HSP 1 Score: 174.481 bits (441), Expect = 9.106e-47
Identity = 101/282 (35.82%), Postives = 156/282 (55.32%), Query Frame = -2
Query:  246 ENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIM---NLLKQPNRDL---ILTEIKVMKQT-QHPNIVNYIESFLI---MEDKELWVVIEYLDGGALTDVVTETI-----MDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQ----YDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPKAK--VDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQ 1028
            ++P D +EL E +G G  G V  AT+++ G+K A+K +   N L+  N+D+   I  E  ++    +HPNIV +   +     +   +LW+V+E  +GG++TD+V   +     MD  LIA +++  L  L  LH +NIIHRDIK +N+LL   G +++ DFG  AQ+      R T VGTP+WMAPEV+    Q    YD + D+WS+GI  IE+ DG+PP  +  P++A++ I     P+ K           F+  CL  D   R +   LL+  F++Q
Sbjct:   18 KDPSDTWELVETIGKGTYGKVYKATSRKDGSKAAVKTLDPVNNLETSNQDIDEEIEAEYSILTSLPEHPNIVRFFGMYYQKDGVNGDQLWIVLELCNGGSVTDLVKGQLKRGERMDVMLIAYILRGALLGLNHLHSHNIIHRDIKGNNILLTTDGGIRLVDFGVSAQVSKTRVERNTAVGTPFWMAPEVIACEQQLDYMYDRRCDVWSMGITAIELGDGDPPLYELHPMRALFKIPRNPPPTLKQPELWPPLFNEFIAQCLVKDFERRATVSQLLEDPFIQQ 299          
BLAST of SMED30035597 vs. Ensembl Sea Lamprey
Match: slka (STE20-like kinase a [Source:ZFIN;Acc:ZDB-GENE-050411-66])

HSP 1 Score: 174.096 bits (440), Expect = 1.303e-46
Identity = 104/291 (35.74%), Postives = 154/291 (52.92%), Query Frame = -2
Query:  204 DEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGL----IASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVV----NRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPK--AKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1046
            D +    +P + + +   LG GA G V  A  KE+G   A K++    +   +  + EI+++    HPNIV  + +F    + +LW+ IE+  GGA+  ++ E  ++ GL    I  V K+ L AL +LH + IIHRD+K+ N+LL   G VK+ DFG  A+      RR + +GTPYWMAPEVV     +   YD K DIWSLGI +IE+   EPP  +  P++ +  I     PS    +K   +   FL  CL+ +P  R +A  LL+H F+    S K +   I  A
Sbjct:   21 DHVRRDVDPAELWSVIGELGDGAFGKVYKAQNKESGVLAAAKVIETKSEEELEDYMVEIEILALCDHPNIVGLLNAFYY--ENKLWIFIEFCPGGAVDAIMLE--LERGLAEPQIRVVCKQMLEALNYLHTHRIIHRDLKAGNILLTFEGDVKLADFGVSAKNTRTLQRRDSFIGTPYWMAPEVVMCETMKDAPYDYKADIWSLGITLIELAQMEPPNHELNPMRVMLKIAKNDPPSLSFPSKWSAEFTDFLKKCLDKNPETRWNALQLLQHSFISGVDSNKPLRELIAEA 307          
BLAST of SMED30035597 vs. Ensembl Yeast
Match: STE20 (Cdc42p-activated signal transducing kinase; involved in pheromone response, pseudohyphal/invasive growth, vacuole inheritance, down-regulation of sterol uptake; GBB motif binds Ste4p; member of the PAK (p21-activated kinase) family [Source:SGD;Acc:S000000999])

HSP 1 Score: 293.123 bits (749), Expect = 1.769e-89
Identity = 143/275 (52.00%), Postives = 192/275 (69.82%), Query Frame = -2
Query:  246 EFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPK--AKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQ 1064
            + YA L+EI +  +P  KY    ++G GASG V  A    T   VAIK MNL KQP ++LI+ EI VMK ++HPNIVN+I+S+++  D  LWV++EY++GG+LTDVVT  I+  G I +V +E L+ LEFLH   ++HRDIKSDN+LL   G +K+TDFGFCAQ+     +R TMVGTPYWMAPEVV+R  +Y  K+DIWSLGIMIIEM++GEPPY++ETPL+A+Y I T G P  K    +   L+ FL  CL ++P  R SA  LL  +++ +
Sbjct:  602 QLYAKLNEICSDGDPSTKYANLVKIGQGASGGVYTAYEIGTNVSVAIKQMNLEKQPKKELIINEILVMKGSKHPNIVNFIDSYVLKGD--LWVIMEYMEGGSLTDVVTHCILTEGQIGAVCRETLSGLEFLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCAQINELNLKRTTMVGTPYWMAPEVVSRK-EYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPENLSSSLKKFLDWCLCVEPEDRASATELLHDEYITE 873          
BLAST of SMED30035597 vs. Ensembl Yeast
Match: CLA4 (Cdc42p-activated signal transducing kinase; member of the PAK (p21-activated kinase) family, along with Ste20p and Skm1p; involved in septin ring assembly, vacuole inheritance, cytokinesis, sterol uptake regulation; phosphorylates Cdc3p and Cdc10p; CLA4 has a paralog, SKM1, that arose from the whole genome duplication [Source:SGD;Acc:S000005242])

HSP 1 Score: 271.166 bits (692), Expect = 4.947e-82
Identity = 145/312 (46.47%), Postives = 195/312 (62.50%), Query Frame = -2
Query:  252 PVKRKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATA-------------------KETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVV--------TETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPKAKVDGDLE--SFLHDCLEIDPNLRKSAESLLKHDFL 1100
            P K  +  MS  E  + L ++    +P   +++ E+ G GASG+V LA                        G+KVAIK M L KQP ++LI+ EI VMK ++H NIVN++E++L  +D +LWVV+E+++GG+LTD++        + + +    IA +V+E    L+FLH+ +IIHRDIKSDNVLL    +VK+TDFGFCA+L  + S+R TMVGTPYWMAPEVV +  +YDEKID+WSLGIM IEML+GEPPY++E PLKA+Y I T G P  K      LE   FL  CL +D   R S E LL H F 
Sbjct:  516 PKKPARPTMSTAEIMSKLKKVTVNADPSQCFKVIEKAGQGASGSVYLAERTHIPTESNMIELINNDIDEPHVGDKVAIKQMVLSKQPRKELIVNEILVMKDSRHKNIVNFLEAYLRTDD-DLWVVMEFMEGGSLTDIIENSPTNDNSHSPLTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTRARVKITDFGFCARLTDKRSKRATMVGTPYWMAPEVV-KQREYDEKIDVWSLGIMTIEMLEGEPPYLNEDPLKALYLIATNGTPKLKHPESLSLEIKRFLSVCLCVDVRYRASTEELLHHGFF 825          

