E3 ubiquitin-protein ligase mind-bomb

Overview
NameE3 ubiquitin-protein ligase mind-bomb
Smed IDSMED30035592
Length (bp)2034
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of E3 ubiquitin-protein ligase mind-bomb (SMED30035592) t-SNE clustered cells

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase mind-bomb (SMED30035592) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of E3 ubiquitin-protein ligase mind-bomb (SMED30035592) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase mind-bomb (SMED30035592) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035592

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30035592SMESG000031930.1 SmedASXL_015868SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30035592SMESG000031930.1 dd_Smed_v4_1317_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30035592SMESG000031930.1 dd_Smed_v4_1317_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035592SMESG000031930.1 dd_Smed_v4_1317_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30035592SMESG000031930.1 dd_Smed_v4_1317_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Human
Match: MIB1 (mindbomb E3 ubiquitin protein ligase 1 [Source:HGNC Symbol;Acc:HGNC:21086])

HSP 1 Score: 260.766 bits (665), Expect = 1.286e-74
Identity = 189/631 (29.95%), Postives = 309/631 (48.97%), Query Frame = 3
Query:  135 DLSTIIKKQKNHGGWNDLMKECLTGPCKLIN-DDGSDATVMGPSGMIYRLNSELLVPFKSVK-------------KHKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKSEIVENTELKXXXXXXXXXXXXXXLITDER---TMRFLVALKTGNLSEVLRLV--DSVGVNTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKR-DGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLM-KYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMK---------------VNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDARSNEAELMELRQKLKEMEDEKICKICHDRRLKVIF-ECGHMC-CDDCSDNISECHLCSEKILHKIKI 1913
            DL  +   Q  HGGW D M E LT    +   D+  D  V  PSG  +  N  +L     V+             + ++G  VQ+  D E  KLLQ  HGEW E M   LGK   V QI+ D D K+      +  +P  +       + + +   +       +   T E        + A   G++++V  L+    V VN    G   +  A+  GH D++ LLL++  ++   DKDGD A+H A   +   + ++L +  AD+NA+N ++ TP  IAV KG   +++ L+       S+ DS+ DT LH A++  R + +  LL AGAD+ + N   FNA H AA+ G+   + + L +     +V+ +K+D + A+H+AA+NNH     +L+ +  A+L++QN+  +TALH+AV+R++   V+ LV   A+LD++DK+G+T LH A++               V + ++ +    K T  +G LG  G        IA +L  NGA + I+N KG++PLD+C D +L  + L+   ++     +  +        PS   SN++E +E             C +C D +   +F  CGH+  C  CS  + +C +C E++  + KI
Sbjct:  257 DLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANIVRSGDAAQGAEGGTSQFQVGDLVQVCYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVSKVASAGSAISNASGERLSQLLKKLFETQESGDLNEELVKAAANGDVAKVEDLLKRPDVDVNGQCAGHTAMQAASQNGHVDILKLLLKQNVDVEAEDKDGDRAVHHAAFGDEGAVIEVLHRGSADLNARNKRRQTPLHIAVNKGHLQVVKTLL-DFGCHPSLQDSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDIQNVNQQTALHLAVERQHTQIVRLLVRAGAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDAAW-EPSKNTLIMG-LGTQGAEKKSAASIACFLAANGADLSIRNKKGQSPLDLCPDPNL-CKALAKCHKEKVSGQVGSRS-------PS-MISNDSETLEE------------CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 863          

HSP 2 Score: 56.225 bits (134), Expect = 2.188e-7
Identity = 22/59 (37.29%), Postives = 40/59 (67.80%), Query Frame = 3
Query: 1731 AELMELRQKLKEMEDEKICKICHDRRLKVIFECGHMCCDDCSDNISECHLCSEKILHKI 1907
            A++ +L+Q+L++++++ +C +C DR   +IF CGH  C  C D +SEC +C + I  +I
Sbjct:  945 ADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRI 1003          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Human
Match: MIB2 (mindbomb E3 ubiquitin protein ligase 2 [Source:HGNC Symbol;Acc:HGNC:30577])

HSP 1 Score: 213.772 bits (543), Expect = 4.543e-58
Identity = 168/624 (26.92%), Postives = 296/624 (47.44%), Query Frame = 3
Query:  135 DLSTIIKKQKNHGGWNDLMKECL--TGPCKLINDDGSDATVMGPSGMIYRLNSELLVPF--KSVKKHK---IGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKS---------EIVENTELKXXXXXXXXXXXXXXLITDERTMRFLVALKTGNLSEVLRLVDSVG--VNTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLES--VEALLN-AGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMK-YKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQ-------TESGFGNFLKMTSALGVLGNIGEG-LDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDARSNEAELMELRQKLKEMEDEKICKICHDRRLKVIF-ECGH-MCCDDCSDNISECHLCSEKILHKIK 1910
            D   + + Q+ HGGWN  M E +  TG    I D G D  V        + N E    F   ++ KH    +G  V++I D +  K LQ  HGEW +DM   LG+  +V+++F DG+ +++   + +   P  + +         ++ E           + D         E   R +V +  GN +  L L+      V+T  +G   L +AA  G  +L+ LLL+ +A +++ D +G+TALH A   N+ +   +LL  G   +A N+ + T   +AV +G  +++  L      D+++ D+  DT LH A+++    S  VE L      D+   N + F   H A++ GH   +   L R   +LV+++KED F A+H+AA+NNH     +L++  + D+N++N +L++ LH+AV++ ++  V  LV+    ++ +D+ G+TALHVA++ +Q          G    L++ S L   G  G   L     +A +L   GA +   N++G++PLD+  +     R+L  ++  +Q+    +      P  P         +  L        +   C +C +  L V+F  C H   C++C+  + +C  C   +  K++
Sbjct:  318 DTDVLREMQEGHGGWNPRMAEFIGQTGTVHRITDRG-DVRV--------QFNHETRWTFHPGALTKHHSFWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVAGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRAQKSDPEHPGRLVVEVALGNAARALDLLRRRPEQVDTKNQGRTALQVAAYLGQVELIRLLLQARAGVDLPDDEGNTALHYAALGNQPEATRVLLSAGCRADAINSTQSTALHVAVQRGFLEVVRALC-ERGCDVNLPDAHSDTPLHSAISAGTGASGIVEVLTEVPNIDVTATNSQGFTLLHHASLKGHALAVRKILAR-ARQLVDAKKEDGFTALHLAALNNHREVAQILIREGRCDVNVRNRKLQSPLHLAVQQAHVGLVPLLVDAGCSVNAEDEEGDTALHVALQRHQLLPLVADGAGGDPGPLQLLSRLQASGLPGSAELTVGAAVACFLALEGADVSYTNHRGRSPLDLAAEG----RVLKALQGCAQRFRERQAGGGAAP-GPRQTLGTPNTVTNLHVGAAPGPEAAECLVCSELALLVLFSPCQHRTVCEECARRMKKCIRCQVVVSKKLR 925          

HSP 2 Score: 58.9214 bits (141), Expect = 3.279e-8
Identity = 20/57 (35.09%), Postives = 35/57 (61.40%), Query Frame = 3
Query: 1743 ELRQKLKEMEDEKICKICHDRRLKVIFECGHMCCDDCSDNISECHLCSEKILHKIKI 1913
            EL+ + ++ME+   C IC D  ++++F+CGH  C  C   +S C +C + I  +I+I
Sbjct:  947 ELQSRYRQMEERITCPICIDSHIRLVFQCGHGACAPCGSALSACPICRQPIRDRIQI 1003          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Human
Match: MIB2 (mindbomb E3 ubiquitin protein ligase 2 [Source:HGNC Symbol;Acc:HGNC:30577])

