Regulator of G-protein signaling 7

Overview
NameRegulator of G-protein signaling 7
Smed IDSMED30035596
Length (bp)2065
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Regulator of G-protein signaling 7 (SMED30035596) t-SNE clustered cells

Violin plots show distribution of expression levels for Regulator of G-protein signaling 7 (SMED30035596) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Regulator of G-protein signaling 7 (SMED30035596) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Regulator of G-protein signaling 7 (SMED30035596) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035596

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neoblastSMED30035596SMESG000072831.1 dd_Smed_v4_4578_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Human
Match: RGS7 (regulator of G protein signaling 7 [Source:HGNC Symbol;Acc:HGNC:10003])

HSP 1 Score: 271.937 bits (694), Expect = 4.982e-83
Identity = 132/280 (47.14%), Postives = 193/280 (68.93%), Query Frame = 1
Query:  412 NQSANEFIWRKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXNVILWSSIEG-----NTLSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFD 1236
            ++S N  ++RK+E +I RMQ+E  G+ IRTVKS +S +PSVF+G D+V W+IK+L  E+ +EA+H+G+++A+ GY FPI+DH L +K+D  + YRFQTP  +PS C E +N +YAVYLCKRTMQNK RLELAD+EAE LA LQ  +  KWEFI++QAEA+AKVDKKRDK+ER +L+SQE+ FWD +RP+ G  N  ++D++K  R + P K             S +     + E      + L +++   ++ L++ R+++SK  +SL SY + Y E+D
Sbjct:   16 DESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGSDIVQWLIKNLTIEDPVEALHLGTLMAAHGYFFPISDHVLTLKDDG-TFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPGCVNTTEVDIKKSSRMRNPHKTRKSVYGLQNDIRSHSPTHTPTPETKPPTEDELQQQIKYWQIQLDRHRLKMSKVADSLLSYTEQYLEYD 294          

HSP 2 Score: 156.377 bits (394), Expect = 1.684e-40
Identity = 74/156 (47.44%), Postives = 107/156 (68.59%), Query Frame = 1
Query: 1480 NPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKK 1947
            NPW+SD+  FW  E S KE S +RVK+W F + E LKDP GRE+  K+LE EFS+ENL+FW A ++LK  P++++  R++ I+ +FL+P A   +N+DSK  +     V       P R+ FE+A+EHI+KLM SDSY R++RS+ Y+EL+  +KK
Sbjct:  304 NPWLSDDTTFWELEAS-KEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENLRFWLAVEDLKKRPIKEVPSRVQEIWQEFLAPGAPSAINLDSKSYDKTTQNV-----KEPGRYTFEDAQEHIYKLMKSDSYPRFIRSSAYQELLQAKKK 453          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Human
Match: RGS7 (regulator of G protein signaling 7 [Source:HGNC Symbol;Acc:HGNC:10003])

HSP 1 Score: 272.322 bits (695), Expect = 6.087e-83
Identity = 132/280 (47.14%), Postives = 193/280 (68.93%), Query Frame = 1
Query:  412 NQSANEFIWRKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXNVILWSSIEG-----NTLSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFD 1236
            ++S N  ++RK+E +I RMQ+E  G+ IRTVKS +S +PSVF+G D+V W+IK+L  E+ +EA+H+G+++A+ GY FPI+DH L +K+D  + YRFQTP  +PS C E +N +YAVYLCKRTMQNK RLELAD+EAE LA LQ  +  KWEFI++QAEA+AKVDKKRDK+ER +L+SQE+ FWD +RP+ G  N  ++D++K  R + P K             S +     + E      + L +++   ++ L++ R+++SK  +SL SY + Y E+D
Sbjct:   16 DESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGSDIVQWLIKNLTIEDPVEALHLGTLMAAHGYFFPISDHVLTLKDDG-TFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPGCVNTTEVDIKKSSRMRNPHKTRKSVYGLQNDIRSHSPTHTPTPETKPPTEDELQQQIKYWQIQLDRHRLKMSKVADSLLSYTEQYLEYD 294          

HSP 2 Score: 156.377 bits (394), Expect = 1.971e-40
Identity = 74/156 (47.44%), Postives = 107/156 (68.59%), Query Frame = 1
Query: 1480 NPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKK 1947
            NPW+SD+  FW  E S KE S +RVK+W F + E LKDP GRE+  K+LE EFS+ENL+FW A ++LK  P++++  R++ I+ +FL+P A   +N+DSK  +     V       P R+ FE+A+EHI+KLM SDSY R++RS+ Y+EL+  +KK
Sbjct:  304 NPWLSDDTTFWELEAS-KEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENLRFWLAVEDLKKRPIKEVPSRVQEIWQEFLAPGAPSAINLDSKSYDKTTQNV-----KEPGRYTFEDAQEHIYKLMKSDSYPRFIRSSAYQELLQAKKK 453          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Human
Match: RGS7 (regulator of G protein signaling 7 [Source:HGNC Symbol;Acc:HGNC:10003])

HSP 1 Score: 270.781 bits (691), Expect = 1.311e-82
Identity = 132/280 (47.14%), Postives = 193/280 (68.93%), Query Frame = 1
Query:  412 NQSANEFIWRKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXNVILWSSIEG-----NTLSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFD 1236
            ++S N  ++RK+E +I RMQ+E  G+ IRTVKS +S +PSVF+G D+V W+IK+L  E+ +EA+H+G+++A+ GY FPI+DH L +K+D  + YRFQTP  +PS C E +N +YAVYLCKRTMQNK RLELAD+EAE LA LQ  +  KWEFI++QAEA+AKVDKKRDK+ER +L+SQE+ FWD +RP+ G  N  ++D++K  R + P K             S +     + E      + L +++   ++ L++ R+++SK  +SL SY + Y E+D
Sbjct:   16 DESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGSDIVQWLIKNLTIEDPVEALHLGTLMAAHGYFFPISDHVLTLKDDG-TFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPGCVNTTEVDIKKSSRMRNPHKTRKSVYGLQNDIRSHSPTHTPTPETKPPTEDELQQQIKYWQIQLDRHRLKMSKVADSLLSYTEQYLEYD 294          

HSP 2 Score: 155.606 bits (392), Expect = 2.870e-40
Identity = 74/156 (47.44%), Postives = 107/156 (68.59%), Query Frame = 1
Query: 1480 NPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKK 1947
            NPW+SD+  FW  E S KE S +RVK+W F + E LKDP GRE+  K+LE EFS+ENL+FW A ++LK  P++++  R++ I+ +FL+P A   +N+DSK  +     V       P R+ FE+A+EHI+KLM SDSY R++RS+ Y+EL+  +KK
Sbjct:  304 NPWLSDDTTFWELEAS-KEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENLRFWLAVEDLKKRPIKEVPSRVQEIWQEFLAPGAPSAINLDSKSYDKTTQNV-----KEPGRYTFEDAQEHIYKLMKSDSYPRFIRSSAYQELLQAKKK 453          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Human
Match: RGS6 (regulator of G protein signaling 6 [Source:HGNC Symbol;Acc:HGNC:10002])

HSP 1 Score: 256.914 bits (655), Expect = 2.552e-77
Identity = 129/280 (46.07%), Postives = 188/280 (67.14%), Query Frame = 1
Query:  418 SANEFIWRKIESIIERMQNEDTG-VQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXNV---ILWSSIEGNT---LSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFD 1236
            S N  ++ KIE II +MQ++ TG V IRTVKS +S +PSV TG D+V W++K+L  E+ +EAIH+GS+IA+ GY+FPI+DH L MK+D  + YRFQ P  +PS C E +N +YA+YLCKRTMQNK RLELAD+EAE LA LQ  +  KWEFI++QAEA+ K+D+K+DK ER +L+SQE+ FWD +RP+ G  N  ++D+RK CR  +  + + +S               +L   I   T   + +++  +   +++  +++SK  ESL +Y + Y E+D
Sbjct:   20 SPNMIVYCKIEDIITKMQDDKTGGVPIRTVKSFLSKIPSVVTGTDIVQWLMKNLSIEDPVEAIHLGSLIAAQGYIFPISDHVLTMKDDG-TFYRFQAPYFWPSNCWEPENTDYAIYLCKRTMQNKARLELADYEAENLARLQRAFARKWEFIFMQAEAQVKIDRKKDKTERKILDSQERAFWDVHRPVPGCVNTTEMDIRK-CRRLKNPQKVKKSVYGVTEESQAQSPVHVLSQPIRKTTKEDIRKQITFLNAQIDRHCLKMSKVAESLIAYTEQYVEYD 297          

HSP 2 Score: 157.918 bits (398), Expect = 4.993e-41
Identity = 74/156 (47.44%), Postives = 108/156 (69.23%), Query Frame = 1
Query: 1480 NPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKK 1947
            NPW+SD+   W  E+S KE S +RVK+W F+  E+LKD  GR++  ++LE EFS+ENL+FW A Q+LK  PL+D+ +R+E I+ +FL+P A   +N+DS   E  +  V +       R+ FE+A+EHI+KLM SDSY R+LRSN Y++L+  +KK
Sbjct:  307 NPWISDDVALWDIEMS-KEPSQQRVKRWGFSFDEILKDQVGRDQFLRFLESEFSSENLRFWLAVQDLKKQPLQDVAKRVEEIWQEFLAPGAPSAINLDSHSYEITSQNVKDGG-----RYTFEDAQEHIYKLMKSDSYARFLRSNAYQDLLLAKKK 456          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Human
Match: RGS6 (regulator of G protein signaling 6 [Source:HGNC Symbol;Acc:HGNC:10002])

HSP 1 Score: 256.529 bits (654), Expect = 2.997e-77
Identity = 129/280 (46.07%), Postives = 188/280 (67.14%), Query Frame = 1
Query:  418 SANEFIWRKIESIIERMQNEDTG-VQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXNV---ILWSSIEGNT---LSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFD 1236
            S N  ++ KIE II +MQ++ TG V IRTVKS +S +PSV TG D+V W++K+L  E+ +EAIH+GS+IA+ GY+FPI+DH L MK+D  + YRFQ P  +PS C E +N +YA+YLCKRTMQNK RLELAD+EAE LA LQ  +  KWEFI++QAEA+ K+D+K+DK ER +L+SQE+ FWD +RP+ G  N  ++D+RK CR  +  + + +S               +L   I   T   + +++  +   +++  +++SK  ESL +Y + Y E+D
Sbjct:   20 SPNMIVYCKIEDIITKMQDDKTGGVPIRTVKSFLSKIPSVVTGTDIVQWLMKNLSIEDPVEAIHLGSLIAAQGYIFPISDHVLTMKDDG-TFYRFQAPYFWPSNCWEPENTDYAIYLCKRTMQNKARLELADYEAENLARLQRAFARKWEFIFMQAEAQVKIDRKKDKTERKILDSQERAFWDVHRPVPGCVNTTEMDIRK-CRRLKNPQKVKKSVYGVTEESQAQSPVHVLSQPIRKTTKEDIRKQITFLNAQIDRHCLKMSKVAESLIAYTEQYVEYD 297          

HSP 2 Score: 157.918 bits (398), Expect = 4.261e-41
Identity = 74/156 (47.44%), Postives = 108/156 (69.23%), Query Frame = 1
Query: 1480 NPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKK 1947
            NPW+SD+   W  E+S KE S +RVK+W F+  E+LKD  GR++  ++LE EFS+ENL+FW A Q+LK  PL+D+ +R+E I+ +FL+P A   +N+DS   E  +  V +       R+ FE+A+EHI+KLM SDSY R+LRSN Y++L+  +KK
Sbjct:  307 NPWISDDVALWDIEMS-KEPSQQRVKRWGFSFDEILKDQVGRDQFLRFLESEFSSENLRFWLAVQDLKKQPLQDVAKRVEEIWQEFLAPGAPSAINLDSHSYEITSQNVKDGG-----RYTFEDAQEHIYKLMKSDSYARFLRSNAYQDLLLAKKK 456          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Celegans
Match: egl-10 (Regulator of G-protein signaling egl-10 [Source:UniProtKB/Swiss-Prot;Acc:P49809])

HSP 1 Score: 243.432 bits (620), Expect = 7.508e-72
Identity = 109/199 (54.77%), Postives = 147/199 (73.87%), Query Frame = 1
Query:  424 NEFIWRKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKL 1020
            N  ++RK+E ++ +M + + GV I+TVKS +S VPSVFTG DL+ WI+K+L   ++ +A+H+  +IAS GYLF I DH L +KND  + YRFQTP  +PS C + +N +YAVYLCKRTMQNK  LEL DFEAE LA LQ  +  KWEF+++QAEA+ KVDKKRD+ ER +L+SQE+ FWD +RP+ G  N  ++D RKL
Sbjct:   20 NHMVYRKMEMLVNQMLDAEAGVPIKTVKSFLSKVPSVFTGQDLIGWIMKNLEMTDLSDALHLAHLIASHGYLFQIDDHVLTVKNDG-TFYRFQTPYFWPSNCWDPENTDYAVYLCKRTMQNKAHLELEDFEAENLAKLQKMFSRKWEFVFMQAEAQYKVDKKRDRQERQILDSQERAFWDVHRPVPGCVNTTEVDFRKL 217          

HSP 2 Score: 138.658 bits (348), Expect = 2.545e-34
Identity = 69/165 (41.82%), Postives = 105/165 (63.64%), Query Frame = 1
Query: 1459 DMSTSAINPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFL-SPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKKK 1950
            D   S  NPW++D  +FW ++    ++ +RR+K W  + +ELL D  GRE +QK+L+KE+S ENL+FW   Q+L+    R +   +  IYN+F+ + +A  P+NVD KV E     V   +  NP+R+ F+EA +HI+ LM +DSY R+LRS IYK+L+   +KK
Sbjct:  384 DPFQSQPNPWINDTVDFWQHDKITGDIQTRRLKLWEDSFEELLADSLGRETLQKFLDKEYSGENLRFWWEVQKLRKCSSRMVPVMVTEIYNEFIDTNAATSPVNVDCKVME-----VTEDNLKNPNRWSFDEAADHIYCLMKNDSYQRFLRSEIYKDLVLQSRKK 543          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Celegans
Match: egl-10 (Regulator of G-protein signaling egl-10 [Source:UniProtKB/Swiss-Prot;Acc:P49809])

HSP 1 Score: 243.817 bits (621), Expect = 1.296e-71
Identity = 109/199 (54.77%), Postives = 147/199 (73.87%), Query Frame = 1
Query:  424 NEFIWRKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKL 1020
            N  ++RK+E ++ +M + + GV I+TVKS +S VPSVFTG DL+ WI+K+L   ++ +A+H+  +IAS GYLF I DH L +KND  + YRFQTP  +PS C + +N +YAVYLCKRTMQNK  LEL DFEAE LA LQ  +  KWEF+++QAEA+ KVDKKRD+ ER +L+SQE+ FWD +RP+ G  N  ++D RKL
Sbjct:   20 NHMVYRKMEMLVNQMLDAEAGVPIKTVKSFLSKVPSVFTGQDLIGWIMKNLEMTDLSDALHLAHLIASHGYLFQIDDHVLTVKNDG-TFYRFQTPYFWPSNCWDPENTDYAVYLCKRTMQNKAHLELEDFEAENLAKLQKMFSRKWEFVFMQAEAQYKVDKKRDRQERQILDSQERAFWDVHRPVPGCVNTTEVDFRKL 217          

HSP 2 Score: 140.584 bits (353), Expect = 7.717e-35
Identity = 70/171 (40.94%), Postives = 108/171 (63.16%), Query Frame = 1
Query: 1459 DMSTSAINPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFL-SPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKKKSKKRFP 1968
            D   S  NPW++D  +FW ++    ++ +RR+K W  + +ELL D  GRE +QK+L+KE+S ENL+FW   Q+L+    R +   +  IYN+F+ + +A  P+NVD KV E     V   +  NP+R+ F+EA +HI+ LM +DSY R+LRS IYK+L+   +KK  ++ P
Sbjct:  384 DPFQSQPNPWINDTVDFWQHDKITGDIQTRRLKLWEDSFEELLADSLGRETLQKFLDKEYSGENLRFWWEVQKLRKCSSRMVPVMVTEIYNEFIDTNAATSPVNVDCKVME-----VTEDNLKNPNRWSFDEAADHIYCLMKNDSYQRFLRSEIYKDLVLQSRKKVNQKGP 549          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Celegans
Match: egl-10 (Regulator of G-protein signaling egl-10 [Source:UniProtKB/Swiss-Prot;Acc:P49809])

HSP 1 Score: 244.973 bits (624), Expect = 1.321e-71
Identity = 109/199 (54.77%), Postives = 147/199 (73.87%), Query Frame = 1
Query:  424 NEFIWRKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKL 1020
            N  ++RK+E ++ +M + + GV I+TVKS +S VPSVFTG DL+ WI+K+L   ++ +A+H+  +IAS GYLF I DH L +KND  + YRFQTP  +PS C + +N +YAVYLCKRTMQNK  LEL DFEAE LA LQ  +  KWEF+++QAEA+ KVDKKRD+ ER +L+SQE+ FWD +RP+ G  N  ++D RKL
Sbjct:   20 NHMVYRKMEMLVNQMLDAEAGVPIKTVKSFLSKVPSVFTGQDLIGWIMKNLEMTDLSDALHLAHLIASHGYLFQIDDHVLTVKNDG-TFYRFQTPYFWPSNCWDPENTDYAVYLCKRTMQNKAHLELEDFEAENLAKLQKMFSRKWEFVFMQAEAQYKVDKKRDRQERQILDSQERAFWDVHRPVPGCVNTTEVDFRKL 217          

HSP 2 Score: 139.428 bits (350), Expect = 2.385e-34
Identity = 69/166 (41.57%), Postives = 106/166 (63.86%), Query Frame = 1
Query: 1459 DMSTSAINPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFL-SPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKKKS 1953
            D   S  NPW++D  +FW ++    ++ +RR+K W  + +ELL D  GRE +QK+L+KE+S ENL+FW   Q+L+    R +   +  IYN+F+ + +A  P+NVD KV E     V   +  NP+R+ F+EA +HI+ LM +DSY R+LRS IYK+L+   +KK+
Sbjct:  384 DPFQSQPNPWINDTVDFWQHDKITGDIQTRRLKLWEDSFEELLADSLGRETLQKFLDKEYSGENLRFWWEVQKLRKCSSRMVPVMVTEIYNEFIDTNAATSPVNVDCKVME-----VTEDNLKNPNRWSFDEAADHIYCLMKNDSYQRFLRSEIYKDLVLQSRKKT 544          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Celegans
Match: eat-16 (pep chromosome:WBcel235:I:9722550:9726263:1 gene:WBGene00001145.1 transcript:C16C2.2b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:eat-16)