HSP 2 Score: 61.6178 bits (148), Expect = 2.028e-10
Identity = 31/82 (37.80%), Postives = 45/82 (54.88%), Query Frame = -2
Query: 1200 ISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIFMKDYEEKHEKFLGNKENYEDKDETGE 1445
            +S+PTN   KVHV FDPET  FVG+P  W+KLL  +  + E+   +   +   + F ++Y        GN  N  DK ++GE
Sbjct:  184 VSSPTNFTHKVHVGFDPETGSFVGMPTNWEKLLKHSRITGEDWNNNSAAVIQVLQFYQEYNGA-----GNPTNTLDKPQSGE 260          
BLAST of SMED30035597 vs. Ensembl Yeast
Match: SKM1 (Member of the PAK family of serine/threonine protein kinases; similar to Ste20p; involved in down-regulation of sterol uptake; proposed to be a downstream effector of Cdc42p during polarized growth; SKM1 has a paralog, CLA4, that arose from the whole genome duplication [Source:SGD;Acc:S000005473])

HSP 1 Score: 256.914 bits (655), Expect = 3.099e-78
Identity = 134/320 (41.88%), Postives = 189/320 (59.06%), Query Frame = -2
Query:  213 KNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLA-----------------TAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDN----------GLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPK--AKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASI 1085
            KN    NE    +  +    NP   ++L E+ G GASG V L+                   +  G +VAIK + L +QP + LI+ E+ VM  ++  NIVN++E+++I +D+ELWV++EY++GG LTD++      N            +A +VKE    L+FLH   IIHRDIKSDN+LL   G VK+TDFGFC +L  + S+R TMVGTPYWMAPE+VN+   YDEK+D+WSLGIM+IEM++GEPPY++E PLKA+Y I   G P  +    V    + FL  CL+++   R S   LL  +FL    S + +  S+
Sbjct:  335 KNNDDSNEIIMKMKTVAIDVNPRPYFQLVEKAGQGASGAVYLSKRIKLPQENDPRFLKSHCHRVVGERVAIKQIRLSEQPKKQLIMNELLVMNDSRQENIVNFLEAYII-DDEELWVIMEYMEGGCLTDILDAVARSNTGEHSSPLNENQMAYIVKETCQGLKFLHNKKIIHRDIKSDNILLNSQGLVKITDFGFCVELTEKRSKRATMVGTPYWMAPEIVNQK-GYDEKVDVWSLGIMLIEMIEGEPPYLNEDPLKALYLIANNGSPKLRHPESVSKQTKQFLDACLQVNVESRASVRKLLTFEFLSMACSPEQLKVSL 652          

HSP 2 Score: 58.5362 bits (140), Expect = 1.458e-9
Identity = 24/60 (40.00%), Postives = 39/60 (65.00%), Query Frame = -2
Query: 1266 ISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIFMKDY 1445
            +S+PTN   KVHV FDP+  +FVG+PD W KLL  ++ + ++  ++   +  A+ F +DY
Sbjct:  123 VSSPTNFTHKVHVGFDPKVGNFVGVPDSWAKLLQTSEITYDDWNRNSKAVIKALQFYEDY 182          
BLAST of SMED30035597 vs. Ensembl Yeast
Match: KIC1 (Protein kinase of the PAK/Ste20 family, required for cell integrity; physically interacts with Cdc31p (centrin), which is a component of the spindle pole body; part of the RAM network that regulates cellular polarity and morphogenesis [Source:SGD;Acc:S000001144])

HSP 1 Score: 183.341 bits (464), Expect = 5.080e-50
Identity = 105/266 (39.47%), Postives = 153/266 (57.52%), Query Frame = -2
Query:  228 YELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNR-DLILTEIKVMKQ-TQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPK---AKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKT 1010
            ++  E +G G  G V      +TG   AIK++NL    +  + +  EI+ +    Q  NI  Y  S+L  +D  LW+++E+  GG+L  ++    +D   I  +++E L AL+ +H++N+IHRDIK+ NVL+   G VK+ DFG  AQ+   + RRQTM GTPYWMAPEV+   V YD K+DIWSLGI   E+  G PPY D   L+A+  I  K +P P+         L+ F+  CL+ DP  R SA+ LLK  F++  K+  T
Sbjct:   23 FKRTEVIGRGKFGVVYKGYNVKTGRVYAIKVLNLDSDSDEVEDVQREIQFLASLKQISNITRYYGSYL--KDTSLWIIMEHCAGGSLRSLLRPGKIDEKYIGVIMRELLVALKCIHKDNVIHRDIKAANVLITNEGNVKLCDFGVAAQVNQTSLRRQTMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITTYEIATGNPPYCDVEALRAMQLI-IKSKP-PRLEDRSYSTSLKEFIALCLDEDPKERLSADDLLKSKFIRAHKATPT 284          
BLAST of SMED30035597 vs. Ensembl Yeast
Match: SPS1 (Putative protein serine/threonine kinase; localizes to the nucleus and cytoplasm; required for efficient spore packaging, prospore membrane development and closure and localization of enzymes involved in spore wall synthesis; interacts with and required for Ssp1p phosphorylation and turnover; member of the GCKIII subfamily of STE20 kinases; multiply phosphorylated on S/T residues; interacts with 14-3-3 proteins, Bmh1p and Bmh2p; expressed at the end of meiosis [Source:SGD;Acc:S000002931])

HSP 1 Score: 172.555 bits (436), Expect = 2.967e-48
Identity = 103/270 (38.15%), Postives = 150/270 (55.56%), Query Frame = -2
Query:  249 IVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNL-LKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGL----IASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQ-YDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPKAKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLK 1040
            I ++  P   Y +   +G G  G V  A  + T   VAIK++NL     + +L+  EI  + + + P I NYI + L  ED  +W+V+EY  GG+ +D++  + + NGL    ++ ++ E    L++LHE   IHRDIK+ N+LL + G VK+ DFG    + S T +R T VGTPYWMAPEVV   V  Y+EK DIWSLGI   E+L G PP     P+K + N+  +  P  +       + F+  CL   P  R SA +LL  +F+K
Sbjct:    8 IRSRTPPSKLYSIQSCIGRGNFGDVYKAVDRVTQEIVAIKVVNLEHSDEDIELLAQEIFFLAELKSPLITNYIATML--EDVSMWIVMEYCGGGSCSDLLKRSYV-NGLPEEKVSFIIHEVTLGLKYLHEQRKIHRDIKAANILLNEEGMVKLGDFGVSGHIRS-TLKRDTFVGTPYWMAPEVVCCEVDGYNEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGPFSDAAKDFVAGCLVKTPADRPSAYNLLSFEFVK 273          
BLAST of SMED30035597 vs. Ensembl Nematostella
Match: EDO33667 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRJ0])