HSP 1 Score: 213.772 bits (543), Expect = 5.365e-58
Identity = 168/622 (27.01%), Postives = 295/622 (47.43%), Query Frame = 3
Query:  135 DLSTIIKKQKNHGGWNDLMKECLTGPCKLINDDGSDATVMGPSGMIYRLNSELLVPF--KSVKKHK---IGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKS---------EIVENTELKXXXXXXXXXXXXXXLITDERTMRFLVALKTGNLSEVLRLVDSVG--VNTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLES--VEALLN-AGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMK-YKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQ-------TESGFGNFLKMTSALGVLGNIGEG-LDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDARSNEAELMELRQKLKEMEDEKICKICHDRRLKVIF-ECGH-MCCDDCSDNISECHLCSEKILHKIK 1910
            D   + + Q+ HGGWN  M E  TG    I D G D  V        + N E    F   ++ KH    +G  V++I D +  K LQ  HGEW +DM   LG+  +V+++F DG+ +++   + +   P  + +         ++ E           + D         E   R +V +  GN +  L L+      V+T  +G   L +AA  G  +L+ LLL+ +A +++ D +G+TALH A   N+ +   +LL  G   +A N+ + T   +AV +G  +++  L      D+++ D+  DT LH A+++    S  VE L      D+   N + F   H A++ GH   +   L R   +LV+++KED F A+H+AA+NNH     +L++  + D+N++N +L++ LH+AV++ ++  V  LV+    ++ +D+ G+TALHVA++ +Q          G    L++ S L   G  G   L     +A +L   GA +   N++G++PLD+  +     R+L  ++  +Q+    +      P  P         +  L        +   C +C +  L V+F  C H   C++C+  + +C  C   +  K++
Sbjct:  383 DTDVLREMQEGHGGWNPRMAE--TGTVHRITDRG-DVRV--------QFNHETRWTFHPGALTKHHSFWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVAGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRAQKSDPEHPGRLVVEVALGNAARALDLLRRRPEQVDTKNQGRTALQVAAYLGQVELIRLLLQARAGVDLPDDEGNTALHYAALGNQPEATRVLLSAGCRADAINSTQSTALHVAVQRGFLEVVRALC-ERGCDVNLPDAHSDTPLHSAISAGTGASGIVEVLTEVPNIDVTATNSQGFTLLHHASLKGHALAVRKILAR-ARQLVDAKKEDGFTALHLAALNNHREVAQILIREGRCDVNVRNRKLQSPLHLAVQQAHVGLVPLLVDAGCSVNAEDEEGDTALHVALQRHQLLPLVADGAGGDPGPLQLLSRLQASGLPGSAELTVGAAVACFLALEGADVSYTNHRGRSPLDLAAEG----RVLKALQGCAQRFRERQAGGGAAP-GPRQTLGTPNTVTNLHVGAAPGPEAAECLVCSELALLVLFSPCQHRTVCEECARRMKKCIRCQVVVSKKLR 986          

HSP 2 Score: 58.9214 bits (141), Expect = 3.035e-8
Identity = 20/57 (35.09%), Postives = 35/57 (61.40%), Query Frame = 3
Query: 1743 ELRQKLKEMEDEKICKICHDRRLKVIFECGHMCCDDCSDNISECHLCSEKILHKIKI 1913
            EL+ + ++ME+   C IC D  ++++F+CGH  C  C   +S C +C + I  +I+I
Sbjct: 1008 ELQSRYRQMEERITCPICIDSHIRLVFQCGHGACAPCGSALSACPICRQPIRDRIQI 1064          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Human
Match: MIB2 (mindbomb E3 ubiquitin protein ligase 2 [Source:HGNC Symbol;Acc:HGNC:30577])

HSP 1 Score: 213.001 bits (541), Expect = 5.958e-58
Identity = 168/624 (26.92%), Postives = 297/624 (47.60%), Query Frame = 3
Query:  135 DLSTIIKKQKNHGGWNDLMKECL--TGPCKLINDDGSDATVMGPSGMIYRLNSELLVPF--KSVKKHK---IGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKS---------EIVENTELKXXXXXXXXXXXXXXLITDERTMRFLVALKTGNLSEVLRLVDSVG--VNTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLES--VEALLN-AGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMK-YKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQ-------TESGFGNFLKMTSALGVLGNIGEG-LDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDARSNEAELMELRQKLKEMEDEKICKICHDRRLKVIF-ECGH-MCCDDCSDNISECHLCSEKILHKIK 1910
            D   + + Q+ HGGWN  M E +  TG    I D G D  V        + N E    F   ++ KH    +G  V++I D +  K LQ  HGEW +DM   LG+  +V+++F DG+ +++   + +   P  + +         ++ E           + D         E   R +V +  GN +  L L+      V+T  +G   L +AA  G  +L+ LLL+ +A +++ D +G+TALH A   N+ +   +LL  G   +A N+ + T   +AV +G  +++  L      D+++ D+  DT LH A+++    S  VE L      D+   N + F   H A++ GH   +   L R   +LV+++KED F A+H+AA+NNH     +L++  + D+N++N +L++ LH+AV++ ++  V  LV+    ++ +D+ G+TALHVA++ +Q          G    L++ S L   G  G   L     +A +L   GA +   N++G++PLD+    + + R+L  ++  +Q+    +      P  P         +  L        +   C +C +  L V+F  C H   C++C+  + +C  C   +  K++
Sbjct:  282 DTDVLREMQEGHGGWNPRMAEFIGQTGTVHRITDRG-DVRV--------QFNHETRWTFHPGALTKHHSFWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVAGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRAQKSDPEHPGRLVVEVALGNAARALDLLRRRPEQVDTKNQGRTALQVAAYLGQVELIRLLLQARAGVDLPDDEGNTALHYAALGNQPEATRVLLSAGCRADAINSTQSTALHVAVQRGFLEVVRALC-ERGCDVNLPDAHSDTPLHSAISAGTGASGIVEVLTEVPNIDVTATNSQGFTLLHHASLKGHALAVRKILAR-ARQLVDAKKEDGFTALHLAALNNHREVAQILIREGRCDVNVRNRKLQSPLHLAVQQAHVGLVPLLVDAGCSVNAEDEEGDTALHVALQRHQLLPLVADGAGGDPGPLQLLSRLQASGLPGSAELTVGAAVACFLALEGADVSYTNHRGRSPLDL----AAEGRVLKALQGCAQRFRERQAGGGAAP-GPRQTLGTPNTVTNLHVGAAPGPEAAECLVCSELALLVLFSPCQHRTVCEECARRMKKCIRCQVVVSKKLR 889          

HSP 2 Score: 58.151 bits (139), Expect = 4.527e-8
Identity = 20/57 (35.09%), Postives = 35/57 (61.40%), Query Frame = 3
Query: 1743 ELRQKLKEMEDEKICKICHDRRLKVIFECGHMCCDDCSDNISECHLCSEKILHKIKI 1913
            EL+ + ++ME+   C IC D  ++++F+CGH  C  C   +S C +C + I  +I+I
Sbjct:  911 ELQSRYRQMEERITCPICIDSHIRLVFQCGHGACAPCGSALSACPICRQPIRDRIQI 967          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Human
Match: MIB2 (mindbomb E3 ubiquitin protein ligase 2 [Source:HGNC Symbol;Acc:HGNC:30577])

HSP 1 Score: 213.386 bits (542), Expect = 7.543e-58
Identity = 168/624 (26.92%), Postives = 296/624 (47.44%), Query Frame = 3
Query:  135 DLSTIIKKQKNHGGWNDLMKECL--TGPCKLINDDGSDATVMGPSGMIYRLNSELLVPF--KSVKKHK---IGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKS---------EIVENTELKXXXXXXXXXXXXXXLITDERTMRFLVALKTGNLSEVLRLVDSVG--VNTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLES--VEALLN-AGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMK-YKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQ-------TESGFGNFLKMTSALGVLGNIGEG-LDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDARSNEAELMELRQKLKEMEDEKICKICHDRRLKVIF-ECGH-MCCDDCSDNISECHLCSEKILHKIK 1910
            D   + + Q+ HGGWN  M E +  TG    I D G D  V        + N E    F   ++ KH    +G  V++I D +  K LQ  HGEW +DM   LG+  +V+++F DG+ +++   + +   P  + +         ++ E           + D         E   R +V +  GN +  L L+      V+T  +G   L +AA  G  +L+ LLL+ +A +++ D +G+TALH A   N+ +   +LL  G   +A N+ + T   +AV +G  +++  L      D+++ D+  DT LH A+++    S  VE L      D+   N + F   H A++ GH   +   L R   +LV+++KED F A+H+AA+NNH     +L++  + D+N++N +L++ LH+AV++ ++  V  LV+    ++ +D+ G+TALHVA++ +Q          G    L++ S L   G  G   L     +A +L   GA +   N++G++PLD+  +     R+L  ++  +Q+    +      P  P         +  L        +   C +C +  L V+F  C H   C++C+  + +C  C   +  K++
Sbjct:  369 DTDVLREMQEGHGGWNPRMAEFIGQTGTVHRITDRG-DVRV--------QFNHETRWTFHPGALTKHHSFWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVAGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRAQKSDPEHPGRLVVEVALGNAARALDLLRRRPEQVDTKNQGRTALQVAAYLGQVELIRLLLQARAGVDLPDDEGNTALHYAALGNQPEATRVLLSAGCRADAINSTQSTALHVAVQRGFLEVVRALC-ERGCDVNLPDAHSDTPLHSAISAGTGASGIVEVLTEVPNIDVTATNSQGFTLLHHASLKGHALAVRKILAR-ARQLVDAKKEDGFTALHLAALNNHREVAQILIREGRCDVNVRNRKLQSPLHLAVQQAHVGLVPLLVDAGCSVNAEDEEGDTALHVALQRHQLLPLVADGAGGDPGPLQLLSRLQASGLPGSAELTVGAAVACFLALEGADVSYTNHRGRSPLDLAAEG----RVLKALQGCAQRFRERQAGGGAAP-GPRQTLGTPNTVTNLHVGAAPGPEAAECLVCSELALLVLFSPCQHRTVCEECARRMKKCIRCQVVVSKKLR 976          