HSP 1 Score: 137.117 bits (344), Expect = 1.335e-34
Identity = 68/187 (36.36%), Postives = 110/187 (58.82%), Query Frame = 1
Query: 1414 TGTTGMESTAGINGIDMSTSAINPWVSDNAEFW--ANEISLKEVSS-RRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKKKSKKRF 1965
            T  T ++  A  +         NPW+SD A FW    + S  E+ + +RVK+W  ++QEL+KDP GR+ ++ +LE EFS+EN++FW A Q+LK AP   + ++ E I  +FL+  A   +NVD++  +     ++ +  ++  RF F  +EEH+F LM  DSY R++RS IYK ++   ++   KR 
Sbjct:  232 TMVTWVDQRAEFDPFLHPPQPSNPWISDEASFWNQPTDTSSAEIPTEKRVKRWGLSVQELVKDPIGRQVLETFLESEFSSENIRFWIAIQDLKYAPNEQIYQKAERIREEFLAQGAPAQVNVDNRTLDQTLECISKAKDASQMRFAFYHSEEHVFTLMAKDSYPRFVRSQIYKAVLTAAQQHGTKRL 418          

HSP 2 Score: 111.694 bits (278), Expect = 5.056e-26
Identity = 64/184 (34.78%), Postives = 104/184 (56.52%), Query Frame = 1
Query:  442 KIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPN 993
            KIE + +R+     G Q++T K     VP   TG  L+  +++    ++  EA H+ S++   GY+FP+ +H    K+D  +LYR Q P  +PS+   V ++EYA+YL KR ++N+Q+  L + E E    L     H W FI  Q+E + K  K++ KV+++V +S+E+ FW   +P  G PN
Sbjct:    7 KIEVLAKRVME---GAQLKTHKYFRIAVPHAITGQQLIALVLERGAPDDEAEASHLASLLLHHGYMFPVIEHGQPFKDDG-TLYRLQRPYFWPSQAELVPDVEYAIYLNKRLLRNEQKHGLEEDEVESFNRLADVLAHMWAFIVQQSELQLKQQKEKKKVDKVVFDSEERAFWKIRKPSRGGPN 186          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Celegans
Match: eat-16 (pep chromosome:WBcel235:I:9722721:9726263:1 gene:WBGene00001145.1 transcript:C16C2.2b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:eat-16)

HSP 1 Score: 137.117 bits (344), Expect = 1.335e-34
Identity = 68/187 (36.36%), Postives = 110/187 (58.82%), Query Frame = 1
Query: 1414 TGTTGMESTAGINGIDMSTSAINPWVSDNAEFW--ANEISLKEVSS-RRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKKKSKKRF 1965
            T  T ++  A  +         NPW+SD A FW    + S  E+ + +RVK+W  ++QEL+KDP GR+ ++ +LE EFS+EN++FW A Q+LK AP   + ++ E I  +FL+  A   +NVD++  +     ++ +  ++  RF F  +EEH+F LM  DSY R++RS IYK ++   ++   KR 
Sbjct:  232 TMVTWVDQRAEFDPFLHPPQPSNPWISDEASFWNQPTDTSSAEIPTEKRVKRWGLSVQELVKDPIGRQVLETFLESEFSSENIRFWIAIQDLKYAPNEQIYQKAERIREEFLAQGAPAQVNVDNRTLDQTLECISKAKDASQMRFAFYHSEEHVFTLMAKDSYPRFVRSQIYKAVLTAAQQHGTKRL 418          

HSP 2 Score: 111.694 bits (278), Expect = 5.056e-26
Identity = 64/184 (34.78%), Postives = 104/184 (56.52%), Query Frame = 1
Query:  442 KIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPN 993
            KIE + +R+     G Q++T K     VP   TG  L+  +++    ++  EA H+ S++   GY+FP+ +H    K+D  +LYR Q P  +PS+   V ++EYA+YL KR ++N+Q+  L + E E    L     H W FI  Q+E + K  K++ KV+++V +S+E+ FW   +P  G PN
Sbjct:    7 KIEVLAKRVME---GAQLKTHKYFRIAVPHAITGQQLIALVLERGAPDDEAEASHLASLLLHHGYMFPVIEHGQPFKDDG-TLYRLQRPYFWPSQAELVPDVEYAIYLNKRLLRNEQKHGLEEDEVESFNRLADVLAHMWAFIVQQSELQLKQQKEKKKVDKVVFDSEERAFWKIRKPSRGGPN 186          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Fly
Match: RSG7 (gene:FBgn0024941 transcript:FBtr0074350)

HSP 1 Score: 278.1 bits (710), Expect = 9.822e-84
Identity = 137/273 (50.18%), Postives = 188/273 (68.86%), Query Frame = 1
Query:  418 SANEFIWRKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXNVILWSSIEGNTLSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFD 1236
            + N  +++K+E+IIE+MQ E TGV +RTVK+ MS VPSVFTG DLV WI+K+   E+V EA+H   +++S GY+FPI DH+L +KND  + YRFQTP  +PS C E +N +YAVYLCKRTMQNK RLELAD+EAE LA LQ  +  KWEFI++QAE+++KV KKRDK+ER VL+SQE+ FWD +RP+ G  N  +ID++K       +   S  +    +S + N +         L+  +A  +  LE++ I+VSKA E+L +Y D Y EFD
Sbjct:  211 APNILVYKKMEAIIEKMQAESTGVAVRTVKAFMSKVPSVFTGADLVAWILKNFDVEDVTEALHFAHLLSSHGYIFPIDDHALTVKNDG-TFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKTRLELADYEAENLAKLQKMFSRKWEFIFMQAESQSKVAKKRDKLERKVLDSQERAFWDVHRPMPGCVNTTEIDIKK----AYRRGGSSHGTGSAGASLAKNPV-------EQLTRIIALRKQKLERRTIKVSKAAEALVAYYDQYNEFD 471          

HSP 2 Score: 166.007 bits (419), Expect = 3.405e-43
Identity = 79/159 (49.69%), Postives = 110/159 (69.18%), Query Frame = 1
Query: 1480 NPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKKKSK 1956
            NPW +D+ E W  E + KEV  RRVK+W+F+++ELL D  GRE+  K+LEKE+S ENLKFWE+ QE+K  P  ++   I+ I+ +FL+P A  P+NVDSK  E    R A +S S P+R+CF+ A  H++ LM SDSY RYLRS++YK+ +   +KK K
Sbjct:  481 NPWQTDSTEMWDTEKNSKEVPVRRVKRWAFSLRELLNDAIGREQFTKFLEKEYSGENLKFWESVQEMKALPQSEIKEAIQKIWQEFLAPEAPCPVNVDSKSVELA--REAVNSPSGPNRWCFDVAASHVYHLMKSDSYSRYLRSDMYKDYLNCSRKKIK 637          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Fly
Match: RSG7 (gene:FBgn0024941 transcript:FBtr0307538)

HSP 1 Score: 278.1 bits (710), Expect = 9.822e-84
Identity = 137/273 (50.18%), Postives = 188/273 (68.86%), Query Frame = 1
Query:  418 SANEFIWRKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXNVILWSSIEGNTLSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFD 1236
            + N  +++K+E+IIE+MQ E TGV +RTVK+ MS VPSVFTG DLV WI+K+   E+V EA+H   +++S GY+FPI DH+L +KND  + YRFQTP  +PS C E +N +YAVYLCKRTMQNK RLELAD+EAE LA LQ  +  KWEFI++QAE+++KV KKRDK+ER VL+SQE+ FWD +RP+ G  N  +ID++K       +   S  +    +S + N +         L+  +A  +  LE++ I+VSKA E+L +Y D Y EFD
Sbjct:  211 APNILVYKKMEAIIEKMQAESTGVAVRTVKAFMSKVPSVFTGADLVAWILKNFDVEDVTEALHFAHLLSSHGYIFPIDDHALTVKNDG-TFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKTRLELADYEAENLAKLQKMFSRKWEFIFMQAESQSKVAKKRDKLERKVLDSQERAFWDVHRPMPGCVNTTEIDIKK----AYRRGGSSHGTGSAGASLAKNPV-------EQLTRIIALRKQKLERRTIKVSKAAEALVAYYDQYNEFD 471          

HSP 2 Score: 166.007 bits (419), Expect = 3.405e-43
Identity = 79/159 (49.69%), Postives = 110/159 (69.18%), Query Frame = 1
Query: 1480 NPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKKKSK 1956
            NPW +D+ E W  E + KEV  RRVK+W+F+++ELL D  GRE+  K+LEKE+S ENLKFWE+ QE+K  P  ++   I+ I+ +FL+P A  P+NVDSK  E    R A +S S P+R+CF+ A  H++ LM SDSY RYLRS++YK+ +   +KK K
Sbjct:  481 NPWQTDSTEMWDTEKNSKEVPVRRVKRWAFSLRELLNDAIGREQFTKFLEKEYSGENLKFWESVQEMKALPQSEIKEAIQKIWQEFLAPEAPCPVNVDSKSVELA--REAVNSPSGPNRWCFDVAASHVYHLMKSDSYSRYLRSDMYKDYLNCSRKKIK 637          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Fly
Match: CG42450 (gene:FBgn0259927 transcript:FBtr0310343)

HSP 1 Score: 160.614 bits (405), Expect = 1.714e-40
Identity = 87/269 (32.34%), Postives = 151/269 (56.13%), Query Frame = 1
Query:  436 WRKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITD-HSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXNVILWSSIEGNTLSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFDM 1239
            + K+E ++  MQ+++ GV +R  K  ++++P  F G DL+ W++  L  EE  EA+++ + +   GY FP+ D  +L +K+D+ SLYRFQTP  +P +    DN+EYA+YL KR+++NKQR  L D+EAE LA+L      KW+FI +QAE + ++ K+R K +++V +SQE+ +W  +RP  G          + C      +   + +                   + +   V  +  +L + R+++S+A ESL  Y++ + E+D 
Sbjct:  214 FDKMEMLVREMQDQEHGVPVRQQKMFLTSIPYAFMGYDLIEWLMDRLQIEE-SEALNIANQLCLHGYFFPVNDSKTLTVKDDS-SLYRFQTPYYWPWQHKAPDNVEYAIYLAKRSLRNKQRHALEDYEAEALASLHKNLKGKWDFISMQAEEQVRLAKERKKGDKIVGDSQERAYWRVHRPPPG-----QFTPLEPCPVPSRDRQGLKPNKKKTV--------------DDMQRDVDYLGKSLNRTRMKMSQACESLVCYSETFSEYDF 461          

HSP 2 Score: 125.561 bits (314), Expect = 2.810e-29
Identity = 65/165 (39.39%), Postives = 97/165 (58.79%), Query Frame = 1
Query: 1480 NPWVSDNAEFWA-NEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFK-LMTSDSYYRYLRSNIYKELM-AGQKKKSKKRF 1965
            NPWV+++  FW  N   +   + +RVK+W+ +I+EL+ DP G +E   +LEKE+S EN++FW A   L+ +    + R++  IY +FL P A   +N+D K  ESV   +      NP RF F+ A EHI+  L+  D Y R++RS  YK L+  G +   KKRF
Sbjct:  470 NPWVTEDIAFWQLNNTFVDIPTEKRVKRWAISIEELVSDPTGLQEFTGFLEKEYSHENIRFWIAVNRLRRSAHSQVARKVNEIYEEFLKPGAPCEINIDGKTMESVLKGL-----KNPSRFTFDSASEHIYMLLLKKDCYPRFIRSEHYKRLLDTGIQPSYKKRF 629          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Fly
Match: CG42450 (gene:FBgn0259927 transcript:FBtr0300218)

HSP 1 Score: 160.614 bits (405), Expect = 1.739e-40
Identity = 87/269 (32.34%), Postives = 151/269 (56.13%), Query Frame = 1
Query:  436 WRKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITD-HSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXNVILWSSIEGNTLSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFDM 1239
            + K+E ++  MQ+++ GV +R  K  ++++P  F G DL+ W++  L  EE  EA+++ + +   GY FP+ D  +L +K+D+ SLYRFQTP  +P +    DN+EYA+YL KR+++NKQR  L D+EAE LA+L      KW+FI +QAE + ++ K+R K +++V +SQE+ +W  +RP  G          + C      +   + +                   + +   V  +  +L + R+++S+A ESL  Y++ + E+D 
Sbjct:  214 FDKMEMLVREMQDQEHGVPVRQQKMFLTSIPYAFMGYDLIEWLMDRLQIEE-SEALNIANQLCLHGYFFPVNDSKTLTVKDDS-SLYRFQTPYYWPWQHKAPDNVEYAIYLAKRSLRNKQRHALEDYEAEALASLHKNLKGKWDFISMQAEEQVRLAKERKKGDKIVGDSQERAYWRVHRPPPG-----QFTPLEPCPVPSRDRQGLKPNKKKTV--------------DDMQRDVDYLGKSLNRTRMKMSQACESLVCYSETFSEYDF 461          

HSP 2 Score: 125.176 bits (313), Expect = 3.233e-29
Identity = 65/165 (39.39%), Postives = 97/165 (58.79%), Query Frame = 1
Query: 1480 NPWVSDNAEFWA-NEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFK-LMTSDSYYRYLRSNIYKELM-AGQKKKSKKRF 1965
            NPWV+++  FW  N   +   + +RVK+W+ +I+EL+ DP G +E   +LEKE+S EN++FW A   L+ +    + R++  IY +FL P A   +N+D K  ESV   +      NP RF F+ A EHI+  L+  D Y R++RS  YK L+  G +   KKRF
Sbjct:  470 NPWVTEDIAFWQLNNTFVDIPTEKRVKRWAISIEELVSDPTGLQEFTGFLEKEYSHENIRFWIAVNRLRRSAHSQVARKVNEIYEEFLKPGAPCEINIDGKTMESVLKGL-----KNPSRFTFDSASEHIYMLLLKKDCYPRFIRSEHYKRLLDTGIQPSYKKRF 629          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Fly
Match: Dhit (gene:FBgn0028743 transcript:FBtr0340279)

HSP 1 Score: 77.7962 bits (190), Expect = 2.060e-15
Identity = 50/149 (33.56%), Postives = 76/149 (51.01%), Query Frame = 1
Query: 1498 NAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDL-NRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQ 1941
            NAEF   E    E     ++ W  +  +L+K  AGR+  Q +L  EFS EN+ FW AC++LK     +L   +   IY  ++S  +   +++DS+V E     + N +   P    F+EA+  I+ LM  DSY R+L S  +K L   Q
Sbjct:  119 NAEFLDGEQPTLE----EIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELVEEKARLIYEDYISILSPREVSLDSRVRE-----IVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKFKTLAQLQ 258          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Zebrafish
Match: rgs7a (regulator of G protein signaling 7a [Source:ZFIN;Acc:ZDB-GENE-040718-276])

HSP 1 Score: 269.626 bits (688), Expect = 1.717e-82
Identity = 133/280 (47.50%), Postives = 190/280 (67.86%), Query Frame = 1
Query:  412 NQSANEFIWRKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXNVILWSSIEGNT-----LSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFD 1236
            + S N  ++RK+E +I RMQ+E  G+ IRTVKS +S +PSVF+G D+V W++K+L  E+ +EA+H+G+++A+ GY FPI+DH L +K+D  + YRFQTP  +PS C E +N +YAVYLCKRTMQNK RLELAD+EAE LA LQ  +  KWEFI++QAEA+AKVDKKRDK+ER +L+SQE+ FWD +RP+ G  N  ++D++K  R K P K             S +     + E        L E++   +  L++ R+++SK  ESL SY + Y ++D
Sbjct:   16 DDSPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGSDIVQWLLKNLCIEDQVEALHLGTLMAAHGYFFPISDHVLTLKDDG-TFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPGCVNTTEVDIKKSSRMKNPHKTRKSVYGLQNDIRSHSPTHTPAPEAKQPTEEELQEQIKFWQAQLDRHRLKMSKVAESLLSYAEQYSDYD 294          

HSP 2 Score: 159.844 bits (403), Expect = 4.947e-42
Identity = 79/162 (48.77%), Postives = 108/162 (66.67%), Query Frame = 1
Query: 1480 NPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKKKSKKRF 1965
            NPW+SD+   W  E S KE    RV++W F I E+LKDP GRE+  K+LE EFS+ENL+FW A QELK  P+R++  R++ I+ +FL+  A   +NVDSK  +     V      +P R+ FE+A+EHI+KLM SDSY R++RS  Y+EL+  +KKKSK  F
Sbjct:  304 NPWMSDDTTLWEMEAS-KEPGQTRVRRWGFGIDEVLKDPVGREQFLKFLESEFSSENLRFWLAVQELKRRPIREVPTRVQEIWEEFLAAGAPSAINVDSKSYDKTTQNV-----KDPGRYAFEDAQEHIYKLMKSDSYSRFIRSCAYQELLQAKKKKSKNLF 459          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Zebrafish
Match: rgs7a (regulator of G protein signaling 7a [Source:ZFIN;Acc:ZDB-GENE-040718-276])

HSP 1 Score: 269.626 bits (688), Expect = 1.717e-82
Identity = 133/280 (47.50%), Postives = 190/280 (67.86%), Query Frame = 1
Query:  412 NQSANEFIWRKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXNVILWSSIEGNT-----LSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFD 1236
            + S N  ++RK+E +I RMQ+E  G+ IRTVKS +S +PSVF+G D+V W++K+L  E+ +EA+H+G+++A+ GY FPI+DH L +K+D  + YRFQTP  +PS C E +N +YAVYLCKRTMQNK RLELAD+EAE LA LQ  +  KWEFI++QAEA+AKVDKKRDK+ER +L+SQE+ FWD +RP+ G  N  ++D++K  R K P K             S +     + E        L E++   +  L++ R+++SK  ESL SY + Y ++D
Sbjct:   16 DDSPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGSDIVQWLLKNLCIEDQVEALHLGTLMAAHGYFFPISDHVLTLKDDG-TFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPGCVNTTEVDIKKSSRMKNPHKTRKSVYGLQNDIRSHSPTHTPAPEAKQPTEEELQEQIKFWQAQLDRHRLKMSKVAESLLSYAEQYSDYD 294          

HSP 2 Score: 159.844 bits (403), Expect = 4.947e-42
Identity = 79/162 (48.77%), Postives = 108/162 (66.67%), Query Frame = 1
Query: 1480 NPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKKKSKKRF 1965
            NPW+SD+   W  E S KE    RV++W F I E+LKDP GRE+  K+LE EFS+ENL+FW A QELK  P+R++  R++ I+ +FL+  A   +NVDSK  +     V      +P R+ FE+A+EHI+KLM SDSY R++RS  Y+EL+  +KKKSK  F
Sbjct:  304 NPWMSDDTTLWEMEAS-KEPGQTRVRRWGFGIDEVLKDPVGREQFLKFLESEFSSENLRFWLAVQELKRRPIREVPTRVQEIWEEFLAAGAPSAINVDSKSYDKTTQNV-----KDPGRYAFEDAQEHIYKLMKSDSYSRFIRSCAYQELLQAKKKKSKNLF 459          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Zebrafish
Match: rgs7a (regulator of G protein signaling 7a [Source:ZFIN;Acc:ZDB-GENE-040718-276])