HSP 1 Score: 383.259 bits (983), Expect = 3.092e-128
Identity = 213/457 (46.61%), Postives = 279/457 (61.05%), Query Frame = -2
Query:  204 LKFFKNLKSGANKKEEPFEISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIFMKDYEEKHE--KF--------------------LGNKENYEDKDETGEPRDNGLKPVAEEKTPPEIVETENQKKLETNTSTPVKRKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRP--SPKAKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1502
             + F N K+  NKK +P EIS PT  +  +HV FDP T +F G+P+ W +LL  ++ ++ E+ K+P  + + + F    ++K E  KF                    L   + Y  K  T     N +   A+    P   E    K          KRKK KMSD E  A L  IV+  +P  KY   E++G GASGTV  A    TG++VAIK MNL +QP ++LI+ EI VM++ +HPNIVNY++S+L+ E  ELWVV+EYL GG+LTDVVTET MD G IA+V +ECL ALEFLH N +IHRDIKSDN+LLG  GQVK+TDFGFCA +    ++R TMVGTPYWMAPEVV R  QY  ++D+WSLGIM IEM++GEPPY++E PL+A+Y I T G P  +   K+    + FL   LE+D   R SA  LL+H FLKQ K L ++   I AA
Sbjct:   43 FRLFPN-KTEYNKKNKP-EISYPTQFEHTIHVGFDPVTGEFTGMPEAWARLLQVSNITQAEQKKNPQAVLDVLNFYDSSKDKTEPTKFWTTVKPAYDLLFESYWLIRGLSCHQRYAKKTITEHGSSNSVNDDAQPPAIPSRPEHTKSKPSHGQVQARDKRKK-KMSDEEILARLRTIVSIGDPKKKYTKFEKIGQGASGTVYTAIEVATGHEVAIKQMNLSQQPKKELIINEILVMRENKHPNIVNYVDSYLVGE--ELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNGVIHRDIKSDNILLGMDGQVKLTDFGFCATITPEQNKRSTMVGTPYWMAPEVVTRK-QYGPRVDVWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELAHPEKLSPVFKDFLAQSLEMDVEKRSSARELLQHPFLKQAKPLASLVPLILAA 493          
BLAST of SMED30035597 vs. Ensembl Nematostella
Match: EDO45846 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRL1])

HSP 1 Score: 247.284 bits (630), Expect = 4.651e-78
Identity = 120/251 (47.81%), Postives = 172/251 (68.53%), Query Frame = -2
Query:  249 RLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPK--AKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLK 995
            ++G G++G V LAT K TG +VA+K M+L KQ  R+L+  E+ +M+   HPNIV    S L+ +  ELWVV+E+L+GG LTD+VT T +    +A V +  L AL FLH   +IHRDIKSD++LL  +G VK++DFGFCAQ+     RR+++VGTPYWMAPEV++R   Y  ++DIWSLGIM++EM+DGEPPY +E PL+A+  ++    P+ +   ++   L+SFL + L  DP  R +A  LL H F++
Sbjct:   34 KIGEGSTGIVCLATDKRTGRQVAVKKMDLKKQQRRELLFNEVVIMRDYPHPNIVEMYGSHLVGD--ELWVVMEFLEGGTLTDIVTHTNLSEEQVACVCRAVLKALTFLHSQGVIHRDIKSDSILLTSNGTVKLSDFGFCAQVTEDMPRRKSLVGTPYWMAPEVISRK-PYGTEVDIWSLGIMVLEMVDGEPPYFNEPPLQAMRKLRDLEPPTSRNPIQISPRLQSFLDNALIRDPLYRATAFELLNHPFIR 281          
BLAST of SMED30035597 vs. Ensembl Nematostella
Match: EDO42845 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0A9])

HSP 1 Score: 194.126 bits (492), Expect = 1.773e-57
Identity = 110/294 (37.41%), Postives = 171/294 (58.16%), Query Frame = -2
Query:  204 NEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDL--ILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDV--VTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPK--AKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1067
            NE     +E +T+  P + +++ E+LG G+ G+V  A  KE+G  VAIK + +    + DL  I+ EI +M+Q   P +V Y  S+   ++ +LW+V+EY   G+++D+  +    +    I  V+K  L  LE+LH    IHRDIK+ N+LL   G  K+ DFG   QL    ++R T++GTP+WMAPEV+   V YD   DIWSLGI  +EM +G+PPY D  P++AI+ I TK  P+ +   +   D + F+  CL  +P  R +A  LL+H F++  K +  +++ I  A
Sbjct:    6 NELRKLSEESLTRP-PEEVFDVLEKLGEGSYGSVFKAMHKESGQVVAIKQVPV----DTDLQEIIKEISMMQQCDSPYVVKYYGSYF--KNTDLWIVMEYCGAGSVSDLMKIRNKTLTEEEIKCVLKYTLKGLEYLHLRRKIHRDIKAGNILLNSEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQE-VGYDCLADIWSLGITAMEMAEGKPPYADIHPMRAIFMIPTKPPPTFRDPGQWSEDFKDFVSKCLVKNPEERATATELLQHSFIQGAKQISILSSMIQEA 291          
BLAST of SMED30035597 vs. Ensembl Nematostella
Match: EDO49047 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHW1])

HSP 1 Score: 187.963 bits (476), Expect = 2.743e-55
Identity = 104/275 (37.82%), Postives = 159/275 (57.82%), Query Frame = -2
Query:  234 VTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTET-IMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEV--VNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSP----KAKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSL 1037
            +++ NP   ++L E++G G  G V  A    TG+  A+K++ +    + +LI  EI +M+Q +H NI+NYI ++  M   +LW+ +EY  GG++ DV   T       I+ V  E L  L +LHE +++HRDIK  N+LL  +G+VK+ DFG  A++     +R++ +GTPYWMAPE+  V RT  YD K DIW++GI  IEM + +PP  D  P++A+Y I  K    P    K K   ++  F+   L  +P  R SA+ +L H F   C+ L
Sbjct:    9 ISRGNPDKVFDLIEKVGGGTYGDVFKARVIATGDLAAVKVVKVEPGDDFELIQQEIAMMQQCRHNNIINYIGAY--MRRDKLWIGMEYCGGGSIQDVYCVTGPCSETQISFVTVETLKGLAYLHEKSLMHRDIKGANILLTTNGEVKLADFGISARITETMKKRKSFIGTPYWMAPEMAAVERTGGYDLKCDIWAVGITAIEMAELQPPMFDLHPMRALYIIGKKSFIPPTLKEKDKWSNEMHHFIKVALIKNPKKRPSADKMLTHPFC--CRHL 279          
BLAST of SMED30035597 vs. Ensembl Nematostella
Match: EDO31934 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWI4])