HSP 2 Score: 58.9214 bits (141), Expect = 3.354e-8
Identity = 20/57 (35.09%), Postives = 35/57 (61.40%), Query Frame = 3
Query: 1743 ELRQKLKEMEDEKICKICHDRRLKVIFECGHMCCDDCSDNISECHLCSEKILHKIKI 1913
            EL+ + ++ME+   C IC D  ++++F+CGH  C  C   +S C +C + I  +I+I
Sbjct:  998 ELQSRYRQMEERITCPICIDSHIRLVFQCGHGACAPCGSALSACPICRQPIRDRIQI 1054          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 125.176 bits (313), Expect = 3.118e-29
Identity = 85/308 (27.60%), Postives = 144/308 (46.75%), Query Frame = 3
Query:  687 TNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICN 1610
            T+  G  PL IAA+ GHE++  LLLEK AN+N   +   + LH+A    R  + +LLL +GA ++++    +TP   A   G   +++LL+    A +S    +    LH+A     +++   LL   A +  +        H+AA  GH ++ ++ L R  +   NS+  + F  +H+A   N    + +L+KY+A +        T LH+A     ++ V +L++  A  D++   G T LH+A + NQT                            D+   LI NGA +D +  + +TPL I +
Sbjct:  223 TSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVV-QGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADP--NSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQT----------------------------DVVRVLIRNGAKVDAQARELQTPLHIAS 499          

HSP 2 Score: 118.627 bits (296), Expect = 3.545e-27
Identity = 93/331 (28.10%), Postives = 154/331 (46.53%), Query Frame = 3
Query:  624 VALKTGNLSEVLRLVDSVGVNTNLK---GMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDIC 1607
            +A + GN   V+ L+ + G N+N        PL IAA EG E++  +LL+  A+  +  K G T LHLA      ++  LLL++G  V+ +   ++TP  +A    + D + +L+  N A       +  T LH+A   +++E    LL   AD    ++  F   HL+A  GH++I  + ++   +  V ++  +   A+H+ A  +H     +L    A++N +     T LH+A     L+ VK LVEN A++  K +   T LH A      + G  N ++                       YL+ENGAS + +   G+TPL I 
Sbjct:  497 IASRLGNTDIVILLLQA-GANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAA-HYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSD--VGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQA-----AQQGHNNCVR-----------------------YLLENGASPNEQTATGQTPLSIA 795          

HSP 3 Score: 113.235 bits (282), Expect = 1.756e-25
Identity = 88/307 (28.66%), Postives = 148/307 (48.21%), Query Frame = 3
Query:  687 TNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDIC 1607
            T   G+ PL +AA  G  ++V  LL++ AN ++    G+T LHLA   N+  +  +L++ GA V+AQ  +  TP  IA   G+ DI+ LL+ +  A+ +    D  + LH+A    + E    LL+  AD  LL KK F   HLA+  G+ +++ + L+R     V+ + +++   +H+AA  N++    +L++  A          T LHIA K+  +     L++ KA+ + K + G T LH++ +    E                            I+  LIENG+ +  K N G T + +C
Sbjct:  421 TTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAG-ANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERG--TPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKE----------------------------ISGLLIENGSDVGAKANNGLTAMHLC 696          

HSP 4 Score: 97.8265 bits (242), Expect = 1.186e-20
Identity = 81/306 (26.47%), Postives = 143/306 (46.73%), Query Frame = 3
Query:  603 ERTMRFLVALKTGNLSEVLRLVDS-VGVNT-NLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLIT-SNNADLSIGDS---------------------------DRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMK 1430
            E +  FL A + G+L +VL L+ +   +NT N  G+  L +A+ EGH ++V  L++++A ++ A + G+TALH+A    +  +  +L++ GA+VN Q+    TP  +A  +  +++++ L+    N  LS  D                             R  ALH+A       +   LL    +  + +K  F   H+AA  GHE + ++ L++     VN Q     + +H+A      +   +L+   A ++ +  +L T LH A +  +   V  LV   A +  K KNG   LH+A +
Sbjct:   32 EGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGAN--VNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQ 335          

HSP 5 Score: 90.8929 bits (224), Expect = 1.598e-18
Identity = 99/357 (27.73%), Postives = 161/357 (45.10%), Query Frame = 3
Query:  594 ITDERTMRFLVALKTGNLS---EVLRLVDSVGVNTNLK---GMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNF--LKMTSALGVLGNIGEGLDKL-----------EDIAIYLIENGASIDIKNNKGKTPLDIC 1607
            I D RT   L  L     S   +V+ L+   G   + K   G+ PL +AA   H D    LL  +A ++    D  T LH+A H    ++  LLL + AD N++     TP  IA  K    ++ELL+    A  +  +S   T LH+A     +  V  LL  GA+  +   +     HLAA +    ++ + + R+G K V++Q  +    +H+A+   +   + +L++  A+ N    +  + LHIA K         L+++ A+  L  K G T LH+A K       +GN   +++    G   +I EG +++           + +A+ L+ENGAS       G TPL I 
Sbjct:  285 IIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGL-TPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLI-RNGAK-VDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASK-------YGNLEVVRLLLERGTPVDI-EGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIA 630          

HSP 6 Score: 66.2402 bits (160), Expect = 7.698e-11
Identity = 55/218 (25.23%), Postives = 104/218 (47.71%), Query Frame = 3
Query:  987 GDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDI-----------AIYLIENGASIDIKNNKGKTPLDIC 1607
            G ++   +   A  +  LE V  LL AG DI   N    N+ HLA+  GH +++   +KR  +  V++       A+H+A++      + +L++  A++N+Q++   T L++A +  +   VK+L+++ A   L  ++G T L VA+     + G    + +     +L N  +G  +L  +           A  L++N  + D+ +  G TPL I 
Sbjct:   29 GRAEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQ--VDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVAL-----QQGHDRVVAV-----LLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIA 234          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 125.176 bits (313), Expect = 3.118e-29
Identity = 85/308 (27.60%), Postives = 144/308 (46.75%), Query Frame = 3
Query:  687 TNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICN 1610
            T+  G  PL IAA+ GHE++  LLLEK AN+N   +   + LH+A    R  + +LLL +GA ++++    +TP   A   G   +++LL+    A +S    +    LH+A     +++   LL   A +  +        H+AA  GH ++ ++ L R  +   NS+  + F  +H+A   N    + +L+KY+A +        T LH+A     ++ V +L++  A  D++   G T LH+A + NQT                            D+   LI NGA +D +  + +TPL I +
Sbjct:  223 TSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVV-QGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADP--NSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQT----------------------------DVVRVLIRNGAKVDAQARELQTPLHIAS 499          

HSP 2 Score: 118.627 bits (296), Expect = 3.545e-27
Identity = 93/331 (28.10%), Postives = 154/331 (46.53%), Query Frame = 3
Query:  624 VALKTGNLSEVLRLVDSVGVNTNLK---GMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDIC 1607
            +A + GN   V+ L+ + G N+N        PL IAA EG E++  +LL+  A+  +  K G T LHLA      ++  LLL++G  V+ +   ++TP  +A    + D + +L+  N A       +  T LH+A   +++E    LL   AD    ++  F   HL+A  GH++I  + ++   +  V ++  +   A+H+ A  +H     +L    A++N +     T LH+A     L+ VK LVEN A++  K +   T LH A      + G  N ++                       YL+ENGAS + +   G+TPL I 
Sbjct:  497 IASRLGNTDIVILLLQA-GANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAA-HYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSD--VGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQA-----AQQGHNNCVR-----------------------YLLENGASPNEQTATGQTPLSIA 795          