HSP 1 Score: 269.626 bits (688), Expect = 1.717e-82
Identity = 133/280 (47.50%), Postives = 190/280 (67.86%), Query Frame = 1
Query:  412 NQSANEFIWRKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXNVILWSSIEGNT-----LSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFD 1236
            + S N  ++RK+E +I RMQ+E  G+ IRTVKS +S +PSVF+G D+V W++K+L  E+ +EA+H+G+++A+ GY FPI+DH L +K+D  + YRFQTP  +PS C E +N +YAVYLCKRTMQNK RLELAD+EAE LA LQ  +  KWEFI++QAEA+AKVDKKRDK+ER +L+SQE+ FWD +RP+ G  N  ++D++K  R K P K             S +     + E        L E++   +  L++ R+++SK  ESL SY + Y ++D
Sbjct:   16 DDSPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGSDIVQWLLKNLCIEDQVEALHLGTLMAAHGYFFPISDHVLTLKDDG-TFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPGCVNTTEVDIKKSSRMKNPHKTRKSVYGLQNDIRSHSPTHTPAPEAKQPTEEELQEQIKFWQAQLDRHRLKMSKVAESLLSYAEQYSDYD 294          

HSP 2 Score: 159.844 bits (403), Expect = 4.947e-42
Identity = 79/162 (48.77%), Postives = 108/162 (66.67%), Query Frame = 1
Query: 1480 NPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKKKSKKRF 1965
            NPW+SD+   W  E S KE    RV++W F I E+LKDP GRE+  K+LE EFS+ENL+FW A QELK  P+R++  R++ I+ +FL+  A   +NVDSK  +     V      +P R+ FE+A+EHI+KLM SDSY R++RS  Y+EL+  +KKKSK  F
Sbjct:  304 NPWMSDDTTLWEMEAS-KEPGQTRVRRWGFGIDEVLKDPVGREQFLKFLESEFSSENLRFWLAVQELKRRPIREVPTRVQEIWEEFLAAGAPSAINVDSKSYDKTTQNV-----KDPGRYAFEDAQEHIYKLMKSDSYSRFIRSCAYQELLQAKKKKSKNLF 459          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Zebrafish
Match: rgs7a (regulator of G protein signaling 7a [Source:ZFIN;Acc:ZDB-GENE-040718-276])

HSP 1 Score: 269.626 bits (688), Expect = 1.936e-82
Identity = 133/280 (47.50%), Postives = 190/280 (67.86%), Query Frame = 1
Query:  412 NQSANEFIWRKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXNVILWSSIEGNT-----LSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFD 1236
            + S N  ++RK+E +I RMQ+E  G+ IRTVKS +S +PSVF+G D+V W++K+L  E+ +EA+H+G+++A+ GY FPI+DH L +K+D  + YRFQTP  +PS C E +N +YAVYLCKRTMQNK RLELAD+EAE LA LQ  +  KWEFI++QAEA+AKVDKKRDK+ER +L+SQE+ FWD +RP+ G  N  ++D++K  R K P K             S +     + E        L E++   +  L++ R+++SK  ESL SY + Y ++D
Sbjct:   16 DDSPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGSDIVQWLLKNLCIEDQVEALHLGTLMAAHGYFFPISDHVLTLKDDG-TFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPGCVNTTEVDIKKSSRMKNPHKTRKSVYGLQNDIRSHSPTHTPAPEAKQPTEEELQEQIKFWQAQLDRHRLKMSKVAESLLSYAEQYSDYD 294          

HSP 2 Score: 154.836 bits (390), Expect = 3.884e-40
Identity = 79/170 (46.47%), Postives = 110/170 (64.71%), Query Frame = 1
Query: 1480 NPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKKKS---KKRFPADIR 1980
            NPW+SD+   W  E S KE    RV++W F I E+LKDP GRE+  K+LE EFS+ENL+FW A QELK  P+R++  R++ I+ +FL+  A   +NVDSK  +     V      +P R+ FE+A+EHI+KLM SDSY R++RS  Y+EL+  +KK      KR PA ++
Sbjct:  304 NPWMSDDTTLWEMEAS-KEPGQTRVRRWGFGIDEVLKDPVGREQFLKFLESEFSSENLRFWLAVQELKRRPIREVPTRVQEIWEEFLAAGAPSAINVDSKSYDKTTQNV-----KDPGRYAFEDAQEHIYKLMKSDSYSRFIRSCAYQELLQAKKKGKSLISKRPPAVVQ 467          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Zebrafish
Match: rgs6 (regulator of G protein signaling 6 [Source:ZFIN;Acc:ZDB-GENE-030131-31])

HSP 1 Score: 255.758 bits (652), Expect = 6.417e-77
Identity = 124/279 (44.44%), Postives = 188/279 (67.38%), Query Frame = 1
Query:  418 SANEFIWRKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXNVILWSSIEGNT------LSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFD 1236
            S N   +RKIE II R+Q+E  GV +RTVKS ++ +P+V TG D+V W++K+L  E+  EAIHVGS+IA+ GY+FPI+DH L +K+D  + YRFQ P  +PS C E +N +YA+YLCKRTMQNK RLELAD+EAE LA LQ  +  KWEFI++QAEA+ K+D+K+DK ER +L+SQE+ FWD +RP+ G  N  ++D+RK CR  +  + + +S    +        + +  + ++      + +++  +   L++  +++SK  E+L SY + Y ++D
Sbjct:   20 SPNMIAYRKIEDIITRLQDEAEGVPVRTVKSFLTKIPNVVTGSDIVQWMMKNLNMEDPAEAIHVGSLIAAQGYIFPISDHVLTLKDDG-TFYRFQAPYFWPSNCWEPENTDYAIYLCKRTMQNKTRLELADYEAENLARLQRAFARKWEFIFMQAEAQVKIDRKKDKTERKILDSQERAFWDVHRPVPGCVNTTEMDIRK-CRRLKNPQRVKKSVYGVVDDTQTQSPVHTPAQQSSKDTKEDVEKEILFLNTQLDRHCMKMSKVAETLMSYTEQYLDYD 296          

HSP 2 Score: 153.295 bits (386), Expect = 1.443e-39
Identity = 75/156 (48.08%), Postives = 107/156 (68.59%), Query Frame = 1
Query: 1480 NPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKK 1947
            NPW+SD+A FW  E S K+ S +RVKKW F++ E LKDP GRE+  K+LE EFS+ENL FW A Q+LK  PL+++  R + I+ +FL+  A   +N+DS   E  +  +      +P R+ FE+A++HI+KLM SDSY R+LRSN Y++L+  +KK
Sbjct:  306 NPWISDDATFWELEAS-KDPSQQRVKKWGFSLDEALKDPVGREQFLKFLESEFSSENLLFWLAVQDLKCRPLQEVASRAQEIWQEFLAEGAPNAINLDSHSYERTSQNL-----KDPGRYSFEDAQDHIYKLMKSDSYPRFLRSNAYQDLLLARKK 455          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Xenopus
Match: RGS6 (regulator of G-protein signaling 6 [Source:NCBI gene;Acc:100486845])

HSP 1 Score: 258.455 bits (659), Expect = 5.856e-78
Identity = 129/281 (45.91%), Postives = 191/281 (67.97%), Query Frame = 1
Query:  412 NQSANEFIWRKIESIIERMQNEDTG-VQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXNVILWSS-----IEGNTLSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFD 1236
            + + N  ++RKIE II RMQ++  G V IRTVKS +S +PSV TG D+V W++K+L  E+  EAIH+GS+IA+ GY+FPI+DH L +K+D  + YRFQ P  +PS C E +N +YA+YLCKRTMQNK RLELAD+EAE LA LQ  +  KWEFI++QAEA+ K+D+K+DK ER +L+SQE+GFWD +RP+ G  N  ++D+RK  R K P+K+          S S + +  +S        + L +++  + V +++  +++SK  +S  ++ + Y E+D
Sbjct:   17 DNTPNMIVYRKIEDIITRMQDDKAGGVPIRTVKSFLSKIPSVVTGADIVQWLVKNLNIEDPAEAIHLGSLIAAQGYIFPISDHVLTLKDDG-TFYRFQAPYFWPSNCWEPENTDYAIYLCKRTMQNKARLELADYEAENLARLQRAFARKWEFIFMQAEAQVKIDRKKDKTERKILDSQERGFWDVHRPVPGCVNTTEMDIRKCRRMKNPQKVKKSVYGVSEDSQSQSPVHMASHVIRKTTKDDLRKQINFLNVQIDRHCLKMSKVADSFIAFTEQYTEYD 296          

HSP 2 Score: 157.532 bits (397), Expect = 6.351e-41
Identity = 75/156 (48.08%), Postives = 108/156 (69.23%), Query Frame = 1
Query: 1480 NPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKK 1947
            NPW+SD+  F   E S KE S +RVK+W F++ E+LKDP GRE+  ++LE EFS+ENL+FW   Q+LK  PL ++ +R+E I+ +FL+P A   +N+DS   E  +  V      +P R+ FE+A+EHI+KLM SDSY R+LRSN Y++L+  +KK
Sbjct:  306 NPWISDDTTFLDLENS-KEPSQQRVKRWGFSLDEVLKDPVGREQFLRFLESEFSSENLRFWVVVQDLKKQPLHEVPKRVEEIWQEFLAPGAQSAINLDSHSFEKTSQNV-----KDPGRYTFEDAQEHIYKLMKSDSYARFLRSNAYQDLLLMKKK 455          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Xenopus
Match: RGS6 (regulator of G-protein signaling 6 [Source:NCBI gene;Acc:100486845])

HSP 1 Score: 258.455 bits (659), Expect = 6.355e-78
Identity = 129/281 (45.91%), Postives = 191/281 (67.97%), Query Frame = 1
Query:  412 NQSANEFIWRKIESIIERMQNEDTG-VQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXNVILWSS-----IEGNTLSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFD 1236
            + + N  ++RKIE II RMQ++  G V IRTVKS +S +PSV TG D+V W++K+L  E+  EAIH+GS+IA+ GY+FPI+DH L +K+D  + YRFQ P  +PS C E +N +YA+YLCKRTMQNK RLELAD+EAE LA LQ  +  KWEFI++QAEA+ K+D+K+DK ER +L+SQE+GFWD +RP+ G  N  ++D+RK  R K P+K+          S S + +  +S        + L +++  + V +++  +++SK  +S  ++ + Y E+D
Sbjct:   17 DNTPNMIVYRKIEDIITRMQDDKAGGVPIRTVKSFLSKIPSVVTGADIVQWLVKNLNIEDPAEAIHLGSLIAAQGYIFPISDHVLTLKDDG-TFYRFQAPYFWPSNCWEPENTDYAIYLCKRTMQNKARLELADYEAENLARLQRAFARKWEFIFMQAEAQVKIDRKKDKTERKILDSQERGFWDVHRPVPGCVNTTEMDIRKCRRMKNPQKVKKSVYGVSEDSQSQSPVHMASHVIRKTTKDDLRKQINFLNVQIDRHCLKMSKVADSFIAFTEQYTEYD 296          

HSP 2 Score: 157.147 bits (396), Expect = 8.003e-41
Identity = 75/156 (48.08%), Postives = 108/156 (69.23%), Query Frame = 1
Query: 1480 NPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKK 1947
            NPW+SD+  F   E S KE S +RVK+W F++ E+LKDP GRE+  ++LE EFS+ENL+FW   Q+LK  PL ++ +R+E I+ +FL+P A   +N+DS   E  +  V      +P R+ FE+A+EHI+KLM SDSY R+LRSN Y++L+  +KK
Sbjct:  306 NPWISDDTTFLDLENS-KEPSQQRVKRWGFSLDEVLKDPVGREQFLRFLESEFSSENLRFWVVVQDLKKQPLHEVPKRVEEIWQEFLAPGAQSAINLDSHSFEKTSQNV-----KDPGRYTFEDAQEHIYKLMKSDSYARFLRSNAYQDLLLMKKK 455          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Xenopus
Match: RGS6 (regulator of G-protein signaling 6 [Source:NCBI gene;Acc:100486845])

HSP 1 Score: 248.054 bits (632), Expect = 1.165e-73
Identity = 126/270 (46.67%), Postives = 184/270 (68.15%), Query Frame = 1
Query:  445 IESIIERMQNEDTG-VQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXNVILWSS-----IEGNTLSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFD 1236
            IE II RMQ++  G V IRTVKS +S +PSV TG D+V W++K+L  E+  EAIH+GS+IA+ GY+FPI+DH L +K+D  + YRFQ P  +PS C E +N +YA+YLCKRTMQNK RLELAD+EAE LA LQ  +  KWEFI++QAEA+ K+D+K+DK ER +L+SQE+GFWD +RP+ G  N  ++D+RK  R K P+K+          S S + +  +S        + L +++  + V +++  +++SK  +S  ++ + Y E+D
Sbjct:    2 IEDIITRMQDDKAGGVPIRTVKSFLSKIPSVVTGADIVQWLVKNLNIEDPAEAIHLGSLIAAQGYIFPISDHVLTLKDDG-TFYRFQAPYFWPSNCWEPENTDYAIYLCKRTMQNKARLELADYEAENLARLQRAFARKWEFIFMQAEAQVKIDRKKDKTERKILDSQERGFWDVHRPVPGCVNTTEMDIRKCRRMKNPQKVKKSVYGVSEDSQSQSPVHMASHVIRKTTKDDLRKQINFLNVQIDRHCLKMSKVADSFIAFTEQYTEYD 270          

HSP 2 Score: 156.762 bits (395), Expect = 1.916e-40
Identity = 75/156 (48.08%), Postives = 108/156 (69.23%), Query Frame = 1
Query: 1480 NPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKK 1947
            NPW+SD+  F   E S KE S +RVK+W F++ E+LKDP GRE+  ++LE EFS+ENL+FW   Q+LK  PL ++ +R+E I+ +FL+P A   +N+DS   E  +  V      +P R+ FE+A+EHI+KLM SDSY R+LRSN Y++L+  +KK
Sbjct:  280 NPWISDDTTFLDLENS-KEPSQQRVKRWGFSLDEVLKDPVGREQFLRFLESEFSSENLRFWVVVQDLKKQPLHEVPKRVEEIWQEFLAPGAQSAINLDSHSFEKTSQNV-----KDPGRYTFEDAQEHIYKLMKSDSYARFLRSNAYQDLLLMKKK 429          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Xenopus
Match: RGS6 (regulator of G-protein signaling 6 [Source:NCBI gene;Acc:100486845])

HSP 1 Score: 240.736 bits (613), Expect = 2.156e-71
Identity = 121/263 (46.01%), Postives = 179/263 (68.06%), Query Frame = 1
Query:  466 MQNEDTG-VQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXNVILWSS-----IEGNTLSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFD 1236
            MQ++  G V IRTVKS +S +PSV TG D+V W++K+L  E+  EAIH+GS+IA+ GY+FPI+DH L +K+D  + YRFQ P  +PS C E +N +YA+YLCKRTMQNK RLELAD+EAE LA LQ  +  KWEFI++QAEA+ K+D+K+DK ER +L+SQE+GFWD +RP+ G  N  ++D+RK  R K P+K+          S S + +  +S        + L +++  + V +++  +++SK  +S  ++ + Y E+D
Sbjct:    1 MQDDKAGGVPIRTVKSFLSKIPSVVTGADIVQWLVKNLNIEDPAEAIHLGSLIAAQGYIFPISDHVLTLKDDG-TFYRFQAPYFWPSNCWEPENTDYAIYLCKRTMQNKARLELADYEAENLARLQRAFARKWEFIFMQAEAQVKIDRKKDKTERKILDSQERGFWDVHRPVPGCVNTTEMDIRKCRRMKNPQKVKKSVYGVSEDSQSQSPVHMASHVIRKTTKDDLRKQINFLNVQIDRHCLKMSKVADSFIAFTEQYTEYD 262          

HSP 2 Score: 157.918 bits (398), Expect = 3.229e-41
Identity = 78/162 (48.15%), Postives = 112/162 (69.14%), Query Frame = 1
Query: 1480 NPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKKKSKKRF 1965
            NPW+SD+  F   E S KE S +RVK+W F++ E+LKDP GRE+  ++LE EFS+ENL+FW   Q+LK  PL ++ +R+E I+ +FL+P A   +N+DS   E  +  V      +P R+ FE+A+EHI+KLM SDSY R+LRSN Y++L+   KKK+ +RF
Sbjct:  272 NPWISDDTTFLDLENS-KEPSQQRVKRWGFSLDEVLKDPVGREQFLRFLESEFSSENLRFWVVVQDLKKQPLHEVPKRVEEIWQEFLAPGAQSAINLDSHSFEKTSQNV-----KDPGRYTFEDAQEHIYKLMKSDSYARFLRSNAYQDLLL-MKKKAGRRF 426          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Xenopus
Match: RGS6 (regulator of G-protein signaling 6 [Source:NCBI gene;Acc:100486845])

HSP 1 Score: 239.965 bits (611), Expect = 3.547e-71
Identity = 121/263 (46.01%), Postives = 179/263 (68.06%), Query Frame = 1
Query:  466 MQNEDTG-VQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXNVILWSS-----IEGNTLSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFD 1236
            MQ++  G V IRTVKS +S +PSV TG D+V W++K+L  E+  EAIH+GS+IA+ GY+FPI+DH L +K+D  + YRFQ P  +PS C E +N +YA+YLCKRTMQNK RLELAD+EAE LA LQ  +  KWEFI++QAEA+ K+D+K+DK ER +L+SQE+GFWD +RP+ G  N  ++D+RK  R K P+K+          S S + +  +S        + L +++  + V +++  +++SK  +S  ++ + Y E+D
Sbjct:    1 MQDDKAGGVPIRTVKSFLSKIPSVVTGADIVQWLVKNLNIEDPAEAIHLGSLIAAQGYIFPISDHVLTLKDDG-TFYRFQAPYFWPSNCWEPENTDYAIYLCKRTMQNKARLELADYEAENLARLQRAFARKWEFIFMQAEAQVKIDRKKDKTERKILDSQERGFWDVHRPVPGCVNTTEMDIRKCRRMKNPQKVKKSVYGVSEDSQSQSPVHMASHVIRKTTKDDLRKQINFLNVQIDRHCLKMSKVADSFIAFTEQYTEYD 262          