HSP 1 Score: 184.882 bits (468), Expect = 3.184e-53
Identity = 100/265 (37.74%), Postives = 150/265 (56.60%), Query Frame = -2
Query:  240 KENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILT-EIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPKAKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCK 1031
            K +P   +   ER+G G+ G V       T   VAIKI++L +  +    +  EI V+ Q     +  Y  S+L  +  +LW+++EYL GG+  D++    ++   IA++++E L  L++LH    +HRDIK+ NVL+ ++G VK+ DFG   QL    ++R T VGTP+WMAPEV+ ++  YD K DIWSLGI  IE+  GEPP  D  P++ ++ I     P          + F+  CL  DPN R +A+ LLKH F+K  K
Sbjct:    4 KADPEKLFSKLERIGKGSFGEVFKGIDNRTNEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSLYVTKYHGSYL--KGTKLWIIMEYLGGGSALDLMKAGNIEEFYIATILREVLKGLDYLHTEKKLHRDIKAANVLMSETGDVKLADFGVAGQLTDTLNKRNTFVGTPFWMAPEVIKQSA-YDSKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNNPPELTGNFSKAFKEFVSLCLNKDPNDRPTAKELLKHRFIKTAK 265          
BLAST of SMED30035597 vs. Ensembl Medaka
Match: ENSORLT00000015480.2 (serine/threonine-protein kinase PAK 2 [Source:NCBI gene;Acc:101169249])

HSP 1 Score: 360.918 bits (925), Expect = 2.424e-119
Identity = 196/422 (46.45%), Postives = 269/422 (63.74%), Query Frame = -2
Query:  204 KEEPFEISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIFMKDYEEKHEKFLGNKENYEDKDETGEPRDNGLKPVAEEKTPPEIVETENQKKLETNTSTPVKRKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPK--AKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1463
            K+ P EIS+P++ +  +HV FD  T +F G+P+ W +LL  ++ SK E+ ++P  +   + F  D     +K++G+ + +           + + P+     PP   ++ +Q       +   K+K  KM+D E    L  IV+  +P  KY   E++G GASGTV  A    TG +VAIK +NL KQP ++LI+ EI VMK+ ++PNIVN+++SFL+ +  EL+VV+EYL GG+LTDVVTET MD   IA+V +E L ALEFLH N +IHRDIKSDNVLLG  G VK+TDFGFCAQ+    S+R TMVGTPYWMAPEVV R   Y  K+DIWSLGIM IEM++GEPPY++E PL+A+Y I T G P  +   K+    +SFL  CLE+D   R S + LL+H FLK  K L ++   I AA
Sbjct:   67 KDRP-EISSPSDFEHTIHVGFDSVTGEFTGMPEQWARLLQTSNISKLEQKQNPQTVLTILKFY-DSTSGKQKYIGSGQRF---GRLSVYTRSVINPI-----PPPDADSNSQ------AADKQKKKGGKMTDEEIMDKLRTIVSIGDPKKKYTRYEKIGQGASGTVYTAIDVSTGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFVDSFLVGD--ELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCREVLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKA-YGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPVFKSFLSRCLEMDVEKRGSGKELLQHPFLKIAKPLSSLTPLILAA 469          
BLAST of SMED30035597 vs. Ensembl Medaka
Match: pak2b (p21 (RAC1) activated kinase 2 [Source:NCBI gene;Acc:101167280])

HSP 1 Score: 356.295 bits (913), Expect = 8.467e-117
Identity = 207/476 (43.49%), Postives = 279/476 (58.61%), Query Frame = -2
Query:  204 FFKNLKSGANK---KEEPFEISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIFMKDYEEKHEKFLGNKENYEDKDETG--EPRDNGLKPVAEEKTPPEI-------------------VETENQKKLETNTST-PV------------------KRKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPK--AKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1496
            F    KSG  K   KE P EIS P++ +  +HV FD  T +F G+P+ W +LL  ++ +K E+ K+P  + + + F    +   +K+L    + +D    G   P   G +P +     P I                      E+ K + T +   P+                  ++KK+KM+D E    L  IV+  +P  KY   E++G GASGTV  A    TG +VAIK +NL KQP ++LI+ EI VMK+ ++PNIVN+++SFL+ +  EL+VV+EYL GG+LTDVVTET MD   IA+V +ECL ALEFLH N +IHRDIKSDNVLLG  G VK+TDFGFCAQ+    S+R TMVGTPYWMAPEVV R   Y  K+DIWSLGIM IEM++GEPPY++E PL+A+Y I T G P  +   K+      FL+ CLE+D   R   + LL+H FLK  K L ++   I AA
Sbjct:   58 FSGQEKSGRKKDRDKERP-EISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLKFYDSTDNGRQKYLSFSSSEKDAFTPGPQSPIKKGSEPSS-----PNIKDIDDDDEDDDEAPPPVVAPRPEHTKSVYTRSVIEPIPAASTGPDGDAASKAADRQKKKSKMTDEEIMDKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTAIDVATGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSFLMGD--ELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKA-YGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPVFRDFLNRCLEMDVEKRGGGKELLQHPFLKLAKPLSSLTPLILAA 524          
BLAST of SMED30035597 vs. Ensembl Medaka
Match: ENSORLT00000028689.1 (serine/threonine-protein kinase PAK 2 [Source:NCBI gene;Acc:101169249])

HSP 1 Score: 352.058 bits (902), Expect = 1.726e-115
Identity = 200/467 (42.83%), Postives = 276/467 (59.10%), Query Frame = -2
Query:  204 MLKFFKNLKSGANK---KEEPFEISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIFMKDYEEKHEKFLGNKENYE---DKDETGEPRDNGLKPVAEEKT-------------------------PPEIVETENQKKLETNTSTPVKRKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPK--AKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1505
            ++  F   K G  K   K+ P EIS+P++ +  +HV FD  T +F G+P+ W +LL  ++ SK E+ ++P  +   + F  D     +K++G+ ++ +    +     P    +    +                            PP   ++ +Q       +   K+K  KM+D E    L  IV+  +P  KY   E++G GASGTV  A    TG +VAIK +NL KQP ++LI+ EI VMK+ ++PNIVN+++SFL+ +  EL+VV+EYL GG+LTDVVTET MD   IA+V +E L ALEFLH N +IHRDIKSDNVLLG  G VK+TDFGFCAQ+    S+R TMVGTPYWMAPEVV R   Y  K+DIWSLGIM IEM++GEPPY++E PL+A+Y I T G P  +   K+    +SFL  CLE+D   R S + LL+H FLK  K L ++   I AA
Sbjct:   51 IISIFAPEKGGRKKDRDKDRP-EISSPSDFEHTIHVGFDSVTGEFTGMPEQWARLLQTSNISKLEQKQNPQTVLTILKFY-DSTSGKQKYIGSDKDSQLPGKQSTAASPSGKDVDDEDDGDDTPPPIVAPRPPNTISVYTRSVINPIPPPDADSNSQ------AADKQKKKGGKMTDEEIMDKLRTIVSIGDPKKKYTRYEKIGQGASGTVYTAIDVSTGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFVDSFLVGD--ELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCREVLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKA-YGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPVFKSFLSRCLEMDVEKRGSGKELLQHPFLKIAKPLSSLTPLILAA 506          
BLAST of SMED30035597 vs. Ensembl Medaka
Match: ENSORLT00000043480.1 (serine/threonine-protein kinase PAK 2 [Source:NCBI gene;Acc:101169249])