HSP 3 Score: 113.235 bits (282), Expect = 1.756e-25
Identity = 88/307 (28.66%), Postives = 148/307 (48.21%), Query Frame = 3
Query:  687 TNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDIC 1607
            T   G+ PL +AA  G  ++V  LL++ AN ++    G+T LHLA   N+  +  +L++ GA V+AQ  +  TP  IA   G+ DI+ LL+ +  A+ +    D  + LH+A    + E    LL+  AD  LL KK F   HLA+  G+ +++ + L+R     V+ + +++   +H+AA  N++    +L++  A          T LHIA K+  +     L++ KA+ + K + G T LH++ +    E                            I+  LIENG+ +  K N G T + +C
Sbjct:  421 TTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAG-ANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERG--TPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKE----------------------------ISGLLIENGSDVGAKANNGLTAMHLC 696          

HSP 4 Score: 97.8265 bits (242), Expect = 1.186e-20
Identity = 81/306 (26.47%), Postives = 143/306 (46.73%), Query Frame = 3
Query:  603 ERTMRFLVALKTGNLSEVLRLVDS-VGVNT-NLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLIT-SNNADLSIGDS---------------------------DRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMK 1430
            E +  FL A + G+L +VL L+ +   +NT N  G+  L +A+ EGH ++V  L++++A ++ A + G+TALH+A    +  +  +L++ GA+VN Q+    TP  +A  +  +++++ L+    N  LS  D                             R  ALH+A       +   LL    +  + +K  F   H+AA  GHE + ++ L++     VN Q     + +H+A      +   +L+   A ++ +  +L T LH A +  +   V  LV   A +  K KNG   LH+A +
Sbjct:   32 EGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGAN--VNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQ 335          

HSP 5 Score: 90.8929 bits (224), Expect = 1.598e-18
Identity = 99/357 (27.73%), Postives = 161/357 (45.10%), Query Frame = 3
Query:  594 ITDERTMRFLVALKTGNLS---EVLRLVDSVGVNTNLK---GMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNF--LKMTSALGVLGNIGEGLDKL-----------EDIAIYLIENGASIDIKNNKGKTPLDIC 1607
            I D RT   L  L     S   +V+ L+   G   + K   G+ PL +AA   H D    LL  +A ++    D  T LH+A H    ++  LLL + AD N++     TP  IA  K    ++ELL+    A  +  +S   T LH+A     +  V  LL  GA+  +   +     HLAA +    ++ + + R+G K V++Q  +    +H+A+   +   + +L++  A+ N    +  + LHIA K         L+++ A+  L  K G T LH+A K       +GN   +++    G   +I EG +++           + +A+ L+ENGAS       G TPL I 
Sbjct:  285 IIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGL-TPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLI-RNGAK-VDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASK-------YGNLEVVRLLLERGTPVDI-EGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIA 630          

HSP 6 Score: 66.2402 bits (160), Expect = 7.698e-11
Identity = 55/218 (25.23%), Postives = 104/218 (47.71%), Query Frame = 3
Query:  987 GDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDI-----------AIYLIENGASIDIKNNKGKTPLDIC 1607
            G ++   +   A  +  LE V  LL AG DI   N    N+ HLA+  GH +++   +KR  +  V++       A+H+A++      + +L++  A++N+Q++   T L++A +  +   VK+L+++ A   L  ++G T L VA+     + G    + +     +L N  +G  +L  +           A  L++N  + D+ +  G TPL I 
Sbjct:   29 GRAEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQ--VDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVAL-----QQGHDRVVAV-----LLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIA 234          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 125.176 bits (313), Expect = 3.242e-29
Identity = 85/308 (27.60%), Postives = 144/308 (46.75%), Query Frame = 3
Query:  687 TNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICN 1610
            T+  G  PL IAA+ GHE++  LLLEK AN+N   +   + LH+A    R  + +LLL +GA ++++    +TP   A   G   +++LL+    A +S    +    LH+A     +++   LL   A +  +        H+AA  GH ++ ++ L R  +   NS+  + F  +H+A   N    + +L+KY+A +        T LH+A     ++ V +L++  A  D++   G T LH+A + NQT                            D+   LI NGA +D +  + +TPL I +
Sbjct:  223 TSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVV-QGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADP--NSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQT----------------------------DVVRVLIRNGAKVDAQARELQTPLHIAS 499          

HSP 2 Score: 118.627 bits (296), Expect = 3.952e-27
Identity = 93/331 (28.10%), Postives = 154/331 (46.53%), Query Frame = 3
Query:  624 VALKTGNLSEVLRLVDSVGVNTNLK---GMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDIC 1607
            +A + GN   V+ L+ + G N+N        PL IAA EG E++  +LL+  A+  +  K G T LHLA      ++  LLL++G  V+ +   ++TP  +A    + D + +L+  N A       +  T LH+A   +++E    LL   AD    ++  F   HL+A  GH++I  + ++   +  V ++  +   A+H+ A  +H     +L    A++N +     T LH+A     L+ VK LVEN A++  K +   T LH A      + G  N ++                       YL+ENGAS + +   G+TPL I 
Sbjct:  497 IASRLGNTDIVILLLQA-GANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAA-HYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSD--VGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQA-----AQQGHNNCVR-----------------------YLLENGASPNEQTATGQTPLSIA 795          

HSP 3 Score: 113.235 bits (282), Expect = 2.117e-25
Identity = 88/307 (28.66%), Postives = 148/307 (48.21%), Query Frame = 3
Query:  687 TNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDIC 1607
            T   G+ PL +AA  G  ++V  LL++ AN ++    G+T LHLA   N+  +  +L++ GA V+AQ  +  TP  IA   G+ DI+ LL+ +  A+ +    D  + LH+A    + E    LL+  AD  LL KK F   HLA+  G+ +++ + L+R     V+ + +++   +H+AA  N++    +L++  A          T LHIA K+  +     L++ KA+ + K + G T LH++ +    E                            I+  LIENG+ +  K N G T + +C
Sbjct:  421 TTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAG-ANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTP--VDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKE----------------------------ISGLLIENGSDVGAKANNGLTAMHLC 696          

HSP 4 Score: 97.4413 bits (241), Expect = 1.465e-20
Identity = 81/306 (26.47%), Postives = 143/306 (46.73%), Query Frame = 3
Query:  603 ERTMRFLVALKTGNLSEVLRLVDS-VGVNT-NLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSN-NADLSIGDS---------------------------DRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMK 1430
            E +  FL A + G+L +VL L+ +   +NT N  G+  L +A+ EGH ++V  L++++A ++ A + G+TALH+A    +  +  +L++ GA+VN Q+    TP  +A  +  +++++ L+    N  LS  D                             R  ALH+A       +   LL    +  + +K  F   H+AA  GHE + ++ L++     VN Q     + +H+A      +   +L+   A ++ +  +L T LH A +  +   V  LV   A +  K KNG   LH+A +
Sbjct:   32 EGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGAN--VNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQ 335          

HSP 5 Score: 90.8929 bits (224), Expect = 1.551e-18
Identity = 99/357 (27.73%), Postives = 161/357 (45.10%), Query Frame = 3
Query:  594 ITDERTMRFLVALKTGNLS---EVLRLVDSVGVNTNLK---GMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNF--LKMTSALGVLGNIGEGLDKL-----------EDIAIYLIENGASIDIKNNKGKTPLDIC 1607
            I D RT   L  L     S   +V+ L+   G   + K   G+ PL +AA   H D    LL  +A ++    D  T LH+A H    ++  LLL + AD N++     TP  IA  K    ++ELL+    A  +  +S   T LH+A     +  V  LL  GA+  +   +     HLAA +    ++ + + R+G K V++Q  +    +H+A+   +   + +L++  A+ N    +  + LHIA K         L+++ A+  L  K G T LH+A K       +GN   +++    G   +I EG +++           + +A+ L+ENGAS       G TPL I 
Sbjct:  285 IIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGL-TPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLI-RNGAK-VDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASK-------YGNLEVVRLLLERGTPVDI-EGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIA 630          

HSP 6 Score: 65.855 bits (159), Expect = 8.580e-11
Identity = 55/218 (25.23%), Postives = 104/218 (47.71%), Query Frame = 3
Query:  987 GDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDI-----------AIYLIENGASIDIKNNKGKTPLDIC 1607
            G ++   +   A  +  LE V  LL AG DI   N    N+ HLA+  GH +++   +KR  +  V++       A+H+A++      + +L++  A++N+Q++   T L++A +  +   VK+L+++ A   L  ++G T L VA+     + G    + +     +L N  +G  +L  +           A  L++N  + D+ +  G TPL I 
Sbjct:   29 GRAEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQ--VDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVAL-----QQGHDRVVAV-----LLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIA 234          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 125.176 bits (313), Expect = 3.242e-29
Identity = 85/308 (27.60%), Postives = 144/308 (46.75%), Query Frame = 3
Query:  687 TNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICN 1610
            T+  G  PL IAA+ GHE++  LLLEK AN+N   +   + LH+A    R  + +LLL +GA ++++    +TP   A   G   +++LL+    A +S    +    LH+A     +++   LL   A +  +        H+AA  GH ++ ++ L R  +   NS+  + F  +H+A   N    + +L+KY+A +        T LH+A     ++ V +L++  A  D++   G T LH+A + NQT                            D+   LI NGA +D +  + +TPL I +
Sbjct:  223 TSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVV-QGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADP--NSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQT----------------------------DVVRVLIRNGAKVDAQARELQTPLHIAS 499          