HSP 2 Score: 156.377 bits (394), Expect = 1.139e-40
Identity = 75/156 (48.08%), Postives = 108/156 (69.23%), Query Frame = 1
Query: 1480 NPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKK 1947
            NPW+SD+  F   E S KE S +RVK+W F++ E+LKDP GRE+  ++LE EFS+ENL+FW   Q+LK  PL ++ +R+E I+ +FL+P A   +N+DS   E  +  V      +P R+ FE+A+EHI+KLM SDSY R+LRSN Y++L+  +KK
Sbjct:  272 NPWISDDTTFLDLENS-KEPSQQRVKRWGFSLDEVLKDPVGREQFLRFLESEFSSENLRFWVVVQDLKKQPLHEVPKRVEEIWQEFLAPGAQSAINLDSHSFEKTSQNV-----KDPGRYTFEDAQEHIYKLMKSDSYARFLRSNAYQDLLLMKKK 421          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Mouse
Match: Rgs7 (regulator of G protein signaling 7 [Source:MGI Symbol;Acc:MGI:1346089])

HSP 1 Score: 271.166 bits (692), Expect = 6.038e-83
Identity = 132/280 (47.14%), Postives = 193/280 (68.93%), Query Frame = 1
Query:  412 NQSANEFIWRKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXNVILWSSIEG-----NTLSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFD 1236
            ++S N  ++RK+E +I RMQ+E  G+ IRTVKS +S +PSVF+G D+V W+IK+L  E+ +EA+H+G+++A+ GY FPI+DH L +K+D  + YRFQTP  +PS C E +N +YAVYLCKRTMQNK RLELAD+EAE LA LQ  +  KWEFI++QAEA+AKVDKKRDK+ER +L+SQE+ FWD +RP+ G  N  ++D++K  R + P K             S +     + E      + L +++   ++ L++ R+++SK  +SL SY + Y E+D
Sbjct:   16 DESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGSDIVQWLIKNLTIEDPVEALHLGTLMAAHGYFFPISDHVLTLKDDG-TFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPGCVNTTEVDIKKSSRMRNPHKTRKSVYGLQNDIRSHSPTHTPTPETKPPTEDELHQQIKYWQIQLDRHRLKMSKVADSLLSYTEQYVEYD 294          

HSP 2 Score: 156.377 bits (394), Expect = 9.163e-41
Identity = 74/156 (47.44%), Postives = 107/156 (68.59%), Query Frame = 1
Query: 1480 NPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKK 1947
            NPW+SD+  FW  E S KE S +RVK+W F + E LKDP GRE+  K+LE EFS+ENL+FW A ++LK  P+R++  R++ I+ +FL+P A   +N+DSK  +     V       P R+ FE+A+EHI+KLM SDSY R++RS+ Y+EL+  ++K
Sbjct:  304 NPWLSDDTTFWELEAS-KEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENLRFWLAVEDLKRRPIREVPSRVQEIWQEFLAPGAPSAINLDSKSYDKTTQNV-----KEPGRYTFEDAQEHIYKLMKSDSYPRFIRSSAYQELLQAKRK 453          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Mouse
Match: Rgs7 (regulator of G protein signaling 7 [Source:MGI Symbol;Acc:MGI:1346089])

HSP 1 Score: 271.166 bits (692), Expect = 6.038e-83
Identity = 132/280 (47.14%), Postives = 193/280 (68.93%), Query Frame = 1
Query:  412 NQSANEFIWRKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXNVILWSSIEG-----NTLSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFD 1236
            ++S N  ++RK+E +I RMQ+E  G+ IRTVKS +S +PSVF+G D+V W+IK+L  E+ +EA+H+G+++A+ GY FPI+DH L +K+D  + YRFQTP  +PS C E +N +YAVYLCKRTMQNK RLELAD+EAE LA LQ  +  KWEFI++QAEA+AKVDKKRDK+ER +L+SQE+ FWD +RP+ G  N  ++D++K  R + P K             S +     + E      + L +++   ++ L++ R+++SK  +SL SY + Y E+D
Sbjct:   16 DESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGSDIVQWLIKNLTIEDPVEALHLGTLMAAHGYFFPISDHVLTLKDDG-TFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPGCVNTTEVDIKKSSRMRNPHKTRKSVYGLQNDIRSHSPTHTPTPETKPPTEDELHQQIKYWQIQLDRHRLKMSKVADSLLSYTEQYVEYD 294          

HSP 2 Score: 156.377 bits (394), Expect = 9.163e-41
Identity = 74/156 (47.44%), Postives = 107/156 (68.59%), Query Frame = 1
Query: 1480 NPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKK 1947
            NPW+SD+  FW  E S KE S +RVK+W F + E LKDP GRE+  K+LE EFS+ENL+FW A ++LK  P+R++  R++ I+ +FL+P A   +N+DSK  +     V       P R+ FE+A+EHI+KLM SDSY R++RS+ Y+EL+  ++K
Sbjct:  304 NPWLSDDTTFWELEAS-KEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENLRFWLAVEDLKRRPIREVPSRVQEIWQEFLAPGAPSAINLDSKSYDKTTQNV-----KEPGRYTFEDAQEHIYKLMKSDSYPRFIRSSAYQELLQAKRK 453          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Mouse
Match: Rgs7 (regulator of G protein signaling 7 [Source:MGI Symbol;Acc:MGI:1346089])

HSP 1 Score: 270.396 bits (690), Expect = 1.029e-82
Identity = 132/280 (47.14%), Postives = 193/280 (68.93%), Query Frame = 1
Query:  412 NQSANEFIWRKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXNVILWSSIEG-----NTLSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFD 1236
            ++S N  ++RK+E +I RMQ+E  G+ IRTVKS +S +PSVF+G D+V W+IK+L  E+ +EA+H+G+++A+ GY FPI+DH L +K+D  + YRFQTP  +PS C E +N +YAVYLCKRTMQNK RLELAD+EAE LA LQ  +  KWEFI++QAEA+AKVDKKRDK+ER +L+SQE+ FWD +RP+ G  N  ++D++K  R + P K             S +     + E      + L +++   ++ L++ R+++SK  +SL SY + Y E+D
Sbjct:   16 DESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGSDIVQWLIKNLTIEDPVEALHLGTLMAAHGYFFPISDHVLTLKDDG-TFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPGCVNTTEVDIKKSSRMRNPHKTRKSVYGLQNDIRSHSPTHTPTPETKPPTEDELHQQIKYWQIQLDRHRLKMSKVADSLLSYTEQYVEYD 294          

HSP 2 Score: 158.303 bits (399), Expect = 2.070e-41
Identity = 75/162 (46.30%), Postives = 110/162 (67.90%), Query Frame = 1
Query: 1480 NPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKKKSKKRF 1965
            NPW+SD+  FW  E S KE S +RVK+W F + E LKDP GRE+  K+LE EFS+ENL+FW A ++LK  P+R++  R++ I+ +FL+P A   +N+DSK  +     V       P R+ FE+A+EHI+KLM SDSY R++RS+ Y+EL+  ++K+  +R 
Sbjct:  304 NPWLSDDTTFWELEAS-KEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENLRFWLAVEDLKRRPIREVPSRVQEIWQEFLAPGAPSAINLDSKSYDKTTQNV-----KEPGRYTFEDAQEHIYKLMKSDSYPRFIRSSAYQELLQAKRKRCHERL 459          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Mouse
Match: Rgs7 (regulator of G protein signaling 7 [Source:MGI Symbol;Acc:MGI:1346089])

HSP 1 Score: 270.781 bits (691), Expect = 1.088e-82
Identity = 132/280 (47.14%), Postives = 193/280 (68.93%), Query Frame = 1
Query:  412 NQSANEFIWRKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXNVILWSSIEG-----NTLSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFD 1236
            ++S N  ++RK+E +I RMQ+E  G+ IRTVKS +S +PSVF+G D+V W+IK+L  E+ +EA+H+G+++A+ GY FPI+DH L +K+D  + YRFQTP  +PS C E +N +YAVYLCKRTMQNK RLELAD+EAE LA LQ  +  KWEFI++QAEA+AKVDKKRDK+ER +L+SQE+ FWD +RP+ G  N  ++D++K  R + P K             S +     + E      + L +++   ++ L++ R+++SK  +SL SY + Y E+D
Sbjct:   16 DESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGSDIVQWLIKNLTIEDPVEALHLGTLMAAHGYFFPISDHVLTLKDDG-TFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPGCVNTTEVDIKKSSRMRNPHKTRKSVYGLQNDIRSHSPTHTPTPETKPPTEDELHQQIKYWQIQLDRHRLKMSKVADSLLSYTEQYVEYD 294          

HSP 2 Score: 156.377 bits (394), Expect = 1.391e-40
Identity = 74/156 (47.44%), Postives = 107/156 (68.59%), Query Frame = 1
Query: 1480 NPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKK 1947
            NPW+SD+  FW  E S KE S +RVK+W F + E LKDP GRE+  K+LE EFS+ENL+FW A ++LK  P+R++  R++ I+ +FL+P A   +N+DSK  +     V       P R+ FE+A+EHI+KLM SDSY R++RS+ Y+EL+  ++K
Sbjct:  304 NPWLSDDTTFWELEAS-KEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENLRFWLAVEDLKRRPIREVPSRVQEIWQEFLAPGAPSAINLDSKSYDKTTQNV-----KEPGRYTFEDAQEHIYKLMKSDSYPRFIRSSAYQELLQAKRK 453          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Mouse
Match: Rgs6 (regulator of G-protein signaling 6 [Source:MGI Symbol;Acc:MGI:1354730])

HSP 1 Score: 255.758 bits (652), Expect = 2.666e-78
Identity = 129/279 (46.24%), Postives = 189/279 (67.74%), Query Frame = 1
Query:  418 SANEFIWRKIESIIERMQNEDTG-VQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXNVILWSS-----IEGNTLSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFD 1236
            S N  ++ KIE II +MQ++ TG V IRTVKS +S +PSV TG D+V W++K+L  E+ +EAIH+GS+IA+ GY+FPI+DH L MK+D  + YRFQ P  +PS C E +N +YA+YLCKRTMQNK RLELAD+EAE LA LQ  +  KWEFI++QAEA+ K+D+K+DK ER +L+SQE+ FWD +RP+ G  N  ++D+RK  R K P+K+          + S + +   S        + + +++  +   +++  +++SK  ESL +Y + Y E+D
Sbjct:   20 SPNMIVYCKIEDIITKMQDDKTGGVPIRTVKSFLSKIPSVVTGTDIVQWLMKNLSIEDPVEAIHLGSLIAAQGYIFPISDHVLTMKDDG-TFYRFQAPYFWPSNCWEPENTDYAIYLCKRTMQNKARLELADYEAENLARLQRAFARKWEFIFMQAEAQVKIDRKKDKTERKILDSQERAFWDVHRPVPGCVNTTEMDIRKCRRLKNPQKVKKSVYGVTDETQSQSPVHIPSQPIRKTTKDDIRKQITFLNAQIDRHCLKMSKVAESLIAYTEQYVEYD 297          
BLAST of Regulator of G-protein signaling 7 vs. UniProt/SwissProt
Match: sp|O46470|RGS7_BOVIN (Regulator of G-protein signaling 7 OS=Bos taurus OX=9913 GN=RGS7 PE=1 SV=1)

HSP 1 Score: 271.552 bits (693), Expect = 2.686e-82
Identity = 132/280 (47.14%), Postives = 193/280 (68.93%), Query Frame = 1
Query:  412 NQSANEFIWRKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXNVILWSSIEG-----NTLSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFD 1236
            ++S N  ++RK+E +I RMQ+E  G+ IRTVKS +S +PSVF+G D+V W+IK+L  E+ +EA+H+G+++A+ GY FPI+DH L +K+D  + YRFQTP  +PS C E +N +YAVYLCKRTMQNK RLELAD+EAE LA LQ  +  KWEFI++QAEA+AKVDKKRDK+ER +L+SQE+ FWD +RP+ G  N  ++D++K  R + P K             S +     + E      + L +++   ++ L++ R+++SK  +SL SY + Y E+D
Sbjct:   16 DESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGSDIVQWLIKNLTIEDPVEALHLGTLMAAHGYFFPISDHVLTLKDDG-TFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPGCVNTTEVDIKKSSRMRNPHKTRKSVYGLQNDIRSHSPTHTPTPETKPPTEDELQQQIKYWQIQLDRHRLKMSKVADSLLSYTEQYVEYD 294          

HSP 2 Score: 157.918 bits (398), Expect = 2.405e-40
Identity = 75/156 (48.08%), Postives = 107/156 (68.59%), Query Frame = 1
Query: 1480 NPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKK 1947
            NPW+SD+  FW  E S KE S +RVK+W F + E LKDP GRE+  K+LE EFS+ENL+FW A ++LK  P+R++  R++ I+ +FL+P A   +N+DSK  +     V       P R+ FE+A+EHI+KLM SDSY R++RS+ Y+EL+  +KK
Sbjct:  304 NPWLSDDTTFWELEAS-KEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENLRFWLAVEDLKKRPIREVPSRVQEIWQEFLAPGAPSAINLDSKSYDKTTQNV-----KEPGRYTFEDAQEHIYKLMKSDSYPRFIRSSAYQELLQAKKK 453          
BLAST of Regulator of G-protein signaling 7 vs. UniProt/SwissProt
Match: sp|O54829|RGS7_MOUSE (Regulator of G-protein signaling 7 OS=Mus musculus OX=10090 GN=Rgs7 PE=1 SV=2)

HSP 1 Score: 271.166 bits (692), Expect = 4.223e-82
Identity = 132/280 (47.14%), Postives = 193/280 (68.93%), Query Frame = 1
Query:  412 NQSANEFIWRKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXNVILWSSIEG-----NTLSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFD 1236
            ++S N  ++RK+E +I RMQ+E  G+ IRTVKS +S +PSVF+G D+V W+IK+L  E+ +EA+H+G+++A+ GY FPI+DH L +K+D  + YRFQTP  +PS C E +N +YAVYLCKRTMQNK RLELAD+EAE LA LQ  +  KWEFI++QAEA+AKVDKKRDK+ER +L+SQE+ FWD +RP+ G  N  ++D++K  R + P K             S +     + E      + L +++   ++ L++ R+++SK  +SL SY + Y E+D
Sbjct:   16 DESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGSDIVQWLIKNLTIEDPVEALHLGTLMAAHGYFFPISDHVLTLKDDG-TFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPGCVNTTEVDIKKSSRMRNPHKTRKSVYGLQNDIRSHSPTHTPTPETKPPTEDELHQQIKYWQIQLDRHRLKMSKVADSLLSYTEQYVEYD 294          

HSP 2 Score: 156.377 bits (394), Expect = 6.409e-40
Identity = 74/156 (47.44%), Postives = 107/156 (68.59%), Query Frame = 1
Query: 1480 NPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKK 1947
            NPW+SD+  FW  E S KE S +RVK+W F + E LKDP GRE+  K+LE EFS+ENL+FW A ++LK  P+R++  R++ I+ +FL+P A   +N+DSK  +     V       P R+ FE+A+EHI+KLM SDSY R++RS+ Y+EL+  ++K
Sbjct:  304 NPWLSDDTTFWELEAS-KEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENLRFWLAVEDLKRRPIREVPSRVQEIWQEFLAPGAPSAINLDSKSYDKTTQNV-----KEPGRYTFEDAQEHIYKLMKSDSYPRFIRSSAYQELLQAKRK 453          
BLAST of Regulator of G-protein signaling 7 vs. UniProt/SwissProt
Match: sp|P49802|RGS7_HUMAN (Regulator of G-protein signaling 7 OS=Homo sapiens OX=9606 GN=RGS7 PE=1 SV=3)

HSP 1 Score: 271.166 bits (692), Expect = 8.506e-82
Identity = 132/280 (47.14%), Postives = 193/280 (68.93%), Query Frame = 1
Query:  412 NQSANEFIWRKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXNVILWSSIEG-----NTLSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFD 1236
            ++S N  ++RK+E +I RMQ+E  G+ IRTVKS +S +PSVF+G D+V W+IK+L  E+ +EA+H+G+++A+ GY FPI+DH L +K+D  + YRFQTP  +PS C E +N +YAVYLCKRTMQNK RLELAD+EAE LA LQ  +  KWEFI++QAEA+AKVDKKRDK+ER +L+SQE+ FWD +RP+ G  N  ++D++K  R + P K             S +     + E      + L +++   ++ L++ R+++SK  +SL SY + Y E+D
Sbjct:   16 DESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGSDIVQWLIKNLTIEDPVEALHLGTLMAAHGYFFPISDHVLTLKDDG-TFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPGCVNTTEVDIKKSSRMRNPHKTRKSVYGLQNDIRSHSPTHTPTPETKPPTEDELQQQIKYWQIQLDRHRLKMSKVADSLLSYTEQYLEYD 294          

HSP 2 Score: 155.992 bits (393), Expect = 1.762e-39
Identity = 74/156 (47.44%), Postives = 107/156 (68.59%), Query Frame = 1
Query: 1480 NPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKK 1947
            NPW+SD+  FW  E S KE S +RVK+W F + E LKDP GRE+  K+LE EFS+ENL+FW A ++LK  P++++  R++ I+ +FL+P A   +N+DSK  +     V       P R+ FE+A+EHI+KLM SDSY R++RS+ Y+EL+  +KK
Sbjct:  304 NPWLSDDTTFWELEAS-KEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENLRFWLAVEDLKKRPIKEVPSRVQEIWQEFLAPGAPSAINLDSKSYDKTTQNV-----KEPGRYTFEDAQEHIYKLMKSDSYPRFIRSSAYQELLQAKKK 453          
BLAST of Regulator of G-protein signaling 7 vs. UniProt/SwissProt
Match: sp|P49803|RGS7_RAT (Regulator of G-protein signaling 7 OS=Rattus norvegicus OX=10116 GN=Rgs7 PE=1 SV=2)

HSP 1 Score: 269.626 bits (688), Expect = 1.765e-81
Identity = 136/298 (45.64%), Postives = 199/298 (66.78%), Query Frame = 1
Query:  358 IENGNNAFRGKSRLTEYPNQSANEFIWRKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXNVILWSSIEG-----NTLSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFD 1236
            +  GNN  +  + + E   +S N  ++RK+E +I RMQ+E  G+ IRTVKS +S +PSVF+G D+V W+IK+L  E+ +EA+H+G+++A+ GY FPI+DH L +K+D  + YRFQTP  +PS C E +N +YAVYLCKRTMQNK RLELAD+EAE LA LQ  +  KWEFI++QAEA+AKVDKKRDK+ER +L+SQE+ FWD +RP+ G  N  ++D++K  R + P K             S +     + E      + L  ++   ++ L++ R+++SK  +SL SY + Y E+D
Sbjct:    1 MAQGNNYGQTSNGVAE---ESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGSDIVQWLIKNLTIEDPVEALHLGTLMAAHGYFFPISDHVLTLKDDG-TFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPGCVNTTEVDIKKSSRMRNPHKTRKSVYGLQNDIRSHSPTHTPTPETKPPTEDELHRQIKYWQIQLDRHRLKMSKVADSLLSYTEQYVEYD 294          