HSP 1 Score: 352.058 bits (902), Expect = 1.726e-115
Identity = 200/467 (42.83%), Postives = 276/467 (59.10%), Query Frame = -2
Query:  204 MLKFFKNLKSGANK---KEEPFEISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIFMKDYEEKHEKFLGNKENYE---DKDETGEPRDNGLKPVAEEKT-------------------------PPEIVETENQKKLETNTSTPVKRKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPK--AKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1505
            ++  F   K G  K   K+ P EIS+P++ +  +HV FD  T +F G+P+ W +LL  ++ SK E+ ++P  +   + F  D     +K++G+ ++ +    +     P    +    +                            PP   ++ +Q       +   K+K  KM+D E    L  IV+  +P  KY   E++G GASGTV  A    TG +VAIK +NL KQP ++LI+ EI VMK+ ++PNIVN+++SFL+ +  EL+VV+EYL GG+LTDVVTET MD   IA+V +E L ALEFLH N +IHRDIKSDNVLLG  G VK+TDFGFCAQ+    S+R TMVGTPYWMAPEVV R   Y  K+DIWSLGIM IEM++GEPPY++E PL+A+Y I T G P  +   K+    +SFL  CLE+D   R S + LL+H FLK  K L ++   I AA
Sbjct:   51 IISIFAPEKGGRKKDRDKDRP-EISSPSDFEHTIHVGFDSVTGEFTGMPEQWARLLQTSNISKLEQKQNPQTVLTILKFY-DSTSGKQKYIGSDKDSQLPGKQSTAASPSGKDVDDEDDGDDTPPPIVAPRPPNTISVYTRSVINPIPPPDADSNSQ------AADKQKKKGGKMTDEEIMDKLRTIVSIGDPKKKYTRYEKIGQGASGTVYTAIDVSTGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFVDSFLVGD--ELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCREVLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKA-YGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPVFKSFLSRCLEMDVEKRGSGKELLQHPFLKIAKPLSSLTPLILAA 506          
BLAST of SMED30035597 vs. Ensembl Medaka
Match: ENSORLT00000030173.1 (serine/threonine-protein kinase PAK 2 [Source:NCBI gene;Acc:101169249])

HSP 1 Score: 352.058 bits (902), Expect = 1.726e-115
Identity = 200/467 (42.83%), Postives = 276/467 (59.10%), Query Frame = -2
Query:  204 MLKFFKNLKSGANK---KEEPFEISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIFMKDYEEKHEKFLGNKENYE---DKDETGEPRDNGLKPVAEEKT-------------------------PPEIVETENQKKLETNTSTPVKRKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPK--AKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1505
            ++  F   K G  K   K+ P EIS+P++ +  +HV FD  T +F G+P+ W +LL  ++ SK E+ ++P  +   + F  D     +K++G+ ++ +    +     P    +    +                            PP   ++ +Q       +   K+K  KM+D E    L  IV+  +P  KY   E++G GASGTV  A    TG +VAIK +NL KQP ++LI+ EI VMK+ ++PNIVN+++SFL+ +  EL+VV+EYL GG+LTDVVTET MD   IA+V +E L ALEFLH N +IHRDIKSDNVLLG  G VK+TDFGFCAQ+    S+R TMVGTPYWMAPEVV R   Y  K+DIWSLGIM IEM++GEPPY++E PL+A+Y I T G P  +   K+    +SFL  CLE+D   R S + LL+H FLK  K L ++   I AA
Sbjct:   51 IISIFAPEKGGRKKDRDKDRP-EISSPSDFEHTIHVGFDSVTGEFTGMPEQWARLLQTSNISKLEQKQNPQTVLTILKFY-DSTSGKQKYIGSDKDSQLPGKQSTAASPSGKDVDDEDDGDDTPPPIVAPRPPNTISVYTRSVINPIPPPDADSNSQ------AADKQKKKGGKMTDEEIMDKLRTIVSIGDPKKKYTRYEKIGQGASGTVYTAIDVSTGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFVDSFLVGD--ELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCREVLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKA-YGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPVFKSFLSRCLEMDVEKRGSGKELLQHPFLKIAKPLSSLTPLILAA 506          
BLAST of SMED30035597 vs. Planmine SMEST
Match: SMESG000029469.1 (SMESG000029469.1)

HSP 1 Score: 892.878 bits (2306), Expect = 0.000e+0
Identity = 434/434 (100.00%), Postives = 434/434 (100.00%), Query Frame = -2
Query:  204 MLKFFKNLKSGANKKEEPFEISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIFMKDYEEKHEKFLGNKENYEDKDETGEPRDNGLKPVAEEKTPPEIVETENQKKLETNTSTPVKRKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPKAKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 1505
            MLKFFKNLKSGANKKEEPFEISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIFMKDYEEKHEKFLGNKENYEDKDETGEPRDNGLKPVAEEKTPPEIVETENQKKLETNTSTPVKRKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPKAKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA
Sbjct:    1 MLKFFKNLKSGANKKEEPFEISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIFMKDYEEKHEKFLGNKENYEDKDETGEPRDNGLKPVAEEKTPPEIVETENQKKLETNTSTPVKRKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPKAKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQCKSLKTIAASIDAA 434          
BLAST of SMED30035597 vs. Planmine SMEST
Match: SMESG000021793.1 (SMESG000021793.1)

HSP 1 Score: 337.806 bits (865), Expect = 6.248e-109
Identity = 164/285 (57.54%), Postives = 205/285 (71.93%), Query Frame = -2
Query:  243 RKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPKA--KVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQC 1091
            ++K +MSD +    +  IV+  +P+ KYEL ER+G GASG V       TG KVAIK MNL  QP ++L++ EI VMK   HPNIVNY++S+L+  D ELWVV+EYLDGG+LT+VVTET M+ G IA+V +ECL AL+FLHE  +IHRDIKSDN+LLG  G VK+ DFGFCAQL S   +R TMVGTPYWMAPEVV +  QY  K+DIWSLGIM IEM+DGEPPY++E PL+A+Y I T G+P  K   K+     SFL + L +D  +R SA  LL H F+KQC
Sbjct:  297 KRKARMSDEQISEKIRAIVSLGDPIRKYELKERIGQGASGIVNSGIEISTGKKVAIKQMNLKSQPKKELLINEIYVMKANHHPNIVNYLDSYLLPHD-ELWVVMEYLDGGSLTEVVTETYMEEGHIAAVSRECLQALKFLHERKVIHRDIKSDNILLGIDGSVKLIDFGFCAQLSSEQMKRSTMVGTPYWMAPEVVAKK-QYGPKVDIWSLGIMAIEMIDGEPPYLNENPLRALYLIATNGKPEIKERDKLSSLFISFLDNSLSVDVEMRSSAADLLVHPFIKQC 579          