HSP 2 Score: 118.627 bits (296), Expect = 3.952e-27
Identity = 93/331 (28.10%), Postives = 154/331 (46.53%), Query Frame = 3
Query:  624 VALKTGNLSEVLRLVDSVGVNTNLK---GMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDIC 1607
            +A + GN   V+ L+ + G N+N        PL IAA EG E++  +LL+  A+  +  K G T LHLA      ++  LLL++G  V+ +   ++TP  +A    + D + +L+  N A       +  T LH+A   +++E    LL   AD    ++  F   HL+A  GH++I  + ++   +  V ++  +   A+H+ A  +H     +L    A++N +     T LH+A     L+ VK LVEN A++  K +   T LH A      + G  N ++                       YL+ENGAS + +   G+TPL I 
Sbjct:  497 IASRLGNTDIVILLLQA-GANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAA-HYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSD--VGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQA-----AQQGHNNCVR-----------------------YLLENGASPNEQTATGQTPLSIA 795          

HSP 3 Score: 113.235 bits (282), Expect = 2.117e-25
Identity = 88/307 (28.66%), Postives = 148/307 (48.21%), Query Frame = 3
Query:  687 TNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDIC 1607
            T   G+ PL +AA  G  ++V  LL++ AN ++    G+T LHLA   N+  +  +L++ GA V+AQ  +  TP  IA   G+ DI+ LL+ +  A+ +    D  + LH+A    + E    LL+  AD  LL KK F   HLA+  G+ +++ + L+R     V+ + +++   +H+AA  N++    +L++  A          T LHIA K+  +     L++ KA+ + K + G T LH++ +    E                            I+  LIENG+ +  K N G T + +C
Sbjct:  421 TTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAG-ANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTP--VDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKE----------------------------ISGLLIENGSDVGAKANNGLTAMHLC 696          

HSP 4 Score: 97.4413 bits (241), Expect = 1.465e-20
Identity = 81/306 (26.47%), Postives = 143/306 (46.73%), Query Frame = 3
Query:  603 ERTMRFLVALKTGNLSEVLRLVDS-VGVNT-NLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSN-NADLSIGDS---------------------------DRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMK 1430
            E +  FL A + G+L +VL L+ +   +NT N  G+  L +A+ EGH ++V  L++++A ++ A + G+TALH+A    +  +  +L++ GA+VN Q+    TP  +A  +  +++++ L+    N  LS  D                             R  ALH+A       +   LL    +  + +K  F   H+AA  GHE + ++ L++     VN Q     + +H+A      +   +L+   A ++ +  +L T LH A +  +   V  LV   A +  K KNG   LH+A +
Sbjct:   32 EGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGAN--VNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQ 335          

HSP 5 Score: 90.8929 bits (224), Expect = 1.551e-18
Identity = 99/357 (27.73%), Postives = 161/357 (45.10%), Query Frame = 3
Query:  594 ITDERTMRFLVALKTGNLS---EVLRLVDSVGVNTNLK---GMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNF--LKMTSALGVLGNIGEGLDKL-----------EDIAIYLIENGASIDIKNNKGKTPLDIC 1607
            I D RT   L  L     S   +V+ L+   G   + K   G+ PL +AA   H D    LL  +A ++    D  T LH+A H    ++  LLL + AD N++     TP  IA  K    ++ELL+    A  +  +S   T LH+A     +  V  LL  GA+  +   +     HLAA +    ++ + + R+G K V++Q  +    +H+A+   +   + +L++  A+ N    +  + LHIA K         L+++ A+  L  K G T LH+A K       +GN   +++    G   +I EG +++           + +A+ L+ENGAS       G TPL I 
Sbjct:  285 IIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGL-TPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLI-RNGAK-VDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASK-------YGNLEVVRLLLERGTPVDI-EGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIA 630          

HSP 6 Score: 65.855 bits (159), Expect = 8.580e-11
Identity = 55/218 (25.23%), Postives = 104/218 (47.71%), Query Frame = 3
Query:  987 GDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDI-----------AIYLIENGASIDIKNNKGKTPLDIC 1607
            G ++   +   A  +  LE V  LL AG DI   N    N+ HLA+  GH +++   +KR  +  V++       A+H+A++      + +L++  A++N+Q++   T L++A +  +   VK+L+++ A   L  ++G T L VA+     + G    + +     +L N  +G  +L  +           A  L++N  + D+ +  G TPL I 
Sbjct:   29 GRAEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQ--VDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVAL-----QQGHDRVVAV-----LLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIA 234          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 125.176 bits (313), Expect = 3.512e-29
Identity = 85/308 (27.60%), Postives = 144/308 (46.75%), Query Frame = 3
Query:  687 TNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICN 1610
            T+  G  PL IAA+ GHE++  LLLEK AN+N   +   + LH+A    R  + +LLL +GA ++++    +TP   A   G   +++LL+    A +S    +    LH+A     +++   LL   A +  +        H+AA  GH ++ ++ L R  +   NS+  + F  +H+A   N    + +L+KY+A +        T LH+A     ++ V +L++  A  D++   G T LH+A + NQT                            D+   LI NGA +D +  + +TPL I +
Sbjct:  223 TSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVV-QGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADP--NSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQT----------------------------DVVRVLIRNGAKVDAQARELQTPLHIAS 499          

HSP 2 Score: 118.627 bits (296), Expect = 3.853e-27
Identity = 93/331 (28.10%), Postives = 154/331 (46.53%), Query Frame = 3
Query:  624 VALKTGNLSEVLRLVDSVGVNTNLK---GMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDIC 1607
            +A + GN   V+ L+ + G N+N        PL IAA EG E++  +LL+  A+  +  K G T LHLA      ++  LLL++G  V+ +   ++TP  +A    + D + +L+  N A       +  T LH+A   +++E    LL   AD    ++  F   HL+A  GH++I  + ++   +  V ++  +   A+H+ A  +H     +L    A++N +     T LH+A     L+ VK LVEN A++  K +   T LH A      + G  N ++                       YL+ENGAS + +   G+TPL I 
Sbjct:  497 IASRLGNTDIVILLLQA-GANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAA-HYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSD--VGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQA-----AQQGHNNCVR-----------------------YLLENGASPNEQTATGQTPLSIA 795          

HSP 3 Score: 113.235 bits (282), Expect = 1.891e-25
Identity = 88/307 (28.66%), Postives = 148/307 (48.21%), Query Frame = 3
Query:  687 TNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDIC 1607
            T   G+ PL +AA  G  ++V  LL++ AN ++    G+T LHLA   N+  +  +L++ GA V+AQ  +  TP  IA   G+ DI+ LL+ +  A+ +    D  + LH+A    + E    LL+  AD  LL KK F   HLA+  G+ +++ + L+R     V+ + +++   +H+AA  N++    +L++  A          T LHIA K+  +     L++ KA+ + K + G T LH++ +    E                            I+  LIENG+ +  K N G T + +C
Sbjct:  421 TTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAG-ANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERG--TPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKE----------------------------ISGLLIENGSDVGAKANNGLTAMHLC 696          

HSP 4 Score: 97.8265 bits (242), Expect = 1.378e-20
Identity = 81/306 (26.47%), Postives = 143/306 (46.73%), Query Frame = 3
Query:  603 ERTMRFLVALKTGNLSEVLRLVDS-VGVNT-NLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLIT-SNNADLSIGDS---------------------------DRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMK 1430
            E +  FL A + G+L +VL L+ +   +NT N  G+  L +A+ EGH ++V  L++++A ++ A + G+TALH+A    +  +  +L++ GA+VN Q+    TP  +A  +  +++++ L+    N  LS  D                             R  ALH+A       +   LL    +  + +K  F   H+AA  GHE + ++ L++     VN Q     + +H+A      +   +L+   A ++ +  +L T LH A +  +   V  LV   A +  K KNG   LH+A +
Sbjct:   32 EGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGAN--VNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQ 335          