HSP 2 Score: 156.377 bits (394), Expect = 8.662e-40
Identity = 74/156 (47.44%), Postives = 107/156 (68.59%), Query Frame = 1
Query: 1480 NPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKK 1947
            NPW+SD+  FW  E S KE S +RVK+W F + E LKDP GRE+  K+LE EFS+ENL+FW A ++LK  P+R++  R++ I+ +FL+P A   +N+DSK  +     V       P R+ FE+A+EHI+KLM SDSY R++RS+ Y+EL+  ++K
Sbjct:  304 NPWLSDDTTFWELEAS-KEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENLRFWLAVEDLKKRPIREVPSRVQEIWQEFLAPGAPSAINLDSKSYDKTTQNV-----KEPGRYTFEDAQEHIYKLMKSDSYPRFIRSSAYQELLQAKRK 453          
BLAST of Regulator of G-protein signaling 7 vs. UniProt/SwissProt
Match: sp|P49758|RGS6_HUMAN (Regulator of G-protein signaling 6 OS=Homo sapiens OX=9606 GN=RGS6 PE=1 SV=5)

HSP 1 Score: 256.529 bits (654), Expect = 1.439e-76
Identity = 129/280 (46.07%), Postives = 188/280 (67.14%), Query Frame = 1
Query:  418 SANEFIWRKIESIIERMQNEDTG-VQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXNV---ILWSSIEGNT---LSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFD 1236
            S N  ++ KIE II +MQ++ TG V IRTVKS +S +PSV TG D+V W++K+L  E+ +EAIH+GS+IA+ GY+FPI+DH L MK+D  + YRFQ P  +PS C E +N +YA+YLCKRTMQNK RLELAD+EAE LA LQ  +  KWEFI++QAEA+ K+D+K+DK ER +L+SQE+ FWD +RP+ G  N  ++D+RK CR  +  + + +S               +L   I   T   + +++  +   +++  +++SK  ESL +Y + Y E+D
Sbjct:   20 SPNMIVYCKIEDIITKMQDDKTGGVPIRTVKSFLSKIPSVVTGTDIVQWLMKNLSIEDPVEAIHLGSLIAAQGYIFPISDHVLTMKDDG-TFYRFQAPYFWPSNCWEPENTDYAIYLCKRTMQNKARLELADYEAENLARLQRAFARKWEFIFMQAEAQVKIDRKKDKTERKILDSQERAFWDVHRPVPGCVNTTEMDIRK-CRRLKNPQKVKKSVYGVTEESQAQSPVHVLSQPIRKTTKEDIRKQITFLNAQIDRHCLKMSKVAESLIAYTEQYVEYD 297          

HSP 2 Score: 157.918 bits (398), Expect = 2.046e-40
Identity = 74/156 (47.44%), Postives = 108/156 (69.23%), Query Frame = 1
Query: 1480 NPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKK 1947
            NPW+SD+   W  E+S KE S +RVK+W F+  E+LKD  GR++  ++LE EFS+ENL+FW A Q+LK  PL+D+ +R+E I+ +FL+P A   +N+DS   E  +  V +       R+ FE+A+EHI+KLM SDSY R+LRSN Y++L+  +KK
Sbjct:  307 NPWISDDVALWDIEMS-KEPSQQRVKRWGFSFDEILKDQVGRDQFLRFLESEFSSENLRFWLAVQDLKKQPLQDVAKRVEEIWQEFLAPGAPSAINLDSHSYEITSQNVKDGG-----RYTFEDAQEHIYKLMKSDSYARFLRSNAYQDLLLAKKK 456          
BLAST of Regulator of G-protein signaling 7 vs. TrEMBL
Match: A0A0X3NH39 (Regulator of G-protein signaling 7 OS=Schistocephalus solidus OX=70667 GN=RGS7 PE=4 SV=1)

HSP 1 Score: 520.005 bits (1338), Expect = 1.614e-174
Identity = 273/552 (49.46%), Postives = 373/552 (67.57%), Query Frame = 1
Query:  394 RLTEYP--NQSANEFIWRKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXNVILWSSIEGNTLSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFDMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVNMSGSITQS----------QCALSSAAGAPSGFNCPPTGTTGMESTAGINGIDM-----STSAINPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVA-------------NSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKKKSKK 1959
            R  E P    S N F++ ++ES++E M +E  G+ IR VK L+S++PSV +G D+V W+I H GA+++ EA+H+GS I++MGYLF I DH + +KND+H+ YRFQTPCLYPS+C E D ++YAVYLCKRTMQNK RLEL+ FEAERLA+LQ+ Y+HKWEFIY+QAEAE KVDKKRDK ER+VLESQE  +WD +RP  G  N  ++DMRKLCR+KRPKK   R + FPI +G G  +L + +EG T SEK+AK+R ++  KR+RVSKAIE+L +Y D Y EFD++L    ++    +G     + G         + +G++             + + ++ A   +      TG T   + +   G D      S S  NPW+SDN ++W    S++++S +RVK+WSF+  ELLKDP GR + Q+WLEKEF+AENL FW+ CQ+LK APLR+L RRI+ IY+Q+LS SA EP+NVDSKV E + +R+               +   + DR+CFEEAEE IF+LM +DSY R+LRS++Y+EL A  KKKSKK
Sbjct:    2 RQLEMPETKDSPNAFLFHRLESLVEAMVSESGGIPIRNVKGLVSSIPSVVSGADIVLWLICHAGADDISEAVHLGSCISAMGYLFSIDDHMMVVKNDSHTYYRFQTPCLYPSRCPEADTVDYAVYLCKRTMQNKHRLELSAFEAERLASLQNLYYHKWEFIYMQAEAEVKVDKKRDKFERIVLESQEAAYWDVHRPAPGCVNTTEVDMRKLCRAKRPKKAPLRPTGFPIPTGPGGQLLLNVLEGLTPSEKLAKLRASMH-KRVRVSKAIENLQNYCDQYAEFDIMLCTAVSAVSSSAGCAAQLSGGQIGSVPGTASPAGAMVSGSSSAMPLMLRKSSTAALAAHSTTMGLALTGVTHPSTPSSDKGTDNSDRQDSPSQSNPWISDNVDYWNMSTSMQDLSIKRVKRWSFSFMELLKDPIGRGKFQRWLEKEFAAENLMFWQQCQDLKSAPLRELPRRIQFIYSQYLSLSAAEPVNVDSKVREIIFHRLGLNETNELERGATVGAGAGHMDRYCFEEAEEQIFQLMKTDSYCRFLRSDVYRELFASTKKKSKK 552          
BLAST of Regulator of G-protein signaling 7 vs. TrEMBL
Match: A0A0X3PYX8 (Regulator of G-protein signaling 7 OS=Schistocephalus solidus OX=70667 GN=RGS7 PE=4 SV=1)

HSP 1 Score: 521.546 bits (1342), Expect = 1.085e-173
Identity = 273/552 (49.46%), Postives = 373/552 (67.57%), Query Frame = 1
Query:  394 RLTEYP--NQSANEFIWRKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXNVILWSSIEGNTLSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFDMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVNMSGSITQS----------QCALSSAAGAPSGFNCPPTGTTGMESTAGINGIDM-----STSAINPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVA-------------NSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKKKSKK 1959
            R  E P    S N F++ ++ES++E M +E  G+ IR VK L+S++PSV +G D+V W+I H GA+++ EA+H+GS I++MGYLF I DH + +KND+H+ YRFQTPCLYPS+C E D ++YAVYLCKRTMQNK RLEL+ FEAERLA+LQ+ Y+HKWEFIY+QAEAE KVDKKRDK ER+VLESQE  +WD +RP  G  N  ++DMRKLCR+KRPKK   R + FPI +G G  +L + +EG T SEK+AK+R ++  KR+RVSKAIE+L +Y D Y EFD++L    ++    +G     + G         + +G++             + + ++ A   +      TG T   + +   G D      S S  NPW+SDN ++W    S++++S +RVK+WSF+  ELLKDP GR + Q+WLEKEF+AENL FW+ CQ+LK APLR+L RRI+ IY+Q+LS SA EP+NVDSKV E + +R+               +   + DR+CFEEAEE IF+LM +DSY R+LRS++Y+EL A  KKKSKK
Sbjct:  104 RQLEMPETKDSPNAFLFHRLESLVEAMVSESGGIPIRNVKGLVSSIPSVVSGADIVLWLICHAGADDISEAVHLGSCISAMGYLFSIDDHMMVVKNDSHTYYRFQTPCLYPSRCPEADTVDYAVYLCKRTMQNKHRLELSAFEAERLASLQNLYYHKWEFIYMQAEAEVKVDKKRDKFERIVLESQEAAYWDVHRPAPGCVNTTEVDMRKLCRAKRPKKAPLRPTGFPIPTGPGGQLLLNVLEGLTPSEKLAKLRASMH-KRVRVSKAIENLQNYCDQYAEFDIMLCTAVSAVSSSAGCAAQLSGGQIGSVPGTASPAGAMVSGSSSAMPLMLRKSSTAALAAHSTTMGLALTGVTHPSTPSSDKGTDNSDRQDSPSQSNPWISDNVDYWNMSTSMQDLSIKRVKRWSFSFMELLKDPIGRGKFQRWLEKEFAAENLMFWQQCQDLKSAPLRELPRRIQFIYSQYLSLSAAEPVNVDSKVREIIFHRLGLNETNEVERGATVGAGAGHMDRYCFEEAEEQIFQLMKTDSYCRFLRSDVYRELFASTKKKSKK 654          
BLAST of Regulator of G-protein signaling 7 vs. TrEMBL
Match: A0A0V0J623 (Regulator of G-protein signaling 7 OS=Schistocephalus solidus OX=70667 GN=RGS7 PE=4 SV=1)

HSP 1 Score: 521.546 bits (1342), Expect = 1.748e-173
Identity = 273/552 (49.46%), Postives = 373/552 (67.57%), Query Frame = 1
Query:  394 RLTEYP--NQSANEFIWRKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXNVILWSSIEGNTLSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFDMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVNMSGSITQS----------QCALSSAAGAPSGFNCPPTGTTGMESTAGINGIDM-----STSAINPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVA-------------NSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKKKSKK 1959
            R  E P    S N F++ ++ES++E M +E  G+ IR VK L+S++PSV +G D+V W+I H GA+++ EA+H+GS I++MGYLF I DH + +KND+H+ YRFQTPCLYPS+C E D ++YAVYLCKRTMQNK RLEL+ FEAERLA+LQ+ Y+HKWEFIY+QAEAE KVDKKRDK ER+VLESQE  +WD +RP  G  N  ++DMRKLCR+KRPKK   R + FPI +G G  +L + +EG T SEK+AK+R ++  KR+RVSKAIE+L +Y D Y EFD++L    ++    +G     + G         + +G++             + + ++ A   +      TG T   + +   G D      S S  NPW+SDN ++W    S++++S +RVK+WSF+  ELLKDP GR + Q+WLEKEF+AENL FW+ CQ+LK APLR+L RRI+ IY+Q+LS SA EP+NVDSKV E + +R+               +   + DR+CFEEAEE IF+LM +DSY R+LRS++Y+EL A  KKKSKK
Sbjct:  118 RQLELPETKDSPNAFLFHRLESLVEAMVSESGGIPIRNVKGLVSSIPSVVSGADIVLWLICHAGADDISEAVHLGSCISAMGYLFSIDDHMMVVKNDSHTYYRFQTPCLYPSRCPEADTVDYAVYLCKRTMQNKHRLELSAFEAERLASLQNLYYHKWEFIYMQAEAEVKVDKKRDKFERIVLESQEAAYWDVHRPAPGCVNTTEVDMRKLCRAKRPKKAPLRPTGFPIPTGPGGQLLLNVLEGLTPSEKLAKLRASMH-KRVRVSKAIENLQNYCDQYAEFDIMLCTAVSAVSSSAGCAAQLSGGQIGSVPGTASPAGAMVSGSSSAMPLMLRKSSTAALAAHSTTMGLALTGVTHPSTPSSDKGTDNSDRQDSPSQSNPWISDNVDYWNMSTSMQDLSIKRVKRWSFSFMELLKDPIGRGKFQRWLEKEFAAENLMFWQQCQDLKSAPLRELPRRIQFIYSQYLSLSAAEPVNVDSKVREIIFHRLGLNETNELERGATVGAGAGHMDRYCFEEAEEQIFQLMKTDSYCRFLRSDVYRELFASTKKKSKK 668          
BLAST of Regulator of G-protein signaling 7 vs. TrEMBL
Match: A0A0X3PFZ4 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR158681 PE=4 SV=1)

HSP 1 Score: 504.982 bits (1299), Expect = 5.677e-169
Identity = 264/526 (50.19%), Postives = 358/526 (68.06%), Query Frame = 1
Query:  466 MQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXNVILWSSIEGNTLSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFDMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVNMSGSITQS----------QCALSSAAGAPSGFNCPPTGTTGMESTAGINGIDM-----STSAINPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVA-------------NSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKKKSKK 1959
            M +E  G+ IR VK L+S++PSV +G D+V W+I H GA+++ EA+H+GS I++MGYLF I DH + +KND+H+ YRFQTPCLYPS+C E D ++YAVYLCKRTMQNK RLEL+ FEAERLA+LQ+ Y+HKWEFIY+QAEAE KVDKKRDK ER+VLESQE  +WD +RP  G  N  ++DMRKLCR+KRPKK   R + FPI +G G  +L + +EG T SEK+AK+R ++  KR+RVSKAIE+L +Y D Y EFD++L    ++    +G     + G         + +G++             + + ++ A   +      TG T   + +   G D      S S  NPW+SDN ++W    S++++S +RVK+WSF+  ELLKDP GR + Q+WLEKEF+AENL FW+ CQ+LK APLR+L RRI+ IY+Q+LS SA EP+NVDSKV E + +R+               +   + DR+CFEEAEE IF+LM +DSY R+LRS++Y+EL A  KKKSKK
Sbjct:    1 MVSESGGIPIRNVKGLVSSIPSVVSGADIVLWLICHAGADDISEAVHLGSCISAMGYLFSIDDHMMVVKNDSHTYYRFQTPCLYPSRCPEADTVDYAVYLCKRTMQNKHRLELSAFEAERLASLQNLYYHKWEFIYMQAEAEVKVDKKRDKFERIVLESQEAAYWDVHRPAPGCVNTTEVDMRKLCRAKRPKKAPLRPTGFPIPTGPGGQLLLNVLEGLTPSEKLAKLRASMH-KRVRVSKAIENLQNYCDQYAEFDIMLCTAVSAVSSSAGCAAQLSGGQIGSVPGTASPAGAMVSGSSSAMPLMLRKSSTAALAAHSTTMGLALTGVTHPSTPSSDKGTDNSDRQDSPSQSNPWISDNVDYWNMSTSMQDLSIKRVKRWSFSFMELLKDPIGRGKFQRWLEKEFAAENLMFWQQCQDLKSAPLRELPRRIQFIYSQYLSLSAAEPVNVDSKVREIIFHRLGLNETNELERGATVGAGAGHMDRYCFEEAEEQIFQLMKTDSYCRFLRSDVYRELFASTKKKSKK 525          
BLAST of Regulator of G-protein signaling 7 vs. TrEMBL
Match: A0A068Y486 (Regulator of G protein signaling 7 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000714100 PE=4 SV=1)

HSP 1 Score: 493.041 bits (1268), Expect = 3.856e-163
Identity = 276/603 (45.77%), Postives = 372/603 (61.69%), Query Frame = 1
Query:  418 SANEFIWRKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXNV-------ILWSSIEGNTLSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFDMXXXXXXX-------XXXXXXXXXXXXXXXXXXXXXXVVNMSGSIT---------------QSQCALSSAAGAPSGFNCPPTGTTGMESTAGINGIDMSTSAINPWVSDNA-----EFWANE-------------ISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESV---------------------------------------ANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAG---QKKKSKK 1959
            S NE++WR++E +++ M +ED G+ IR VK+ MS +PSVF+G D+V W + H GA++V EA+H+ S IA+MGYLFPI DH++ +KND+H+ YRFQ PCLYPS+C E D ++YAVYLCKRTMQNK RLELADFEAERLA+LQS Y+HKWEFIY+QAEAE KVDKKRDK+ER+VLESQE  FW+ +RP  G  N  ++DMRKLCR+KRPKK    +      +    V       +L+S +EG + +EKV K+R A E KRI+ SKAIE+L +Y D Y++FDMLL             GG       +  S   + +TS V++SG+ +               ++   L+   GA       P   + +   +G   +D++  + NPW+SDN       +W +              + L E+S  RVK+WSF+ QELLKDP GR + Q WLEKEF+AENL FW+ CQELK APLR+L +RI++IY+ +LS +A EP+NVDSKV E+V                                       +  V  +  S+ DR+CFEEAEE IF+LM S SY R+LRS+IY+EL A    +KK+SKK
Sbjct:   18 SPNEYLWRRLEVLVDYMVSEDQGIPIRNVKNFMSVIPSVFSGSDIVLWFMVHAGADDVAEAVHLASRIAAMGYLFPIDDHAMTVKNDSHTYYRFQAPCLYPSRCPEADTVDYAVYLCKRTMQNKHRLELADFEAERLASLQSLYYHKWEFIYMQAEAEMKVDKKRDKLERVVLESQEAAFWNVHRPAPGCVNTTEVDMRKLCRAKRPKKTGLAAGRLHPVTFPIPVASGVAGNLLFSVLEGLSPAEKVTKLR-ASEHKRIKASKAIENLQNYCDQYFDFDMLLYCATTSTSSGGYDGGGGGSGGGAVGSSKALATTSGVDISGAASATSAVSTAHHLLLPRRTSAGLNVTHGAVVNLILGPPPASALSGASGDVQMDLAGQS-NPWLSDNVTAAAENYWGSSTAVGAGGSGLGSAVQLGELSIPRVKRWSFSFQELLKDPLGRAKFQCWLEKEFAAENLMFWQECQELKSAPLRELPQRIQSIYSHYLSLTAPEPVNVDSKVREAVFRRLGLLRLLPPLNQETGGMEPLMEGTMLEPLSLNADATSPVVVGAGASHADRYCFEEAEEQIFQLMKSASYCRFLRSDIYRELFANSATKKKQSKK 618          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Cavefish
Match: rgs7a (regulator of G protein signaling 7a [Source:ZFIN;Acc:ZDB-GENE-040718-276])