HSP 2 Score: 54.299 bits (129), Expect = 1.881e-7
Identity = 25/68 (36.76%), Postives = 42/68 (61.76%), Query Frame = -2
Query: 1242 ISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIFMKDYEEKHEKFL 1445
            IS P +V  K+H+TF  ET +F G+P  W ++L+  + SK E+ ++PN + +A+ F  D     +KF+
Sbjct:   70 ISAPISVTHKLHITFCSETGEFTGMPPEWMRMLED-NISKVEQQQNPNAVVSALNFFADKNHTKDKFM 136          
BLAST of SMED30035597 vs. Planmine SMEST
Match: SMESG000021793.1 (SMESG000021793.1)

HSP 1 Score: 337.421 bits (864), Expect = 1.666e-108
Identity = 164/285 (57.54%), Postives = 205/285 (71.93%), Query Frame = -2
Query:  243 RKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPKA--KVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQC 1091
            ++K +MSD +    +  IV+  +P+ KYEL ER+G GASG V       TG KVAIK MNL  QP ++L++ EI VMK   HPNIVNY++S+L+  D ELWVV+EYLDGG+LT+VVTET M+ G IA+V +ECL AL+FLHE  +IHRDIKSDN+LLG  G VK+ DFGFCAQL S   +R TMVGTPYWMAPEVV +  QY  K+DIWSLGIM IEM+DGEPPY++E PL+A+Y I T G+P  K   K+     SFL + L +D  +R SA  LL H F+KQC
Sbjct:  315 KRKARMSDEQISEKIRAIVSLGDPIRKYELKERIGQGASGIVNSGIEISTGKKVAIKQMNLKSQPKKELLINEIYVMKANHHPNIVNYLDSYLLPHD-ELWVVMEYLDGGSLTEVVTETYMEEGHIAAVSRECLQALKFLHERKVIHRDIKSDNILLGIDGSVKLIDFGFCAQLSSEQMKRSTMVGTPYWMAPEVVAKK-QYGPKVDIWSLGIMAIEMIDGEPPYLNENPLRALYLIATNGKPEIKERDKLSSLFISFLDNSLSVDVEMRSSAADLLVHPFIKQC 597          

HSP 2 Score: 54.299 bits (129), Expect = 1.765e-7
Identity = 25/68 (36.76%), Postives = 42/68 (61.76%), Query Frame = -2
Query: 1242 ISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIFMKDYEEKHEKFL 1445
            IS P +V  K+H+TF  ET +F G+P  W ++L+  + SK E+ ++PN + +A+ F  D     +KF+
Sbjct:   88 ISAPISVTHKLHITFCSETGEFTGMPPEWMRMLED-NISKVEQQQNPNAVVSALNFFADKNHTKDKFM 154          
BLAST of SMED30035597 vs. Planmine SMEST
Match: SMESG000036933.1 (SMESG000036933.1)

HSP 1 Score: 333.954 bits (855), Expect = 4.779e-107
Identity = 164/294 (55.78%), Postives = 211/294 (71.77%), Query Frame = -2
Query:  246 ETNTSTPVKRKKN-KMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPK--AKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQ 1118
            E + S P  R K  K+SD E    L  +V+  +PL+KY L+E++G GASG V  +T K TG  +AIK M L  QP +DLI+ EI VM+  +HPNIVNY++SFL+ ++KELWVV+EYLDGG+LTDVVTE  M    IA+V +E L ALEFLH  ++IHRDIKSDN+LLG  GQVK+TDFGFCAQL +  ++R TMVGTPYWMAPEVV +  QY  K+D+WSLGIM +EMLDGEPPY++E P+KA+Y I T G+P  K    +  + + FL  CLE+D   R SA  LL H F+++
Sbjct:  323 EKSNSAPRTRSKPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKK-QYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQK 615          

HSP 2 Score: 50.447 bits (119), Expect = 3.114e-6
Identity = 24/69 (34.78%), Postives = 37/69 (53.62%), Query Frame = -2
Query: 1242 EISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEIYNAVIFMKDYEEKHEKFL 1448
            EIS PT V  ++HV FD +T    GLP  W  +L  ++ SK ++ K+P  I   +    D  +  +KF+
Sbjct:   65 EISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKSKQKFM 133          
BLAST of SMED30035597 vs. Planmine SMEST
Match: SMESG000009652.1 (SMESG000009652.1)