HSP 5 Score: 90.8929 bits (224), Expect = 1.732e-18
Identity = 99/357 (27.73%), Postives = 161/357 (45.10%), Query Frame = 3
Query:  594 ITDERTMRFLVALKTGNLS---EVLRLVDSVGVNTNLK---GMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNF--LKMTSALGVLGNIGEGLDKL-----------EDIAIYLIENGASIDIKNNKGKTPLDIC 1607
            I D RT   L  L     S   +V+ L+   G   + K   G+ PL +AA   H D    LL  +A ++    D  T LH+A H    ++  LLL + AD N++     TP  IA  K    ++ELL+    A  +  +S   T LH+A     +  V  LL  GA+  +   +     HLAA +    ++ + + R+G K V++Q  +    +H+A+   +   + +L++  A+ N    +  + LHIA K         L+++ A+  L  K G T LH+A K       +GN   +++    G   +I EG +++           + +A+ L+ENGAS       G TPL I 
Sbjct:  285 IIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGL-TPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLI-RNGAK-VDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASK-------YGNLEVVRLLLERGTPVDI-EGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIA 630          

HSP 6 Score: 65.855 bits (159), Expect = 8.694e-11
Identity = 55/218 (25.23%), Postives = 104/218 (47.71%), Query Frame = 3
Query:  987 GDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDI-----------AIYLIENGASIDIKNNKGKTPLDIC 1607
            G ++   +   A  +  LE V  LL AG DI   N    N+ HLA+  GH +++   +KR  +  V++       A+H+A++      + +L++  A++N+Q++   T L++A +  +   VK+L+++ A   L  ++G T L VA+     + G    + +     +L N  +G  +L  +           A  L++N  + D+ +  G TPL I 
Sbjct:   29 GRAEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQ--VDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVAL-----QQGHDRVVAV-----LLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIA 234          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Fly
Match: mib1 (gene:FBgn0263601 transcript:FBtr0333578)

HSP 1 Score: 254.988 bits (650), Expect = 2.144e-72
Identity = 203/691 (29.38%), Postives = 327/691 (47.32%), Query Frame = 3
Query:   81 GANISSFDIRKKVVIANQDLSTIIKKQKNHGGWNDLMKECLTGPCKLIN-DDGSDATVMGPSGMIYRLNSELLV----PFKSVKKHKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHP----KTIKSEIVENTELKXXXXXXXXXXXXXXL----ITDERTMRFLVALKTGNLSEVLRLVDS----------------VGVNTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFL-KRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKY-KADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVN--------QTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSL-KTRILSLVER----------------------------DSQKHHITKKELLEHPVQPSDARSNEAEL----MELRQKLKEMEDEKI-----CKICHDRRLKVIFE-CGHM-CCDDCSDNISECHLCSEKILHKIKIN 1916
            G     F I  KV + + DL  +   Q  HGGW D M ECL+    ++  D+  D  V   SG  +  N  +L     P  +  + ++G  V++  D E  K+LQ  HGEW + M+  LGK   V Q++ D D K+   N  +  +P    K   S   + +      S +   +  + L    ++ + T  F+ A   G  +     +                  V VN    G   L  A+  GH +++ +LL    ++ I DKDGD A+H A   +   + ++L K GAD+NA+N ++ T   IAV KG  ++++ L+T      S+ DS+ DT LH A++    E +  LL+ GADI L N   FNA H AA+ G+   ++I L K +   +V  +K+D + A+H+AA+NNH     +L+   KA+++ QN+ L+TALH+AV+R+++  VK LV++ A+L++ DK+G+T LH A++ +        Q   GFG  L     +G+             IA +L  NGA + +KN K +TPLD+C D +L KT +    ER                             S   ++    L      P+ + S+   L     E+ Q L E   +       C +C D +   +F+ CGH+ CC+ C+  + +C +C E +  + KI+
Sbjct:  223 GKGPHGFQIGDKVTV-DLDLEIVQSLQHGHGGWTDGMFECLSNAGMVVGIDEDHDIVVAYNSGNRWTFNPAVLTKVSSPTTAPPEFQVGDIVKICSDVESIKILQRGHGEWADAMQLTLGKIGRVQQVYHDNDLKVEVGNTSWTYNPLAVCKVASSTASDGSCAPVIPSSERLSAILKKLFEPNVSGDATEEFVKAAANGFAARCEEYLAGAAQPSTSSASPSSGPDVNVNGVFAGHTALQAASQNGHIEVIQVLLRHAVDVEIEDKDGDRAVHHAAFGDEAAVIEILAKAGADLNARNKRRQTSLHIAVNKGHLNVVKTLLTL-GCHPSLQDSEGDTPLHDAISKEHDEMLSLLLDFGADITLNNNNGFNALHHAALKGNPSAMKILLTKTNRPWIVEEKKDDGYTALHLAALNNHVEIAELLVHMGKANMDRQNVNLQTALHLAVERQHVQIVKLLVQDGADLNIPDKDGDTPLHEALRHHTLSQLKQLQDVEGFGKLL-----MGLRN--ANNKKASASIACFLAANGADLTLKNRKQQTPLDLCPDPNLCKTLVKCYNERKTDDSELPGNVAGTSSSARARAASGSLNQSSSVNMPLSSLAASSTFPAASSSSIFALNGIANEMSQSLHEDPPKSSASLDECLVCSDAKRDTVFKPCGHVSCCETCAPRVKKCLICRETVSSREKID 904          

HSP 2 Score: 52.373 bits (124), Expect = 1.610e-6
Identity = 21/70 (30.00%), Postives = 43/70 (61.43%), Query Frame = 3
Query: 1701 VQPSDARSNEAE-LMELRQKLKEMEDEKICKICHDRRLKVIFECGHMCCDDCSDNISECHLCSEKILHKI 1907
            V PS+  + + + + +L+Q+L++++++ +C +C DR   ++F CGH  C  C D I  C +C + +  +I
Sbjct: 1043 VAPSNVNNFQMDDVQKLKQQLQDIKEQTMCPVCFDRIKNMVFLCGHGTCQMCGDQIEGCPICRKTVEKRI 1112          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Fly
Match: mib1 (gene:FBgn0263601 transcript:FBtr0075520)

HSP 1 Score: 254.603 bits (649), Expect = 4.372e-72
Identity = 203/691 (29.38%), Postives = 327/691 (47.32%), Query Frame = 3
Query:   81 GANISSFDIRKKVVIANQDLSTIIKKQKNHGGWNDLMKECLTGPCKLIN-DDGSDATVMGPSGMIYRLNSELLV----PFKSVKKHKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHP----KTIKSEIVENTELKXXXXXXXXXXXXXXL----ITDERTMRFLVALKTGNLSEVLRLVDS----------------VGVNTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFL-KRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKY-KADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVN--------QTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSL-KTRILSLVER----------------------------DSQKHHITKKELLEHPVQPSDARSNEAEL----MELRQKLKEMEDEKI-----CKICHDRRLKVIFE-CGHM-CCDDCSDNISECHLCSEKILHKIKIN 1916
            G     F I  KV + + DL  +   Q  HGGW D M ECL+    ++  D+  D  V   SG  +  N  +L     P  +  + ++G  V++  D E  K+LQ  HGEW + M+  LGK   V Q++ D D K+   N  +  +P    K   S   + +      S +   +  + L    ++ + T  F+ A   G  +     +                  V VN    G   L  A+  GH +++ +LL    ++ I DKDGD A+H A   +   + ++L K GAD+NA+N ++ T   IAV KG  ++++ L+T      S+ DS+ DT LH A++    E +  LL+ GADI L N   FNA H AA+ G+   ++I L K +   +V  +K+D + A+H+AA+NNH     +L+   KA+++ QN+ L+TALH+AV+R+++  VK LV++ A+L++ DK+G+T LH A++ +        Q   GFG  L     +G+             IA +L  NGA + +KN K +TPLD+C D +L KT +    ER                             S   ++    L      P+ + S+   L     E+ Q L E   +       C +C D +   +F+ CGH+ CC+ C+  + +C +C E +  + KI+
Sbjct:  334 GKGPHGFQIGDKVTV-DLDLEIVQSLQHGHGGWTDGMFECLSNAGMVVGIDEDHDIVVAYNSGNRWTFNPAVLTKVSSPTTAPPEFQVGDIVKICSDVESIKILQRGHGEWADAMQLTLGKIGRVQQVYHDNDLKVEVGNTSWTYNPLAVCKVASSTASDGSCAPVIPSSERLSAILKKLFEPNVSGDATEEFVKAAANGFAARCEEYLAGAAQPSTSSASPSSGPDVNVNGVFAGHTALQAASQNGHIEVIQVLLRHAVDVEIEDKDGDRAVHHAAFGDEAAVIEILAKAGADLNARNKRRQTSLHIAVNKGHLNVVKTLLTL-GCHPSLQDSEGDTPLHDAISKEHDEMLSLLLDFGADITLNNNNGFNALHHAALKGNPSAMKILLTKTNRPWIVEEKKDDGYTALHLAALNNHVEIAELLVHMGKANMDRQNVNLQTALHLAVERQHVQIVKLLVQDGADLNIPDKDGDTPLHEALRHHTLSQLKQLQDVEGFGKLL-----MGLRN--ANNKKASASIACFLAANGADLTLKNRKQQTPLDLCPDPNLCKTLVKCYNERKTDDSELPGNVAGTSSSARARAASGSLNQSSSVNMPLSSLAASSTFPAASSSSIFALNGIANEMSQSLHEDPPKSSASLDECLVCSDAKRDTVFKPCGHVSCCETCAPRVKKCLICRETVSSREKID 1015          