HSP 1 Score: 263.077 bits (671), Expect = 2.165e-80
Identity = 114/202 (56.44%), Postives = 158/202 (78.22%), Query Frame = 1
Query:  412 NQSANEFIWRKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRK 1017
            + S N  ++RK+E +I RMQ+E  G+ IRTVKS +S +PSVF+G D+V W++K+L  E+ +EA+H+G+++A+ GY FPI+DH L +K+D  + YRFQTP  +PS C E +N +YAVYLCKRTMQNK RLELAD+EAE LA LQ  +  KWEFI++QAEA+AKVDKKRDK+ER +L+SQE+ FWD +RP+ G  N  ++D++K
Sbjct:   16 DDSPNMLVYRKMEDLIARMQDEKNGIPIRTVKSFLSKIPSVFSGSDIVQWLVKNLNIEDQVEALHMGTLMAAHGYFFPISDHVLTLKDDG-TFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPGCVNTTEVDIKK 216          

HSP 2 Score: 155.992 bits (393), Expect = 5.264e-41
Identity = 82/201 (40.80%), Postives = 122/201 (60.70%), Query Frame = 1
Query: 1387 APSGFNCPPTGTTGMESTAGINGIDMSTSAINPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKKK---SKKRFPADIR 1980
            +PS   C    T     +  +  + +S S INP +  +         L+E +  RVK+W F + E+LKDPAGRE+  K+LE EFS+ENL+FW A QELK  P+R++  R++ I+ +FL+P A   +NVDSK  +     V      +P R+ FE+A+EHI+KLM SDSY R++RS+ Y+EL+  +KK    + KR PA ++
Sbjct:  236 SPSLSQCNLHQTQCKFISKAVQSLCISKSPINPQIITDCTTVVALEHLREPTQSRVKRWGFGMDEVLKDPAGREQFLKFLESEFSSENLRFWLAVQELKRRPIREVPTRVQEIWQEFLAPGAPSAINVDSKSYDKTTQNV-----KDPGRYAFEDAQEHIYKLMKSDSYSRFIRSSAYQELLQAKKKGKSLASKRLPAVVQ 431          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Cavefish
Match: rgs6 (regulator of G-protein signaling 6 [Source:NCBI gene;Acc:103032052])

HSP 1 Score: 262.307 bits (669), Expect = 1.282e-79
Identity = 127/278 (45.68%), Postives = 188/278 (67.63%), Query Frame = 1
Query:  418 SANEFIWRKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXNVILWSSIEGNT-----LSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFD 1236
            S N  ++RKIE I+ R+Q+E  GV IRTVKS MS +PSV TG D+V W++K+L  E+  EA+H+GS+IA+ GY+FPI+DH L +K+D  + YRFQ P  +PS C E +N +YA+YLCKRTMQNK RLELAD+EAE LA LQ  +  KWEFI++QAEA+ K+D+K+DK ER +L+SQE+ FWD +RP+ G  N  ++D+RK  R K P+++          + + + +   S +        + +++  +   L++  +++SK  E+L SY + Y E+D
Sbjct:   44 SPNMIVYRKIEDIVTRIQDETEGVPIRTVKSFMSKIPSVVTGTDIVQWLMKNLSIEDPAEALHIGSLIAAQGYIFPISDHVLTLKDDG-TFYRFQAPYFWPSNCWEPENTDYAIYLCKRTMQNKTRLELADYEAENLARLQRAFARKWEFIFMQAEAQVKIDRKKDKTERKILDSQERAFWDVHRPVPGCVNTTEMDIRKCRRMKNPQRVKKSVYGVAEDTQTQSPVHTQSQQSRKDTKEDVEKEILFLNTQLDRHCMKMSKVAETLMSYTEQYLEYD 320          

HSP 2 Score: 84.7297 bits (208), Expect = 6.649e-17
Identity = 49/132 (37.12%), Postives = 77/132 (58.33%), Query Frame = 1
Query: 1564 SFTIQELLKDP--AGREEIQKWLEKEFSAENL--KFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKK 1947
            S+T Q L  DP     E    W+  + +   L  +FW A Q+LK  PL+D+  R + I+ +FL+  A   +N+DS   E  +  +      +P R+ FE+A++HI+KLM SDSY R+LRS+ Y++L+  +KK
Sbjct:  311 SYTEQYLEYDPFVCTPEPSNPWVGDDCTFWELEARFWLAVQDLKRRPLQDVPARAQEIWQEFLAEGAPSSINLDSHSFERTSQNL-----KDPGRYSFEDAQDHIYKLMKSDSYTRFLRSSAYQDLLLARKK 437          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Cavefish
Match: rgs6 (regulator of G-protein signaling 6 [Source:NCBI gene;Acc:103032052])

HSP 1 Score: 262.692 bits (670), Expect = 1.340e-79
Identity = 127/278 (45.68%), Postives = 188/278 (67.63%), Query Frame = 1
Query:  418 SANEFIWRKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXNVILWSSIEGNT-----LSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFD 1236
            S N  ++RKIE I+ R+Q+E  GV IRTVKS MS +PSV TG D+V W++K+L  E+  EA+H+GS+IA+ GY+FPI+DH L +K+D  + YRFQ P  +PS C E +N +YA+YLCKRTMQNK RLELAD+EAE LA LQ  +  KWEFI++QAEA+ K+D+K+DK ER +L+SQE+ FWD +RP+ G  N  ++D+RK  R K P+++          + + + +   S +        + +++  +   L++  +++SK  E+L SY + Y E+D
Sbjct:   20 SPNMIVYRKIEDIVTRIQDETEGVPIRTVKSFMSKIPSVVTGTDIVQWLMKNLSIEDPAEALHIGSLIAAQGYIFPISDHVLTLKDDG-TFYRFQAPYFWPSNCWEPENTDYAIYLCKRTMQNKTRLELADYEAENLARLQRAFARKWEFIFMQAEAQVKIDRKKDKTERKILDSQERAFWDVHRPVPGCVNTTEMDIRKCRRMKNPQRVKKSVYGVAEDTQTQSPVHTQSQQSRKDTKEDVEKEILFLNTQLDRHCMKMSKVAETLMSYTEQYLEYD 296          

HSP 2 Score: 149.443 bits (376), Expect = 3.042e-38
Identity = 71/156 (45.51%), Postives = 107/156 (68.59%), Query Frame = 1
Query: 1480 NPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKK 1947
            NPWV D+  FW  E S K+ S +RV+KW F+++E LKDP G+++  K+LE EFS+ENL+FW A Q+LK  PL+D+  R + I+ +FL+  A   +N+DS   E  +  +      +P R+ FE+A++HI+KLM SDSY R+LRS+ Y++L+  +KK
Sbjct:  306 NPWVGDDCTFWELEAS-KDPSQQRVRKWGFSLEEALKDPVGQDQFLKFLESEFSSENLRFWLAVQDLKRRPLQDVPARAQEIWQEFLAEGAPSSINLDSHSFERTSQNL-----KDPGRYSFEDAQDHIYKLMKSDSYTRFLRSSAYQDLLLARKK 455          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Cavefish
Match: rgs6 (regulator of G-protein signaling 6 [Source:NCBI gene;Acc:103032052])

HSP 1 Score: 258.07 bits (658), Expect = 1.414e-78
Identity = 113/200 (56.50%), Postives = 153/200 (76.50%), Query Frame = 1
Query:  418 SANEFIWRKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRK 1017
            S N  ++RKIE I+ R+Q+E  GV IRTVKS MS +PSV TG D+V W++K+L  E+  EA+H+GS+IA+ GY+FPI+DH L +K+D  + YRFQ P  +PS C E +N +YA+YLCKRTMQNK RLELAD+EAE LA LQ  +  KWEFI++QAEA+ K+D+K+DK ER +L+SQE+ FWD +RP+ G  N  ++D+RK
Sbjct:   44 SPNMIVYRKIEDIVTRIQDETEGVPIRTVKSFMSKIPSVVTGTDIVQWLMKNLSIEDPAEALHIGSLIAAQGYIFPISDHVLTLKDDG-TFYRFQAPYFWPSNCWEPENTDYAIYLCKRTMQNKTRLELADYEAENLARLQRAFARKWEFIFMQAEAQVKIDRKKDKTERKILDSQERAFWDVHRPVPGCVNTTEMDIRK 242          

HSP 2 Score: 84.3445 bits (207), Expect = 8.262e-17
Identity = 40/97 (41.24%), Postives = 63/97 (64.95%), Query Frame = 1
Query: 1657 FWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKK 1947
            FW A Q+LK  PL+D+  R + I+ +FL+  A   +N+DS   E  +  +      +P R+ FE+A++HI+KLM SDSY R+LRS+ Y++L+  +KK
Sbjct:  309 FWLAVQDLKRRPLQDVPARAQEIWQEFLAEGAPSSINLDSHSFERTSQNL-----KDPGRYSFEDAQDHIYKLMKSDSYTRFLRSSAYQDLLLARKK 400          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Cavefish
Match: rgs6 (regulator of G-protein signaling 6 [Source:NCBI gene;Acc:103032052])

HSP 1 Score: 222.631 bits (566), Expect = 1.967e-65
Identity = 95/168 (56.55%), Postives = 130/168 (77.38%), Query Frame = 1
Query:  514 MSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRK 1017
            MS +PSV TG D+V W++K+L  E+  EA+H+GS+IA+ GY+FPI+DH L +K+D  + YRFQ P  +PS C E +N +YA+YLCKRTMQNK RLELAD+EAE LA LQ  +  KWEFI++QAEA+ K+D+K+DK ER +L+SQE+ FWD +RP+ G  N  ++D+RK
Sbjct:    1 MSKIPSVVTGTDIVQWLMKNLSIEDPAEALHIGSLIAAQGYIFPISDHVLTLKDDG-TFYRFQAPYFWPSNCWEPENTDYAIYLCKRTMQNKTRLELADYEAENLARLQRAFARKWEFIFMQAEAQVKIDRKKDKTERKILDSQERAFWDVHRPVPGCVNTTEMDIRK 167          

HSP 2 Score: 132.494 bits (332), Expect = 5.628e-33
Identity = 62/139 (44.60%), Postives = 97/139 (69.78%), Query Frame = 1
Query: 1531 KEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKK 1947
            K+ S +RV+KW F+++E LKDP G+++  K+LE EFS+ENL+FW A Q+LK  PL+D+  R + I+ +FL+  A   +N+DS   E  +  +      +P R+ FE+A++HI+KLM SDSY R+LRS+ Y++L+  +KK
Sbjct:  234 KDPSQQRVRKWGFSLEEALKDPVGQDQFLKFLESEFSSENLRFWLAVQDLKRRPLQDVPARAQEIWQEFLAEGAPSSINLDSHSFERTSQNL-----KDPGRYSFEDAQDHIYKLMKSDSYTRFLRSSAYQDLLLARKK 367          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Sea Lamprey
Match: RGS7 (regulator of G protein signaling 7 [Source:HGNC Symbol;Acc:HGNC:10003])

HSP 1 Score: 249.595 bits (636), Expect = 4.409e-79
Identity = 110/194 (56.70%), Postives = 152/194 (78.35%), Query Frame = 1
Query:  442 KIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLC 1023
            ++E I+ RMQ++ +GV IRTVKS +S +PSVFTG D+V W+ K+L  ++  +A+HVG+++A+ GY FPI+DH L +K+D  + YRFQTP  +PS C + +N +YAVYLCKRTMQNK RLELAD+EAE LA LQ  +  KWEFI++QAEA+AKVDKKRDK+ER +L+SQE+ FWD +RP+ G  N  ++D++K C
Sbjct:    1 QMEEIVTRMQDDKSGVPIRTVKSFLSKIPSVFTGADIVQWLTKNLIIDDQDKALHVGTLMAAHGYFFPISDHVLMLKDDG-TFYRFQTPFFWPSNCWDPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPGCVNTTEMDIKKSC 193          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Sea Lamprey
Match: RGS7 (regulator of G protein signaling 7 [Source:HGNC Symbol;Acc:HGNC:10003])

HSP 1 Score: 253.062 bits (645), Expect = 8.259e-77
Identity = 126/285 (44.21%), Postives = 182/285 (63.86%), Query Frame = 1
Query:  397 LTEYPNQSANEFIWRKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXNVILWSSIEG-----NTLSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFD 1236
            L E+PN     F  + +E  ++RMQ ED GV +RTVK  M+ +PSVFTG D++ W++K+L  E+  EA+H+GS+IA+ GY FPI++H L +K+D  + YRFQTP  +PS C E +N++YAVYLCKRT+QNK R ELAD+EAE LA LQ  +  KWEFI +Q+EA+AK+D+KR+KVE+ + ESQE+ FWD +RP+ G  N  ++DM+K CR + P +              G+       +      + L  +V  +   L    ++ SK  ESL  Y++ Y E+D
Sbjct:   19 LAEFPNV----FTLKPMEDTVKRMQEEDVGVPVRTVKGFMTKIPSVFTGADIIQWLMKNLSIEDQAEALHLGSLIAAHGYFFPISEHVLTLKDDG-TFYRFQTPYFWPSNCWEPENMDYAVYLCKRTLQNKSRSELADYEAESLARLQQAFARKWEFIVMQSEAQAKIDRKREKVEKKITESQERAFWDVHRPVPGCVNTTEVDMKKSCRIRDPHRTRKSVYGLQDECTGGSPPPTPPPDAKKPTMDELRRRVEFLNTQLNWHCMKTSKVAESLIGYSEQYMEYD 298          

HSP 2 Score: 152.91 bits (385), Expect = 2.734e-40
Identity = 74/160 (46.25%), Postives = 108/160 (67.50%), Query Frame = 1
Query: 1468 TSAINPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKK 1947
            T   NPW SD+  FW  E S KE S ++V++W F+  E+L DPAG++   ++L+ EFS+ENL+FW+A QELK  PLR++   ++ I+ +FL+P AL  +N+DS   E  A  +       P R+ FE+A+EHI+KLM SDSY R+LRS IY+E++  +KK
Sbjct:  304 TEPSNPWQSDDPTFWDMESS-KEPSQQQVRRWGFSFDEVLHDPAGQDRFLRFLQSEFSSENLEFWQAVQELKRRPLREVPEHVQRIWEEFLAPGALNSINLDSHSFERTAQNIC-----EPCRYTFEDAQEHIYKLMKSDSYGRFLRSPIYQEVLLTRKK 457          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Sea Lamprey
Match: RGS7 (regulator of G protein signaling 7 [Source:HGNC Symbol;Acc:HGNC:10003])

HSP 1 Score: 192.2 bits (487), Expect = 2.978e-58
Identity = 84/146 (57.53%), Postives = 116/146 (79.45%), Query Frame = 1
Query:  541 GVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPI 978
            G D+V W++K+L  ++  EA+H+G+ +A+ GY FPI+DH L +K+D  +LYRFQ P  +PS C + +N +YAVYLCKRTMQNK RLELAD+EAE LA LQ  +  KWEFI++QAEA+A+VD+KR+K+ER V+ESQE+ FWD +RP+
Sbjct:    2 GTDIVQWLMKNLNTQDQAEALHLGTQMAAHGYFFPISDHVLALKDDG-ALYRFQNPYFWPSNCWDPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFDRKWEFIFMQAEAQARVDRKREKLERKVMESQERAFWDVHRPV 146          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010444.1 (pep scaffold:Pmarinus_7.0:GL482357:14059:16996:-1 gene:ENSPMAG00000009454.1 transcript:ENSPMAT00000010444.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 146.747 bits (369), Expect = 5.656e-41
Identity = 74/155 (47.74%), Postives = 102/155 (65.81%), Query Frame = 1
Query: 1480 NPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQK 1944
            NPW SD+A FW  E + KE S +RV +W F + E+LKD  G+E+  ++L+ EFS+ENL+FW A QELK  PLR +  R   I+ +FL P A   +N+DS   E  A+ V       P RF F++A+EHI+ LM +DSY R+LRSN Y+EL+A +K
Sbjct:    7 NPWASDDASFWELE-TRKEPSHQRVLRWGFCMDEVLKDSVGQEQFLRFLQSEFSSENLQFWVAVQELKRLPLRKVADRAREIWQEFLEPGAPNTINLDSHSFERTAHNV-----REPGRFAFQDAQEHIYMLMKTDSYARFLRSNNYQELLAARK 155          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010442.1 (pep scaffold:Pmarinus_7.0:GL482357:13581:16779:-1 gene:ENSPMAG00000009454.1 transcript:ENSPMAT00000010442.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.494 bits (332), Expect = 2.795e-36
Identity = 67/147 (45.58%), Postives = 93/147 (63.27%), Query Frame = 1
Query: 1531 KEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKKKSKKRFPA 1971
            KE S +RV +W F + E+LKD  G+E+  ++L+ EFS+ENL+FW A QELK  PLR +  R   I+ +FL P A   +N+DS   E  A+ V       P RF F++A+EHI+ LM +DSY R+LRSN Y+EL+A +K      FP 
Sbjct:    3 KEPSHQRVLRWGFCMDEVLKDSVGQEQFLRFLQSEFSSENLQFWVAVQELKRLPLRKVADRAREIWQEFLEPGAPNTINLDSHSFERTAHNV-----REPGRFAFQDAQEHIYMLMKTDSYARFLRSNNYQELLAARKMAENGLFPC 144          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Nematostella
Match: EDO34351 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPN2])

HSP 1 Score: 236.113 bits (601), Expect = 5.229e-71
Identity = 124/264 (46.97%), Postives = 172/264 (65.15%), Query Frame = 1
Query:  445 IESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXNVILWSSIEGNTLSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFD 1236
            +E II+RMQ+E  GV IRTVKS MS +PSV TG +LV W++ +L  E+  E +H+ S++A+ GY+F ITDH L +K+D+ S YRFQTP  + S   E +NI+YAVYLCKRTMQNK RLEL D+EAE LA LQ     KW+FIY+QAEA+AKVDKKRDK+ER +L+SQE+ FW+ +RP  G  +  +ID++K C+                            +  N+   KV ++R  L ++R++ S+A ES+ +  + Y EFD
Sbjct:    1 MEKIIQRMQDERKGVPIRTVKSFMSKIPSVLTGSELVDWMMDNLMIEDRGEGVHLASLLAAYGYVFSITDHHLMVKDDS-SYYRFQTPYFWLSNNWEPENIDYAVYLCKRTMQNKSRLELDDYEAENLAKLQRTLSRKWDFIYMQAEAQAKVDKKRDKMERQILDSQERAFWNVHRPPPGCVSVTEIDIKKACKV--------------------------EMSPNS-KRKVQELREQLHRRRMKTSQASESIINRYEQYAEFD 236          