HSP 1 Score: 315.849 bits (808), Expect = 7.464e-104
Identity = 163/318 (51.26%), Postives = 212/318 (66.67%), Query Frame = -2
Query:  252 PRDNGLKPVAEEKTPPEIVETENQKKLETNTSTPVKRKKNKMSDNEFYAALDEIVTKENPLDKYELNERLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQHPNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKECLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQTMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLKAIYNIQTKGRPSPK--AKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFL 1199
            P  + + P  + K    I   ++Q + + +    ++R     S   F + L  +V+  +P  KYE+ +R+G GASG V      ET  KVAIK MNL +QP +DLIL EI V+K  +H NIVNY++SF++  + ELWVV+EYLDGG+LTDVVTE  MD   IA++ +E   AL FLH N++IHRDIKSDN+LLG  G VK+ DFGFCAQL    + R TMVGTPYWMAPEVV R  QY  K+D+WSLGIM+IEML+GEPPY++E PL+A+Y I T G+PS K    V      FL  CLE+D + R SA SLLKH+F+
Sbjct:    3 PTGDSVTPCDKSKDSVSIEINQSQNRCDRHQQ--LRRADRHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIM--NNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRK-QYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFI 315          
The following BLAST results are available for this feature:
BLAST of SMED30035597 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PAK14.422e-12143.09p21 (RAC1) activated kinase 1 [Source:HGNC Symbol;... [more]
PAK21.042e-11745.09p21 (RAC1) activated kinase 2 [Source:HGNC Symbol;... [more]
PAK12.436e-11643.01p21 (RAC1) activated kinase 1 [Source:HGNC Symbol;... [more]
PAK32.552e-11542.62p21 (RAC1) activated kinase 3 [Source:HGNC Symbol;... [more]
PAK32.991e-11542.62p21 (RAC1) activated kinase 3 [Source:HGNC Symbol;... [more]
back to top
BLAST of SMED30035597 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
max-21.552e-10653.72Serine/threonine-protein kinase max-2 [Source:Uni... [more]
max-25.380e-10553.90Serine/threonine-protein kinase max-2 [Source:Uni... [more]
max-25.461e-10553.90Serine/threonine-protein kinase max-2 [Source:Uni... [more]
max-21.685e-10453.90Serine/threonine-protein kinase max-2 [Source:Uni... [more]
max-21.972e-10453.90Serine/threonine-protein kinase max-2 [Source:Uni... [more]
back to top
BLAST of SMED30035597 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pak1.065e-10857.24gene:FBgn0267698 transcript:FBtr0334539[more]
Pak1.065e-10857.24gene:FBgn0267698 transcript:FBtr0081714[more]
Pak1.065e-10857.24gene:FBgn0267698 transcript:FBtr0081716[more]
Pak1.065e-10857.24gene:FBgn0267698 transcript:FBtr0081715[more]
Pak1.065e-10857.24gene:FBgn0267698 transcript:FBtr0334544[more]
back to top
BLAST of SMED30035597 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pak2a2.032e-12044.37p21 protein (Cdc42/Rac)-activated kinase 2a [Sourc... [more]
pak2a2.032e-12044.37p21 protein (Cdc42/Rac)-activated kinase 2a [Sourc... [more]
pak2a2.032e-12044.37p21 protein (Cdc42/Rac)-activated kinase 2a [Sourc... [more]
pak2a2.249e-11944.37p21 protein (Cdc42/Rac)-activated kinase 2a [Sourc... [more]
pak2b7.959e-11943.96p21 protein (Cdc42/Rac)-activated kinase 2b [Sourc... [more]
back to top
BLAST of SMED30035597 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
taf31.306e-12144.68TATA-box binding protein associated factor 3 [Sour... [more]
qsox22.243e-12044.30quiescin sulfhydryl oxidase 2 [Source:Xenbase;Acc:... [more]
qsox24.130e-11646.60quiescin sulfhydryl oxidase 2 [Source:Xenbase;Acc:... [more]
flii5.118e-11142.57FLII actin remodeling protein [Source:Xenbase;Acc:... [more]
flii7.089e-11153.33FLII actin remodeling protein [Source:Xenbase;Acc:... [more]
back to top
BLAST of SMED30035597 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pak12.617e-12143.12p21 (RAC1) activated kinase 1 [Source:MGI Symbol;A... [more]
Pak12.617e-12143.12p21 (RAC1) activated kinase 1 [Source:MGI Symbol;A... [more]
Pak22.172e-11745.54p21 (RAC1) activated kinase 2 [Source:MGI Symbol;A... [more]
Pak31.794e-11054.01p21 (RAC1) activated kinase 3 [Source:MGI Symbol;A... [more]
Pak31.794e-11054.01p21 (RAC1) activated kinase 3 [Source:MGI Symbol;A... [more]
back to top
BLAST of SMED30035597 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P35465|PAK1_RAT1.045e-12043.53Serine/threonine-protein kinase PAK 1 OS=Rattus no... [more]
sp|Q13153|PAK1_HUMAN2.124e-12043.09Serine/threonine-protein kinase PAK 1 OS=Homo sapi... [more]
sp|Q08E52|PAK1_BOVIN4.882e-12043.24Serine/threonine-protein kinase PAK 1 OS=Bos tauru... [more]
sp|O88643|PAK1_MOUSE3.011e-11943.24Serine/threonine-protein kinase PAK 1 OS=Mus muscu... [more]
sp|Q13177|PAK2_HUMAN5.006e-11745.09Serine/threonine-protein kinase PAK 2 OS=Homo sapi... [more]
back to top
BLAST of SMED30035597 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3PTP03.588e-16452.36Serine/threonine-protein kinase PAK 3 OS=Schistoce... [more]
A0A5K3EIT45.877e-15851.20Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A564YIV29.790e-15853.50Protein kinase domain-containing protein OS=Hymeno... [more]
A0A158R6P81.170e-15652.03Protein kinase domain-containing protein OS=Taenia... [more]
A0A0R3X8P42.060e-15652.88Protein kinase domain-containing protein OS=Hydati... [more]
back to top
BLAST of SMED30035597 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pak2a3.130e-11945.88p21 protein (Cdc42/Rac)-activated kinase 2a [Sourc... [more]
pak14.438e-11543.42p21 protein (Cdc42/Rac)-activated kinase 1 [Source... [more]
pak2b6.703e-11346.91p21 protein (Cdc42/Rac)-activated kinase 2b [Sourc... [more]
pak19.454e-11143.90p21 protein (Cdc42/Rac)-activated kinase 1 [Source... [more]
pak2a5.143e-10441.01p21 protein (Cdc42/Rac)-activated kinase 2a [Sourc... [more]
back to top
BLAST of SMED30035597 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pak41.212e-8144.67p21 protein (Cdc42/Rac)-activated kinase 4 [Source... [more]
stk25a6.798e-5337.26serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-G... [more]
MAP4K32.597e-5036.40mitogen-activated protein kinase kinase kinase kin... [more]
myo3a9.106e-4735.82myosin IIIA [Source:ZFIN;Acc:ZDB-GENE-041026-4][more]
slka1.303e-4635.74STE20-like kinase a [Source:ZFIN;Acc:ZDB-GENE-0504... [more]
back to top
BLAST of SMED30035597 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
STE201.769e-8952.00Cdc42p-activated signal transducing kinase; involv... [more]
CLA44.947e-8246.47Cdc42p-activated signal transducing kinase; member... [more]
SKM13.099e-7841.88Member of the PAK family of serine/threonine prote... [more]
KIC15.080e-5039.47Protein kinase of the PAK/Ste20 family, required f... [more]
SPS12.967e-4838.15Putative protein serine/threonine kinase; localize... [more]
back to top
BLAST of SMED30035597 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO336673.092e-12846.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458464.651e-7847.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428451.773e-5737.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490472.743e-5537.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO319343.184e-5337.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30035597 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000015480.22.424e-11946.45serine/threonine-protein kinase PAK 2 [Source:NCBI... [more]
pak2b8.467e-11743.49p21 (RAC1) activated kinase 2 [Source:NCBI gene;Ac... [more]
ENSORLT00000028689.11.726e-11542.83serine/threonine-protein kinase PAK 2 [Source:NCBI... [more]
ENSORLT00000043480.11.726e-11542.83serine/threonine-protein kinase PAK 2 [Source:NCBI... [more]
ENSORLT00000030173.11.726e-11542.83serine/threonine-protein kinase PAK 2 [Source:NCBI... [more]
back to top
BLAST of SMED30035597 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029469.10.000e+0100.00SMESG000029469.1[more]
SMESG000021793.16.248e-10957.54SMESG000021793.1[more]
SMESG000021793.11.666e-10857.54SMESG000021793.1[more]
SMESG000036933.14.779e-10755.78SMESG000036933.1[more]
SMESG000009652.17.464e-10451.26SMESG000009652.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035597 ID=SMED30035597|Name=SMED30035597|organism=Schmidtea mediterranea sexual|type=transcript|length=1605bp
GTACTATAACGTTTCTATTCTTTTTAATAATGTCCAAATATTTTTATAAA
AACAAGCTATCATTTATTTATTGTCAACCTTTAAAAAATTTATAAATATA
TTTGGACATTATTTGAAAGAATAGAAACGTTATAGTACAAATTATCATAA
TGATTATGTCTTGTAAAAAAATAATTTCAATGCTTCTTATTCAGATTTTT
CTTGGCCGCGTCAATAGAGGCTGCGATAGTTTTCAAAGATTTACATTGTT
TCAAAAAGTCATGCTTTAAAAGACTTTCTGCACTTTTTCTCAAATTTGGG
TCAATTTCCAAGCAATCATGGAGAAAGCTTTCCAAATCACCATCCACTTT
GGCTTTTGGAGACGGCCTGCCTTTCGTCTGGATGTTGTATATTGCTTTGA
GTGGCGTTTCATCCATATATGGAGGCTCACCGTCAAGCATCTCAATTATC
ATTATTCCCAGAGACCAAATATCGATTTTCTCATCATACTGCACAGTTCT
ATTAACAACTTCCGGTGCCATCCAGTATGGGGTGCCAACCATAGTTTGTC
TACGACTTGTTCGAGATCCAAGTTGGGCACAAAACCCAAAATCAGTCACT
TTTACCTGGCCACTCTTACCAAGCAATACATTGTCTGATTTAATATCACG
GTGAATAATGTTATTCTCATGGAGGAATTCCAAGGCATTCAGACACTCCT
TAACGACGGAGGCAATTAATCCATTGTCCATGATTGTTTCGGTGACGACA
TCAGTTAAAGCACCACCATCGAGGTATTCAATGACAACCCATAATTCTTT
GTCTTCCATAATTAGAAACGACTCAATATAATTCACAATATTCGGATGTT
GAGTTTGTTTCATCACCTTGATTTCAGTTAGAATCAAATCTCGATTTGGT
TGTTTCAGTAGATTCATGATTTTAATCGCGACTTTGTTACCAGTTTCTTT
GGCAGTGGCCAATCTAACTGTACCTGATGCACCAGCGCCTAATCTTTCGT
TTAATTCGTATTTGTCGAGTGGATTTTCTTTTGTGACAATTTCATCTAGA
GCTGCATAAAATTCGTTGTCTGACATTTTATTTTTCTTTCGCTTAACTGG
TGTGCTTGTATTTGTTTCAAGTTTTTTTTGATTTTCTGTTTCAACGATTT
CTGGTGGAGTTTTCTCTTCTGCAACTGGTTTTAAGCCATTATCACGGGGT
TCGCCAGTTTCATCTTTATCTTCATAATTTTCTTTGTTTCCCAAAAATTT
TTCGTGTTTTTCTTCATAATCTTTCATAAAAATTACAGCATTGTAAATTT
CATTAGGATGTTTAGTTTTTTCTTCTTTGCTAAAATCCGCTTGATCTAAC
AGTTTTTTCCAGTAATCTGGTAATCCAACAAAGTCACTGGTTTCTGGATC
AAATGTGACATGGACTTTCTTTTGTACGTTAGTGGGATTAGATATTTCAA
ATGGCTCTTCCTTCTTGTTAGCCCCACTTTTTAAATTTTTAAAGAACTTT
AACATGAAAAAATAACTTCCAAAGTAATTTAATAAACTAAAAAGTTTATT
TAAACAAACAACAAAAATTATTTGAAAAATTTTTAAATAATTCATTGACT
AAAGC
back to top