HSP 2 Score: 52.373 bits (124), Expect = 1.613e-6
Identity = 21/70 (30.00%), Postives = 43/70 (61.43%), Query Frame = 3
Query: 1701 VQPSDARSNEAE-LMELRQKLKEMEDEKICKICHDRRLKVIFECGHMCCDDCSDNISECHLCSEKILHKI 1907
            V PS+  + + + + +L+Q+L++++++ +C +C DR   ++F CGH  C  C D I  C +C + +  +I
Sbjct: 1154 VAPSNVNNFQMDDVQKLKQQLQDIKEQTMCPVCFDRIKNMVFLCGHGTCQMCGDQIEGCPICRKTVEKRI 1223          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Fly
Match: mib2 (gene:FBgn0086442 transcript:FBtr0336840)

HSP 1 Score: 177.178 bits (448), Expect = 4.329e-46
Identity = 142/470 (30.21%), Postives = 238/470 (50.64%), Query Frame = 3
Query:   93 SSFDIRKKVVIANQDLSTIIKKQKNHGGWNDLMKECLT--GPCKLINDDGSDATVMGPSGMIYRLNSELLVPFKSVKKHKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIF--IVHPKTIKSEIVENTELKXXXXXXXXXXXXXXLITDERTMRFLVALK-------------TGNLSEVLRLVD--SVGVNTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNA-GADIYLLNKKLFNAYHLAAISGH----EKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLM-KYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAM 1427
             SF +  +V +   ++  ++K Q+ HGGWN  M E L+  G    I D G            +  +   LV    V   ++G  V +I D  + + LQ  HGEW E MR+ LGK  +V++++ DGD +I   ++ F   ++PK +K   +E + L +     +   +      D   M  L  L               G+L  V + +D     V+    G   + +A+++G+ DLV+ L+ K AN+N  DK+GD+ALH A   N+     +LL+ GA+VN  N+   +   I   K +   +  L+  +NA+++I DS  DTALH A+     E VE L NA   D  + N + FN  H AA+ G+     +IL   L R   +LVN +K+D FAA+H+AA+N H   +  L+ + +A+L+++N   +T   +AV + +   ++ LV    +++ KD++G+ A+H+ +
Sbjct:  251 PSFSVGDRVKVC-LEVDALMKLQQGHGGWNPRMVEHLSKLGTVHRITDKGDIRVQYENCPNRWTFHPAALV---KVVSFRVGDLVTIINDANKVQQLQKGHGEWIEIMRHALGKICKVVKVYSDGDLRIQQLDDGFEWTLNPKCVK---LERSPLATAAERSNSMMDLSHRRADH-VMTPLSGLSGSSVADKLVREAAQGHLDFVRQYLDVNPSQVDVMSGGKACIQVASHQGYVDLVSYLISKGANVNAVDKEGDSALHYAAFGNQPATMRVLLQHGAEVNFLNSSHCSALHICAHKKTPHCVRELL-QHNANVNIQDSYGDTALHDAIGKENTEVVELLCNAPNLDFTVKNNRGFNVLHHAALKGNVVAARRIL--LLSR---QLVNVRKDDGFAALHLAALNGHAQVVETLVTEGQAELDIRNNRQQTPFLLAVSQGHAGVIERLVRLSCDVNAKDEDGDNAMHLCV 706          

HSP 2 Score: 60.8474 bits (146), Expect = 3.502e-9
Identity = 55/203 (27.09%), Postives = 94/203 (46.31%), Query Frame = 3
Query:  639 GNLSEVLRLVDSVGVNTNL---KGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLL-KKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAG-ADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAM 1232
            GN    +R++   G   N         L I A++     V  LL+  AN+NI D  GDTALH A+ +   ++ +LL      D   +NN+       A LKG+      ++  +   +++   D   ALHLA  +   + VE L+  G A++ + N +    + LA   GH  ++E  ++   +  VN++ ED   A+H+  +
Sbjct:  507 GNQPATMRVLLQHGAEVNFLNSSHCSALHICAHKKTPHCVRELLQHNANVNIQDSYGDTALHDAIGKENTEVVELLCNAPNLDFTVKNNRGFNVLHHAALKGNVVAARRILLLSRQLVNVRKDDGFAALHLAALNGHAQVVETLVTEGQAELDIRNNRQQTPFLLAVSQGHAGVIERLVRLSCD--VNAKDEDGDNAMHLCVI 707          

HSP 3 Score: 56.9954 bits (136), Expect = 4.829e-8
Identity = 56/244 (22.95%), Postives = 106/244 (43.44%), Query Frame = 3
Query:  927 KGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNG---NTALHVAMKVN-----------------QTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPL 1598
            +G  D +   +  N + + +    +   + +A +   ++ V  L++ GA++  ++K+  +A H AA       + + L+   E  VN       +A+H+ A     HC+  L+++ A++N+Q+    TALH A+ ++    V+ L+ N   LD   KN    N   H A+K N                 + + GF         L  L    + ++ L      + E  A +DI+NN+ +TP 
Sbjct:  441 QGHLDFVRQYLDVNPSQVDVMSGGK-ACIQVASHQGYVDLVSYLISKGANVNAVDKEGDSALHYAAFGNQPATMRVLLQHGAE--VNFLNSSHCSALHICAHKKTPHCVRELLQHNANVNIQDSYGDTALHDAIGKENTEVVE-LLCNAPNLDFTVKNNRGFNVLHHAALKGNVVAARRILLLSRQLVNVRKDDGFAAL-----HLAALNGHAQVVETL------VTEGQAELDIRNNRQQTPF 669          

HSP 4 Score: 56.6102 bits (135), Expect = 7.466e-8
Identity = 27/71 (38.03%), Postives = 39/71 (54.93%), Query Frame = 3
Query: 1707 PSDA-RSNEAELME-LRQKLKEMEDEKICKICHDRRLKVIFECGHMCCDDCSDNISECHLCSEKILHKIKI 1913
            PSD  R    +L+  L  K+ E E+   C IC +R+  V F CGH  C  C++ +  CH+C + IL KI +
Sbjct:  978 PSDPTRLPSGDLLRYLENKVLEFEESHFCGICMERKRDVAFLCGHGACSHCAETLRTCHMCRKTILKKINL 1048          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Fly
Match: mib2 (gene:FBgn0086442 transcript:FBtr0081142)

HSP 1 Score: 177.178 bits (448), Expect = 4.329e-46
Identity = 142/470 (30.21%), Postives = 238/470 (50.64%), Query Frame = 3
Query:   93 SSFDIRKKVVIANQDLSTIIKKQKNHGGWNDLMKECLT--GPCKLINDDGSDATVMGPSGMIYRLNSELLVPFKSVKKHKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIF--IVHPKTIKSEIVENTELKXXXXXXXXXXXXXXLITDERTMRFLVALK-------------TGNLSEVLRLVD--SVGVNTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNA-GADIYLLNKKLFNAYHLAAISGH----EKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLM-KYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAM 1427
             SF +  +V +   ++  ++K Q+ HGGWN  M E L+  G    I D G            +  +   LV    V   ++G  V +I D  + + LQ  HGEW E MR+ LGK  +V++++ DGD +I   ++ F   ++PK +K   +E + L +     +   +      D   M  L  L               G+L  V + +D     V+    G   + +A+++G+ DLV+ L+ K AN+N  DK+GD+ALH A   N+     +LL+ GA+VN  N+   +   I   K +   +  L+  +NA+++I DS  DTALH A+     E VE L NA   D  + N + FN  H AA+ G+     +IL   L R   +LVN +K+D FAA+H+AA+N H   +  L+ + +A+L+++N   +T   +AV + +   ++ LV    +++ KD++G+ A+H+ +
Sbjct:  251 PSFSVGDRVKVC-LEVDALMKLQQGHGGWNPRMVEHLSKLGTVHRITDKGDIRVQYENCPNRWTFHPAALV---KVVSFRVGDLVTIINDANKVQQLQKGHGEWIEIMRHALGKICKVVKVYSDGDLRIQQLDDGFEWTLNPKCVK---LERSPLATAAERSNSMMDLSHRRADH-VMTPLSGLSGSSVADKLVREAAQGHLDFVRQYLDVNPSQVDVMSGGKACIQVASHQGYVDLVSYLISKGANVNAVDKEGDSALHYAAFGNQPATMRVLLQHGAEVNFLNSSHCSALHICAHKKTPHCVRELL-QHNANVNIQDSYGDTALHDAIGKENTEVVELLCNAPNLDFTVKNNRGFNVLHHAALKGNVVAARRIL--LLSR---QLVNVRKDDGFAALHLAALNGHAQVVETLVTEGQAELDIRNNRQQTPFLLAVSQGHAGVIERLVRLSCDVNAKDEDGDNAMHLCV 706          