HSP 2 Score: 160.614 bits (405), Expect = 2.429e-43
Identity = 74/176 (42.05%), Postives = 109/176 (61.93%), Query Frame = 1
Query: 1432 ESTAGINGIDMSTSAINPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKKKSKK 1959
            E  A  +   M     NPW++D+  FW  + S+  V  +RVK+W+F++ ELLKDP GR+   ++LEKEFSAENL FW AC+ LK  P++ +  + + IY ++LS  +  P+NVD K  E V       +   P R+ F+ A++HIF+LM SDSY R+LRS +YKEL+     K ++
Sbjct:  230 EQYAEFDAFIMYPEPSNPWITDDITFWEQDCSITIVPQKRVKRWAFSLSELLKDPLGRKYFTRFLEKEFSAENLAFWLACERLKATPIKQVPEKAQEIYTEYLSEHSTSPINVDCKTHEEV-----EMNLEKPGRYMFDAAQDHIFQLMKSDSYSRFLRSELYKELLKAPSYKQRR 400          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Nematostella
Match: EDO43126 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZM8])

HSP 1 Score: 89.7373 bits (221), Expect = 1.622e-18
Identity = 44/129 (34.11%), Postives = 74/129 (57.36%), Query Frame = 1
Query: 1549 RVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKG-APLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELM 1932
            RV +W+    +L+ D AG    +++L+KEFS EN+ FW AC+E +  +  + L      I+   LSP+AL P+N+DS      A +VA     NP    +   ++ ++ LM  DSY R+L+S++Y++ +
Sbjct:  650 RVSRWALGFDKLMDDQAGLHCFEEFLKKEFSEENIVFWIACEEFRSISDPKKLKSAASTIFETHLSPNALMPVNIDSS-----AVKVAEEHLLNPTNHMYRVPQQQVYTLMKFDSYPRFLKSDLYRQCL 773          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Nematostella
Match: EDO32804 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU35])

HSP 1 Score: 68.1662 bits (165), Expect = 1.786e-13
Identity = 37/128 (28.91%), Postives = 69/128 (53.91%), Query Frame = 1
Query: 1552 VKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRI-EAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELM 1932
            +K W      LL    G  + Q++L  ++  ENL FW A ++ +    R+  R +   IY  ++S  +   +++D+K+  +V     + S S+PD+  F+ A++HI+ LM  D + R+++S  YK L+
Sbjct:   39 MKNWKHDFHALLSSKYGVNQFQEFLRSQYGEENLCFWLAVEDYRRLEDRESRRDMARMIYEDYVSTLSPTEISLDAKIRATV-----DKSMSDPDQNTFDPAQDHIYTLMYHDCFPRFIKSKHYKNLI 161          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Nematostella
Match: EDO37370 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFZ6])

HSP 1 Score: 65.0846 bits (157), Expect = 2.074e-12
Identity = 39/134 (29.10%), Postives = 71/134 (52.99%), Query Frame = 1
Query: 1540 SSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKG----APLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKEL 1929
            SS  + +W  + + LL    G     ++L+ E+S ENL FW A + LK     A +++L    + IYN ++S  + + +++D K       +V +   S P +  F +A++H++ +M  D Y R+L S+ +K L
Sbjct:   26 SSEEINEWGRSFERLLSSKNGIRVFHEFLKSEYSEENLLFWLAVERLKKETEPASVKNL---AQTIYNDYVSTESPKEVSIDHK-----TRQVIDDEISQPTKETFSKAQQHVYYVMYQDCYPRFLSSSTFKTL 151          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Medaka
Match: rgs7b (regulator of G protein signaling 7 [Source:NCBI gene;Acc:101165338])

HSP 1 Score: 271.166 bits (692), Expect = 4.176e-83
Identity = 130/280 (46.43%), Postives = 192/280 (68.57%), Query Frame = 1
Query:  412 NQSANEFIWRKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXNVILWSSIEGNT-----LSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFD 1236
            ++S N  ++RK+E +I RMQ+E  G+ IRTVKS ++ +PSVF+G ++V W+IK+L  E+ +EA+H+G+++A+ GY FPI+DH L +K+D  + YRFQTP  +PS C E +N +YAVYLCKRTMQNK RLELAD+EAE LA LQ  +  KWEFI++QAEA+AKVDKKRDK+ER +L+SQE+ FWD +RP+ G  N  ++D++K  R K P K             + +     + E        L +++   ++ L++ R+++SK  ESL  Y + Y+E+D
Sbjct:   16 DESPNMIVYRKMEEVIARMQDEKNGIPIRTVKSFLTKIPSVFSGSEIVQWLIKNLEIEDPVEALHLGTLMAAHGYFFPISDHVLTLKDDG-TFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPGCVNTTEVDIKKSSRMKNPHKTRKSVYGLQNDIRTHSPTHTPAPEAKQPTEEELQQQITFWQLQLDRHRLKMSKVAESLVGYTEQYFEYD 294          

HSP 2 Score: 165.236 bits (417), Expect = 5.842e-44
Identity = 79/162 (48.77%), Postives = 111/162 (68.52%), Query Frame = 1
Query: 1480 NPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKKKSKKRF 1965
            NPW+SD+   W  E S KE   +RVK+W+F I E+LKDP GRE+  K+LE EFS+ENL+FW A QE+K  P+R++  R++ I+ +FL+P A   +NVDSK        +      +P R+ FE+A+EHI+KLM SDSY R++RS+ Y+EL+  +KKKSK  F
Sbjct:  304 NPWISDDTTLWELEAS-KEPGQQRVKRWAFGIDEVLKDPVGREQFLKFLESEFSSENLRFWLAVQEVKKRPIREVPTRVQEIWQEFLAPGAPSAINVDSKSYGKTTQNI-----KDPGRYAFEDAQEHIYKLMKSDSYSRFIRSSAYQELLQAKKKKSKNLF 459          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Medaka
Match: rgs7b (regulator of G protein signaling 7 [Source:NCBI gene;Acc:101165338])

HSP 1 Score: 270.396 bits (690), Expect = 7.663e-83
Identity = 130/280 (46.43%), Postives = 192/280 (68.57%), Query Frame = 1
Query:  412 NQSANEFIWRKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXNVILWSSIEGNT-----LSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFD 1236
            ++S N  ++RK+E +I RMQ+E  G+ IRTVKS ++ +PSVF+G ++V W+IK+L  E+ +EA+H+G+++A+ GY FPI+DH L +K+D  + YRFQTP  +PS C E +N +YAVYLCKRTMQNK RLELAD+EAE LA LQ  +  KWEFI++QAEA+AKVDKKRDK+ER +L+SQE+ FWD +RP+ G  N  ++D++K  R K P K             + +     + E        L +++   ++ L++ R+++SK  ESL  Y + Y+E+D
Sbjct:   16 DESPNMIVYRKMEEVIARMQDEKNGIPIRTVKSFLTKIPSVFSGSEIVQWLIKNLEIEDPVEALHLGTLMAAHGYFFPISDHVLTLKDDG-TFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPGCVNTTEVDIKKSSRMKNPHKTRKSVYGLQNDIRTHSPTHTPAPEAKQPTEEELQQQITFWQLQLDRHRLKMSKVAESLVGYTEQYFEYD 294          

HSP 2 Score: 119.013 bits (297), Expect = 3.529e-28
Identity = 57/126 (45.24%), Postives = 82/126 (65.08%), Query Frame = 1
Query: 1480 NPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAE 1857
            NPW+SD+   W  E S KE   +RVK+W+F I E+LKDP GRE+  K+LE EFS+ENL+FW A QE+K  P+R++  R++ I+ +FL+P A   +NVDSK        +      +P R+ FE+A+
Sbjct:  304 NPWISDDTTLWELEAS-KEPGQQRVKRWAFGIDEVLKDPVGREQFLKFLESEFSSENLRFWLAVQEVKKRPIREVPTRVQEIWQEFLAPGAPSAINVDSKSYGKTTQNI-----KDPGRYAFEDAQ 423          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Medaka
Match: rgs7b (regulator of G protein signaling 7 [Source:NCBI gene;Acc:101165338])

HSP 1 Score: 261.922 bits (668), Expect = 5.243e-80
Identity = 125/275 (45.45%), Postives = 183/275 (66.55%), Query Frame = 1
Query:  412 NQSANEFIWRKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXNVILWSSIEGNTLSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFD 1236
            ++S N  ++RK+E +I RMQ+E  G+ IRTVKS ++ +PSVF+G ++V W+IK+L  E+ +EA+H+G+++A+ GY FPI+DH L +K+D  + YRFQTP  +PS C E +N +YAVYLCKRTMQNK RLELAD+EAE LA LQ  +  KWEFI++QAEA+AKVDKKRDK+ER +L+SQE+ FWD +RP++     NDI       +  P+                            L +++   ++ L++ R+++SK  ESL  Y + Y+E+D
Sbjct:   16 DESPNMIVYRKMEEVIARMQDEKNGIPIRTVKSFLTKIPSVFSGSEIVQWLIKNLEIEDPVEALHLGTLMAAHGYFFPISDHVLTLKDDG-TFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVSVYGLQNDIRTHSPTHTPAPEAKQPTE--------------------EELQQQITFWQLQLDRHRLKMSKVAESLVGYTEQYFEYD 269          

HSP 2 Score: 164.851 bits (416), Expect = 3.729e-44
Identity = 79/162 (48.77%), Postives = 111/162 (68.52%), Query Frame = 1
Query: 1480 NPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKKKSKKRF 1965
            NPW+SD+   W  E S KE   +RVK+W+F I E+LKDP GRE+  K+LE EFS+ENL+FW A QE+K  P+R++  R++ I+ +FL+P A   +NVDSK        +      +P R+ FE+A+EHI+KLM SDSY R++RS+ Y+EL+  +KKKSK  F
Sbjct:  279 NPWISDDTTLWELEAS-KEPGQQRVKRWAFGIDEVLKDPVGREQFLKFLESEFSSENLRFWLAVQEVKKRPIREVPTRVQEIWQEFLAPGAPSAINVDSKSYGKTTQNI-----KDPGRYAFEDAQEHIYKLMKSDSYSRFIRSSAYQELLQAKKKKSKNLF 434          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Medaka
Match: ENSORLT00000020999.2 (regulator of G-protein signaling 6 [Source:NCBI gene;Acc:101168163])

HSP 1 Score: 259.61 bits (662), Expect = 1.216e-78
Identity = 134/281 (47.69%), Postives = 188/281 (66.90%), Query Frame = 1
Query:  418 SANEFIWRKIESIIERMQNEDTG-VQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXN---VILWSSIEGNTLSEKVAK----MRVALEKKRIRVSKAIESLHSYNDLYYEFD 1236
            S N  ++RKIE II R+Q+E  G V IRTVKS +S +PSV +G D+V W+IK+L  E+  EAIH+GS+IA+ GY+FPI+DH L +K+D  +LYRFQ+P  +PS C E +N +YA+YLCKRTMQNK RLELAD+EAE LA LQ  +  KWEFI++QAEA+ K+D+K+DK ER +L+SQE+ FWD +RP+ G  N  ++D+RK CR ++    + +S              V + S        E V K    + + L++  ++VSK  +SL SY D + E+D
Sbjct:   20 SPNMIVYRKIEDIITRIQDEKAGGVAIRTVKSFLSKIPSVVSGADIVQWLIKNLSIEDPAEAIHLGSLIAAHGYIFPISDHVLTLKDDG-TLYRFQSPYFWPSNCWEPENTDYAIYLCKRTMQNKARLELADYEAENLARLQRAFARKWEFIFMQAEAQVKLDRKKDKAERKILDSQERAFWDVHRPVPGCVNTTEMDIRK-CRREKNPHRVKKSVYGVADDSQNQLSPVHISSQPARKPTKEDVQKEITFLNIQLDRHCMKVSKVADSLMSYTDQFVEYD 298          

HSP 2 Score: 158.303 bits (399), Expect = 1.622e-41
Identity = 76/161 (47.20%), Postives = 110/161 (68.32%), Query Frame = 1
Query: 1465 STSAINPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKK 1947
            S    NPW+SD+  FW  E S +E S +RV+KW F+++E LKDPAGR++  K+LE EFS+ENL+FW A Q+LK  P R++  R + I+ +FL+  A   +N+DS   E  +  +      +P R+ +E+A+EHIFKLM SDSY R+LRSNIY++L+  +KK
Sbjct:  303 SVEPSNPWISDDTTFWDLEAS-REPSQQRVRKWGFSLEEALKDPAGRDQFLKFLESEFSSENLRFWLAVQDLKRRPFREVPSRAQEIWQEFLAEGAPSAINLDSHSYERTSQNL-----KDPGRYSYEDAQEHIFKLMKSDSYARFLRSNIYQDLLLARKK 457          
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Medaka
Match: ENSORLT00000020998.2 (regulator of G-protein signaling 6 [Source:NCBI gene;Acc:101168163])

HSP 1 Score: 259.996 bits (663), Expect = 1.451e-78
Identity = 134/281 (47.69%), Postives = 188/281 (66.90%), Query Frame = 1
Query:  418 SANEFIWRKIESIIERMQNEDTG-VQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXN---VILWSSIEGNTLSEKVAK----MRVALEKKRIRVSKAIESLHSYNDLYYEFD 1236
            S N  ++RKIE II R+Q+E  G V IRTVKS +S +PSV +G D+V W+IK+L  E+  EAIH+GS+IA+ GY+FPI+DH L +K+D  +LYRFQ+P  +PS C E +N +YA+YLCKRTMQNK RLELAD+EAE LA LQ  +  KWEFI++QAEA+ K+D+K+DK ER +L+SQE+ FWD +RP+ G  N  ++D+RK CR ++    + +S              V + S        E V K    + + L++  ++VSK  +SL SY D + E+D
Sbjct:   20 SPNMIVYRKIEDIITRIQDEKAGGVAIRTVKSFLSKIPSVVSGADIVQWLIKNLSIEDPAEAIHLGSLIAAHGYIFPISDHVLTLKDDG-TLYRFQSPYFWPSNCWEPENTDYAIYLCKRTMQNKARLELADYEAENLARLQRAFARKWEFIFMQAEAQVKLDRKKDKAERKILDSQERAFWDVHRPVPGCVNTTEMDIRK-CRREKNPHRVKKSVYGVADDSQNQLSPVHISSQPARKPTKEDVQKEITFLNIQLDRHCMKVSKVADSLMSYTDQFVEYD 298          

HSP 2 Score: 161.384 bits (407), Expect = 2.466e-42
Identity = 80/173 (46.24%), Postives = 115/173 (66.47%), Query Frame = 1
Query: 1465 STSAINPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKKKSKKRFPADIRQ 1983
            S    NPW+SD+  FW  E S +E S +RV+KW F+++E LKDPAGR++  K+LE EFS+ENL+FW A Q+LK  P R++  R + I+ +FL+  A   +N+DS   E  +  +      +P R+ +E+A+EHIFKLM SDSY R+LRSNIY++L+  +KK+     PAD  Q
Sbjct:  303 SVEPSNPWISDDTTFWDLEAS-REPSQQRVRKWGFSLEEALKDPAGRDQFLKFLESEFSSENLRFWLAVQDLKRRPFREVPSRAQEIWQEFLAEGAPSAINLDSHSYERTSQNL-----KDPGRYSYEDAQEHIFKLMKSDSYARFLRSNIYQDLLLARKKQ-----PADTEQ 464          
BLAST of Regulator of G-protein signaling 7 vs. Planmine SMEST
Match: SMESG000072831.1 (SMESG000072831.1)

HSP 1 Score: 1167.14 bits (3018), Expect = 0.000e+0
Identity = 619/622 (99.52%), Postives = 620/622 (99.68%), Query Frame = 1
Query:  133 MVNESKTMSNRFNRNPHVTFSSNLTSSGVAISSSKANNAFGNNIHLSVGNQKIVSQTSQNVPPIDKSAISKNAMTIENGNNAFRGKSRLTEYPNQSANEFIWRKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXNVILWSSIEGNTLSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFDMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVNMSGSITQSQCALSSAAGAPSGFNCPPTGTTGMESTAGINGIDMSTSAINPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKKKSKKRFPADIRQRLEIE 1998
            MVNESKTMSNRFNRNPHVTFSSNLTSSGVAISSSKANNAFGNNIHLSVGNQKIVSQTSQNV PIDKSAISKNAMTIENGNNAFRGKSRLTEYPNQSANEFIWRKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCRSKRPKKIISRSSSFPISSGSGNVILWSSIEGNTLSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFDMLLIGGGNSGGILSGITTSSTSGGTIGSTSVVNMSGSITQSQCALSSAAGAPSGFNCPPTGTTGMESTAGINGIDMSTSAINPWVSDNAEFW NEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKKKSKKRFPA+IRQRLEIE
Sbjct:    1 MVNESKTMSNRFNRNPHVTFSSNLTSSGVAISSSKANNAFGNNIHLSVGNQKIVSQTSQNVTPIDKSAISKNAMTIENGNNAFRGKSRLTEYPNQSANEFIWRKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCRSKRPKKIISRSSSFPISSGSGNVILWSSIEGNTLSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFDMLLIGGGNSGGILSGITTSSTSGGTIGSTSVVNMSGSITQSQCALSSAAGAPSGFNCPPTGTTGMESTAGINGIDMSTSAINPWVSDNAEFWTNEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKKKSKKRFPAEIRQRLEIE 622          
BLAST of Regulator of G-protein signaling 7 vs. Planmine SMEST
Match: SMESG000072831.1 (SMESG000072831.1)

HSP 1 Score: 1151.73 bits (2978), Expect = 0.000e+0
Identity = 612/615 (99.51%), Postives = 613/615 (99.67%), Query Frame = 1
Query:  154 MSNRFNRNPHVTFSSNLTSSGVAISSSKANNAFGNNIHLSVGNQKIVSQTSQNVPPIDKSAISKNAMTIENGNNAFRGKSRLTEYPNQSANEFIWRKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCXXXXXXXXXXXXXXXXXXXXXXNVILWSSIEGNTLSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFDMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVNMSGSITQSQCALSSAAGAPSGFNCPPTGTTGMESTAGINGIDMSTSAINPWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKKKSKKRFPADIRQRLEIE 1998
            MSNRFNRNPHVTFSSNLTSSGVAISSSKANNAFGNNIHLSVGNQKIVSQTSQNV PIDKSAISKNAMTIENGNNAFRGKSRLTEYPNQSANEFIWRKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCRSKRPKKIISRSSSFPISSGSGNVILWSSIEGNTLSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFDMLLIGGGNSGGILSGITTSSTSGGTIGSTSVVNMSGSITQSQCALSSAAGAPSGFNCPPTGTTGMESTAGINGIDMSTSAINPWVSDNAEFW NEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKKKSKKRFPA+IRQRLEIE
Sbjct:    1 MSNRFNRNPHVTFSSNLTSSGVAISSSKANNAFGNNIHLSVGNQKIVSQTSQNVTPIDKSAISKNAMTIENGNNAFRGKSRLTEYPNQSANEFIWRKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCRSKRPKKIISRSSSFPISSGSGNVILWSSIEGNTLSEKVAKMRVALEKKRIRVSKAIESLHSYNDLYYEFDMLLIGGGNSGGILSGITTSSTSGGTIGSTSVVNMSGSITQSQCALSSAAGAPSGFNCPPTGTTGMESTAGINGIDMSTSAINPWVSDNAEFWTNEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELMAGQKKKSKKRFPAEIRQRLEIE 615          
BLAST of Regulator of G-protein signaling 7 vs. Planmine SMEST
Match: SMESG000072045.1 (SMESG000072045.1)