protein sequence of SMED30035597-orf-1

>SMED30035597-orf-1 ID=SMED30035597-orf-1|Name=SMED30035597-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=473bp
MNYLKIFQIIFVVCLNKLFSLLNYFGSYFFMLKFFKNLKSGANKKEEPFE
ISNPTNVQKKVHVTFDPETSDFVGLPDYWKKLLDQADFSKEEKTKHPNEI
YNAVIFMKDYEEKHEKFLGNKENYEDKDETGEPRDNGLKPVAEEKTPPEI
VETENQKKLETNTSTPVKRKKNKMSDNEFYAALDEIVTKENPLDKYELNE
RLGAGASGTVRLATAKETGNKVAIKIMNLLKQPNRDLILTEIKVMKQTQH
PNIVNYIESFLIMEDKELWVVIEYLDGGALTDVVTETIMDNGLIASVVKE
CLNALEFLHENNIIHRDIKSDNVLLGKSGQVKVTDFGFCAQLGSRTSRRQ
TMVGTPYWMAPEVVNRTVQYDEKIDIWSLGIMIIEMLDGEPPYMDETPLK
AIYNIQTKGRPSPKAKVDGDLESFLHDCLEIDPNLRKSAESLLKHDFLKQ
CKSLKTIAASIDAAKKNLNKKH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0002032epidermal cell
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036936CRIB_dom_sf
IPR033923PAK_BD
IPR000719Prot_kinase_dom
IPR000095CRIB_dom
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004674protein serine/threonine kinase activity
GO:0005524ATP binding
GO:0004672protein kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 107..127
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 275..472
e-value: 1.7E-64
score: 218.8
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 140..274
e-value: 1.2E-36
score: 128.3
NoneNo IPR availablePIRSFPIRSF000615TyrPK_CSF1-Rcoord: 294..444
e-value: 3.7E-11
score: 39.5
coord: 187..282
e-value: 0.0021
score: 13.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 119..156
NoneNo IPR availablePANTHERPTHR45832FAMILY NOT NAMEDcoord: 139..467
NoneNo IPR availablePANTHERPTHR45832:SF7coord: 139..467
coord: 45..147
NoneNo IPR availablePANTHERPTHR45832FAMILY NOT NAMEDcoord: 45..147
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 196..448
e-value: 6.5E-90
score: 314.7
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 196..448
e-value: 2.1E-67
score: 227.3
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 196..448
score: 50.732
IPR000095CRIB domainSMARTSM00285PBD_5coord: 51..86
e-value: 5.2E-7
score: 39.3
IPR000095CRIB domainPFAMPF00786PBDcoord: 50..106
e-value: 2.6E-15
score: 56.5
IPR036936CRIB domain superfamilyGENE3DG3DSA:3.90.810.10coord: 45..123
e-value: 2.0E-19
score: 71.6
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 313..325
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 202..225
IPR033923p21 activated kinase binding domainCDDcd01093CRIB_PAK_likecoord: 49..92
e-value: 4.03129E-14
score: 64.2135
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 188..453