HSP 1 Score: 162.155 bits (409), Expect = 9.399e-43
Identity = 70/185 (37.84%), Postives = 120/185 (64.86%), Query Frame = 1
Query:  439 RKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDH-SLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAP 990
            +++E +I +MQ+ DTG+  ++ K  +ST+P+  +G D + W+ K L ++++ EA  + ++    GY++P+TD+ SL +K+D   LYRFQ P  + SK  + D ++YA+YL KR+++ +Q+  L ++E   L  LQ     KWEFIY+QAE + ++ K+R K +R V+ +QE+ FW  +RP  G P
Sbjct:   11 KRMEKLIGQMQHPDTGIPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPGRP 195          

HSP 2 Score: 103.99 bits (258), Expect = 3.516e-23
Identity = 60/158 (37.97%), Postives = 91/158 (57.59%), Query Frame = 1
Query: 1456 IDMSTSAINPWVS--DNAEFWANEISLKEVSS-RRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIY 1920
            ID S +  N W++  D  ++ A+ I     S+ ++V+ W+     LL+D  GR   Q++LEKEFSAENL+FW      K  P+R +    + IY +FL  +A   +NVDS+   +    +      NP RF FEEA++HI+ L+ +DSY R+LRS+ Y
Sbjct:  270 IDRSDT-FNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPMRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKEL-----KNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDY 421          
BLAST of Regulator of G-protein signaling 7 vs. Planmine SMEST
Match: SMESG000027589.1 (SMESG000027589.1)

HSP 1 Score: 85.8853 bits (211), Expect = 8.673e-18
Identity = 46/126 (36.51%), Postives = 72/126 (57.14%), Query Frame = 1
Query: 1549 RVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKG-APLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYK 1923
            ++K+W ++++ LL D  G      +L+ E+S ENL+FW AC+  K  +  + L +  + IY+Q LS  A   +N+DSK           SS   P +  F+ A++ IF LM  DSY R+LRS+IY+
Sbjct:  205 QIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTI-----SSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIYQ 325          
BLAST of Regulator of G-protein signaling 7 vs. Planmine SMEST
Match: SMESG000011723.1 (SMESG000011723.1)

HSP 1 Score: 85.1149 bits (209), Expect = 5.141e-17
Identity = 47/129 (36.43%), Postives = 72/129 (55.81%), Query Frame = 1
Query: 1549 RVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPL-RDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELM 1932
            ++KKWS + + LL D  G     ++L  EFS EN++FW AC+E +     + L  R E IYN F+   A   +N+DSK  +     +      NP+   F++A++ I  LM  DSY R+LRS +Y +L+
Sbjct:  296 QIKKWSNSFECLLHDKYGLALFHEFLRSEFSDENIEFWIACEEYRTITTNKKLQSRAEKIYNDFVGVQAAREVNLDSKTRQQTEIDI-----RNPNPHTFDQAQKRIQALMEKDSYQRFLRSELYGKLV 419          
The following BLAST results are available for this feature:
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RGS74.982e-8347.14regulator of G protein signaling 7 [Source:HGNC Sy... [more]
RGS76.087e-8347.14regulator of G protein signaling 7 [Source:HGNC Sy... [more]
RGS71.311e-8247.14regulator of G protein signaling 7 [Source:HGNC Sy... [more]
RGS62.552e-7746.07regulator of G protein signaling 6 [Source:HGNC Sy... [more]
RGS62.997e-7746.07regulator of G protein signaling 6 [Source:HGNC Sy... [more]
back to top
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egl-107.508e-7254.77Regulator of G-protein signaling egl-10 [Source:U... [more]
egl-101.296e-7154.77Regulator of G-protein signaling egl-10 [Source:U... [more]
egl-101.321e-7154.77Regulator of G-protein signaling egl-10 [Source:U... [more]
eat-161.335e-3436.36pep chromosome:WBcel235:I:9722550:9726263:1 gene:W... [more]
eat-161.335e-3436.36pep chromosome:WBcel235:I:9722721:9726263:1 gene:W... [more]
back to top
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RSG79.822e-8450.18gene:FBgn0024941 transcript:FBtr0074350[more]
RSG79.822e-8450.18gene:FBgn0024941 transcript:FBtr0307538[more]
CG424501.714e-4032.34gene:FBgn0259927 transcript:FBtr0310343[more]
CG424501.739e-4032.34gene:FBgn0259927 transcript:FBtr0300218[more]
Dhit2.060e-1533.56gene:FBgn0028743 transcript:FBtr0340279[more]
back to top
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rgs7a1.717e-8247.50regulator of G protein signaling 7a [Source:ZFIN;A... [more]
rgs7a1.717e-8247.50regulator of G protein signaling 7a [Source:ZFIN;A... [more]
rgs7a1.717e-8247.50regulator of G protein signaling 7a [Source:ZFIN;A... [more]
rgs7a1.936e-8247.50regulator of G protein signaling 7a [Source:ZFIN;A... [more]
rgs66.417e-7744.44regulator of G protein signaling 6 [Source:ZFIN;Ac... [more]
back to top
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RGS65.856e-7845.91regulator of G-protein signaling 6 [Source:NCBI ge... [more]
RGS66.355e-7845.91regulator of G-protein signaling 6 [Source:NCBI ge... [more]
RGS61.165e-7346.67regulator of G-protein signaling 6 [Source:NCBI ge... [more]
RGS62.156e-7146.01regulator of G-protein signaling 6 [Source:NCBI ge... [more]
RGS63.547e-7146.01regulator of G-protein signaling 6 [Source:NCBI ge... [more]
back to top
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rgs76.038e-8347.14regulator of G protein signaling 7 [Source:MGI Sym... [more]
Rgs76.038e-8347.14regulator of G protein signaling 7 [Source:MGI Sym... [more]
Rgs71.029e-8247.14regulator of G protein signaling 7 [Source:MGI Sym... [more]
Rgs71.088e-8247.14regulator of G protein signaling 7 [Source:MGI Sym... [more]
Rgs62.666e-7846.24regulator of G-protein signaling 6 [Source:MGI Sym... [more]
back to top
BLAST of Regulator of G-protein signaling 7 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O46470|RGS7_BOVIN2.686e-8247.14Regulator of G-protein signaling 7 OS=Bos taurus O... [more]
sp|O54829|RGS7_MOUSE4.223e-8247.14Regulator of G-protein signaling 7 OS=Mus musculus... [more]
sp|P49802|RGS7_HUMAN8.506e-8247.14Regulator of G-protein signaling 7 OS=Homo sapiens... [more]
sp|P49803|RGS7_RAT1.765e-8145.64Regulator of G-protein signaling 7 OS=Rattus norve... [more]
sp|P49758|RGS6_HUMAN1.439e-7646.07Regulator of G-protein signaling 6 OS=Homo sapiens... [more]
back to top
BLAST of Regulator of G-protein signaling 7 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3NH391.614e-17449.46Regulator of G-protein signaling 7 OS=Schistocepha... [more]
A0A0X3PYX81.085e-17349.46Regulator of G-protein signaling 7 OS=Schistocepha... [more]
A0A0V0J6231.748e-17349.46Regulator of G-protein signaling 7 OS=Schistocepha... [more]
A0A0X3PFZ45.677e-16950.19Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A068Y4863.856e-16345.77Regulator of G protein signaling 7 OS=Echinococcus... [more]
back to top
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rgs7a2.165e-8056.44regulator of G protein signaling 7a [Source:ZFIN;A... [more]
rgs61.282e-7945.68regulator of G-protein signaling 6 [Source:NCBI ge... [more]
rgs61.340e-7945.68regulator of G-protein signaling 6 [Source:NCBI ge... [more]
rgs61.414e-7856.50regulator of G-protein signaling 6 [Source:NCBI ge... [more]
rgs61.967e-6556.55regulator of G-protein signaling 6 [Source:NCBI ge... [more]
back to top
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RGS74.409e-7956.70regulator of G protein signaling 7 [Source:HGNC Sy... [more]
RGS78.259e-7744.21regulator of G protein signaling 7 [Source:HGNC Sy... [more]
RGS72.978e-5857.53regulator of G protein signaling 7 [Source:HGNC Sy... [more]
ENSPMAT00000010444.15.656e-4147.74pep scaffold:Pmarinus_7.0:GL482357:14059:16996:-1 ... [more]
ENSPMAT00000010442.12.795e-3645.58pep scaffold:Pmarinus_7.0:GL482357:13581:16779:-1 ... [more]
back to top
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO343515.229e-7146.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431261.622e-1834.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328041.786e-1328.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO373702.074e-1229.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Regulator of G-protein signaling 7 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rgs7b4.176e-8346.43regulator of G protein signaling 7 [Source:NCBI ge... [more]
rgs7b7.663e-8346.43regulator of G protein signaling 7 [Source:NCBI ge... [more]
rgs7b5.243e-8045.45regulator of G protein signaling 7 [Source:NCBI ge... [more]
ENSORLT00000020999.21.216e-7847.69regulator of G-protein signaling 6 [Source:NCBI ge... [more]
ENSORLT00000020998.21.451e-7847.69regulator of G-protein signaling 6 [Source:NCBI ge... [more]
back to top
BLAST of Regulator of G-protein signaling 7 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072831.10.000e+099.52SMESG000072831.1[more]
SMESG000072831.10.000e+099.51SMESG000072831.1[more]
SMESG000072045.19.399e-4337.84SMESG000072045.1[more]
SMESG000027589.18.673e-1836.51SMESG000027589.1[more]
SMESG000011723.15.141e-1736.43SMESG000011723.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035596 ID=SMED30035596|Name=Regulator of G-protein signaling 7|organism=Schmidtea mediterranea sexual|type=transcript|length=2065bp
ACGAGTAAAATATTTATTTACTTCTTACATAAAGTTTTAAATAAACATTG
AAATAAATTTTAATATTTATTGTCTAAAAATCAGTAGAAATTGTGGAATA
TATCGCCTGTTTAACCACATTTCAGATGTAGAATGGTAAATGAGTCGAAA
ACGATGTCAAATAGATTTAATCGAAATCCACATGTTACATTTTCATCCAA
TTTGACATCCTCTGGAGTTGCCATTTCATCATCGAAAGCTAATAACGCTT
TTGGAAATAATATTCATTTATCTGTTGGTAATCAGAAAATTGTGTCTCAA
ACCTCACAAAATGTGCCCCCGATAGACAAATCTGCGATCTCCAAAAACGC
AATGACTATCGAAAACGGTAACAATGCTTTCCGAGGAAAATCAAGATTGA
CTGAATATCCCAACCAATCAGCAAATGAATTCATTTGGCGCAAAATTGAA
TCCATCATAGAGCGGATGCAAAATGAAGACACGGGGGTGCAAATCAGAAC
TGTGAAAAGTCTCATGTCGACTGTCCCAAGTGTCTTCACAGGTGTAGATC
TCGTCACCTGGATAATAAAGCACCTTGGTGCTGAAGAAGTGATGGAGGCC
ATTCACGTCGGTTCAATGATTGCATCAATGGGATATTTATTCCCGATAAC
AGATCACTCGTTGCAAATGAAAAACGATGCGCATTCGTTGTACCGATTCC
AAACTCCTTGTTTATATCCCAGCAAATGCTGTGAGGTGGACAATATTGAA
TATGCCGTTTACCTATGCAAACGTACAATGCAAAATAAACAGAGGCTGGA
GTTGGCAGATTTCGAAGCGGAAAGATTAGCCACTTTACAGAGCTTTTATT
GGCACAAATGGGAATTTATATATCTCCAGGCAGAGGCCGAAGCAAAAGTT
GACAAAAAGAGAGATAAAGTTGAAAGGTTGGTATTAGAGTCCCAAGAAAA
AGGATTTTGGGATTCAAACAGACCAATTGCTGGCGCGCCAAATAATAACG
ATATTGACATGCGTAAACTCTGTCGATCAAAGCGACCCAAAAAGATAATT
TCACGCTCATCATCGTTTCCGATTTCCTCCGGTTCCGGCAATGTGATCCT
GTGGAGTTCAATTGAAGGAAATACTTTATCAGAAAAAGTGGCAAAAATGA
GAGTGGCGTTAGAAAAGAAACGTATTCGAGTTTCGAAAGCCATCGAAAGC
CTTCACTCCTACAATGATTTGTATTATGAGTTTGATATGCTGTTGATTGG
CGGTGGAAACTCGGGGGGCATTCTATCTGGAATTACTACAAGCTCCACAA
GCGGCGGAACGATCGGTTCAACAAGTGTTGTTAATATGAGCGGCTCAATA
ACTCAATCACAATGTGCCCTTTCATCGGCCGCTGGTGCACCTTCTGGTTT
CAACTGCCCCCCGACAGGTACAACAGGCATGGAATCTACTGCTGGCATCA
ATGGCATTGATATGAGCACATCAGCAATAAACCCCTGGGTGTCCGATAAC
GCGGAATTTTGGGCCAATGAAATTTCACTGAAAGAAGTTTCCAGTCGCAG
AGTTAAAAAATGGAGTTTTACTATTCAGGAACTTCTAAAGGATCCGGCTG
GAAGAGAAGAAATTCAAAAATGGCTAGAAAAAGAGTTTTCAGCTGAAAAT
CTGAAGTTCTGGGAAGCTTGTCAAGAACTGAAAGGAGCACCTCTAAGAGA
TCTGAATAGAAGAATCGAAGCAATATACAACCAATTCCTCTCGCCTTCTG
CACTAGAACCCCTGAATGTGGACAGCAAGGTTGCTGAGAGTGTAGCCAAT
CGAGTAGCAAATAGCAGCACTTCAAATCCCGATAGGTTTTGCTTTGAAGA
AGCAGAGGAACATATTTTTAAATTAATGACGAGTGATTCGTATTACCGGT
ACCTGCGCTCCAACATTTATAAGGAGTTAATGGCCGGGCAAAAAAAGAAA
TCCAAAAAGAGATTTCCTGCCGACATCAGACAAAGATTAGAGATTGAGTG
ATATCATAGACAAAGATTGCAATCAGGCTTAGATGTTATGCTGAATAAAA
CCGAGGAGATCCCGC
back to top

protein sequence of SMED30035596-orf-1

>SMED30035596-orf-1 ID=SMED30035596-orf-1|Name=SMED30035596-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=623bp
MVNESKTMSNRFNRNPHVTFSSNLTSSGVAISSSKANNAFGNNIHLSVGN
QKIVSQTSQNVPPIDKSAISKNAMTIENGNNAFRGKSRLTEYPNQSANEF
IWRKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGA
EEVMEAIHVGSMIASMGYLFPITDHSLQMKNDAHSLYRFQTPCLYPSKCC
EVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQA
EAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAPNNNDIDMRKLCRSK
RPKKIISRSSSFPISSGSGNVILWSSIEGNTLSEKVAKMRVALEKKRIRV
SKAIESLHSYNDLYYEFDMLLIGGGNSGGILSGITTSSTSGGTIGSTSVV
NMSGSITQSQCALSSAAGAPSGFNCPPTGTTGMESTAGINGIDMSTSAIN
PWVSDNAEFWANEISLKEVSSRRVKKWSFTIQELLKDPAGREEIQKWLEK
EFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKV
AESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIYKELM
AGQKKKSKKRFPADIRQRLEIE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0008277regulation of G-protein coupled receptor protein signaling pathway
GO:0035556intracellular signal transduction
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: INTERPRO
TermDefinition
IPR036388WH-like_DNA-bd_sf
IPR040759RGS_DHEX
IPR034483Egl-10
IPR036390WH_DNA-bd_sf
IPR036305RGS_sf
IPR036284GGL_sf
IPR016137RGS
IPR000591DEP_dom
IPR011991WHTH_DNA-bd_dom
IPR024066RGS_subdom1/3
IPR015898G-protein_gamma-like_dom
Vocabulary: cellular component
TermDefinition
GO:0005834heterotrimeric G-protein complex
Vocabulary: molecular function
TermDefinition
GO:0004871signal transducer activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 249..269
NoneNo IPR availableGENE3DG3DSA:1.10.1240.60coord: 197..299
e-value: 4.8E-30
score: 105.2
NoneNo IPR availableGENE3DG3DSA:1.20.58.1850coord: 448..606
e-value: 3.6E-42
score: 145.6
NoneNo IPR availablePANTHERPTHR45746FAMILY NOT NAMEDcoord: 446..607
coord: 93..371
NoneNo IPR availableCDDcd04450DEP_RGS7-likecoord: 108..192
e-value: 7.06268E-26
score: 99.6721
IPR016137RGS domainPRINTSPR01301RGSPROTEINcoord: 527..550
score: 33.06
coord: 499..517
score: 58.7
coord: 574..593
score: 51.52
coord: 477..498
score: 32.21
IPR016137RGS domainSMARTSM00315RGS_3coord: 480..600
e-value: 1.9E-33
score: 127.1
IPR016137RGS domainPFAMPF00615RGScoord: 481..599
e-value: 9.1E-29
score: 100.1
IPR016137RGS domainPROSITEPS50132RGScoord: 480..600
score: 30.226
IPR000591DEP domainSMARTSM00049DEP_3coord: 115..191
e-value: 7.4E-18
score: 75.3
IPR000591DEP domainPFAMPF00610DEPcoord: 118..189
e-value: 7.8E-14
score: 51.5
IPR000591DEP domainPROSITEPS50186DEPcoord: 115..191
score: 17.532
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 87..196
e-value: 8.1E-28
score: 98.5
IPR040759Regulator of G-protein signalling, DHEX domainPFAMPF18148RGS_DHEXcoord: 192..290
e-value: 1.1E-31
score: 108.8
IPR034483Regulator of G-protein signalling Egl-10PANTHERPTHR45746:SF6LP21163Pcoord: 446..607
coord: 93..371
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 99..198
IPR036305RGS domain superfamilySUPERFAMILYSSF48097Regulator of G-protein signaling, RGScoord: 468..600
IPR036284G-protein gamma-like domain superfamilySUPERFAMILYSSF48670Transducin (heterotrimeric G protein), gamma chaincoord: 334..374