HSP 2 Score: 60.8474 bits (146), Expect = 3.502e-9
Identity = 55/203 (27.09%), Postives = 94/203 (46.31%), Query Frame = 3
Query:  639 GNLSEVLRLVDSVGVNTNL---KGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLL-KKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAG-ADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAM 1232
            GN    +R++   G   N         L I A++     V  LL+  AN+NI D  GDTALH A+ +   ++ +LL      D   +NN+       A LKG+      ++  +   +++   D   ALHLA  +   + VE L+  G A++ + N +    + LA   GH  ++E  ++   +  VN++ ED   A+H+  +
Sbjct:  507 GNQPATMRVLLQHGAEVNFLNSSHCSALHICAHKKTPHCVRELLQHNANVNIQDSYGDTALHDAIGKENTEVVELLCNAPNLDFTVKNNRGFNVLHHAALKGNVVAARRILLLSRQLVNVRKDDGFAALHLAALNGHAQVVETLVTEGQAELDIRNNRQQTPFLLAVSQGHAGVIERLVRLSCD--VNAKDEDGDNAMHLCVI 707          

HSP 3 Score: 56.9954 bits (136), Expect = 4.829e-8
Identity = 56/244 (22.95%), Postives = 106/244 (43.44%), Query Frame = 3
Query:  927 KGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNG---NTALHVAMKVN-----------------QTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPL 1598
            +G  D +   +  N + + +    +   + +A +   ++ V  L++ GA++  ++K+  +A H AA       + + L+   E  VN       +A+H+ A     HC+  L+++ A++N+Q+    TALH A+ ++    V+ L+ N   LD   KN    N   H A+K N                 + + GF         L  L    + ++ L      + E  A +DI+NN+ +TP 
Sbjct:  441 QGHLDFVRQYLDVNPSQVDVMSGGK-ACIQVASHQGYVDLVSYLISKGANVNAVDKEGDSALHYAAFGNQPATMRVLLQHGAE--VNFLNSSHCSALHICAHKKTPHCVRELLQHNANVNIQDSYGDTALHDAIGKENTEVVE-LLCNAPNLDFTVKNNRGFNVLHHAALKGNVVAARRILLLSRQLVNVRKDDGFAAL-----HLAALNGHAQVVETL------VTEGQAELDIRNNRQQTPF 669          

HSP 4 Score: 56.6102 bits (135), Expect = 7.466e-8
Identity = 27/71 (38.03%), Postives = 39/71 (54.93%), Query Frame = 3
Query: 1707 PSDA-RSNEAELME-LRQKLKEMEDEKICKICHDRRLKVIFECGHMCCDDCSDNISECHLCSEKILHKIKI 1913
            PSD  R    +L+  L  K+ E E+   C IC +R+  V F CGH  C  C++ +  CH+C + IL KI +
Sbjct:  978 PSDPTRLPSGDLLRYLENKVLEFEESHFCGICMERKRDVAFLCGHGACSHCAETLRTCHMCRKTILKKINL 1048          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Fly
Match: mib2 (gene:FBgn0086442 transcript:FBtr0336841)

HSP 1 Score: 177.178 bits (448), Expect = 4.329e-46
Identity = 142/470 (30.21%), Postives = 238/470 (50.64%), Query Frame = 3
Query:   93 SSFDIRKKVVIANQDLSTIIKKQKNHGGWNDLMKECLT--GPCKLINDDGSDATVMGPSGMIYRLNSELLVPFKSVKKHKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIF--IVHPKTIKSEIVENTELKXXXXXXXXXXXXXXLITDERTMRFLVALK-------------TGNLSEVLRLVD--SVGVNTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNA-GADIYLLNKKLFNAYHLAAISGH----EKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLM-KYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAM 1427
             SF +  +V +   ++  ++K Q+ HGGWN  M E L+  G    I D G            +  +   LV    V   ++G  V +I D  + + LQ  HGEW E MR+ LGK  +V++++ DGD +I   ++ F   ++PK +K   +E + L +     +   +      D   M  L  L               G+L  V + +D     V+    G   + +A+++G+ DLV+ L+ K AN+N  DK+GD+ALH A   N+     +LL+ GA+VN  N+   +   I   K +   +  L+  +NA+++I DS  DTALH A+     E VE L NA   D  + N + FN  H AA+ G+     +IL   L R   +LVN +K+D FAA+H+AA+N H   +  L+ + +A+L+++N   +T   +AV + +   ++ LV    +++ KD++G+ A+H+ +
Sbjct:  251 PSFSVGDRVKVC-LEVDALMKLQQGHGGWNPRMVEHLSKLGTVHRITDKGDIRVQYENCPNRWTFHPAALV---KVVSFRVGDLVTIINDANKVQQLQKGHGEWIEIMRHALGKICKVVKVYSDGDLRIQQLDDGFEWTLNPKCVK---LERSPLATAAERSNSMMDLSHRRADH-VMTPLSGLSGSSVADKLVREAAQGHLDFVRQYLDVNPSQVDVMSGGKACIQVASHQGYVDLVSYLISKGANVNAVDKEGDSALHYAAFGNQPATMRVLLQHGAEVNFLNSSHCSALHICAHKKTPHCVRELL-QHNANVNIQDSYGDTALHDAIGKENTEVVELLCNAPNLDFTVKNNRGFNVLHHAALKGNVVAARRIL--LLSR---QLVNVRKDDGFAALHLAALNGHAQVVETLVTEGQAELDIRNNRQQTPFLLAVSQGHAGVIERLVRLSCDVNAKDEDGDNAMHLCV 706          

HSP 2 Score: 60.8474 bits (146), Expect = 3.502e-9
Identity = 55/203 (27.09%), Postives = 94/203 (46.31%), Query Frame = 3
Query:  639 GNLSEVLRLVDSVGVNTNL---KGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLL-KKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAG-ADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAM 1232
            GN    +R++   G   N         L I A++     V  LL+  AN+NI D  GDTALH A+ +   ++ +LL      D   +NN+       A LKG+      ++  +   +++   D   ALHLA  +   + VE L+  G A++ + N +    + LA   GH  ++E  ++   +  VN++ ED   A+H+  +
Sbjct:  507 GNQPATMRVLLQHGAEVNFLNSSHCSALHICAHKKTPHCVRELLQHNANVNIQDSYGDTALHDAIGKENTEVVELLCNAPNLDFTVKNNRGFNVLHHAALKGNVVAARRILLLSRQLVNVRKDDGFAALHLAALNGHAQVVETLVTEGQAELDIRNNRQQTPFLLAVSQGHAGVIERLVRLSCD--VNAKDEDGDNAMHLCVI 707          

HSP 3 Score: 56.9954 bits (136), Expect = 4.829e-8
Identity = 56/244 (22.95%), Postives = 106/244 (43.44%), Query Frame = 3
Query:  927 KGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNG---NTALHVAMKVN-----------------QTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPL 1598
            +G  D +   +  N + + +    +   + +A +   ++ V  L++ GA++  ++K+  +A H AA       + + L+   E  VN       +A+H+ A     HC+  L+++ A++N+Q+    TALH A+ ++    V+ L+ N   LD   KN    N   H A+K N                 + + GF         L  L    + ++ L      + E  A +DI+NN+ +TP 
Sbjct:  441 QGHLDFVRQYLDVNPSQVDVMSGGK-ACIQVASHQGYVDLVSYLISKGANVNAVDKEGDSALHYAAFGNQPATMRVLLQHGAE--VNFLNSSHCSALHICAHKKTPHCVRELLQHNANVNIQDSYGDTALHDAIGKENTEVVE-LLCNAPNLDFTVKNNRGFNVLHHAALKGNVVAARRILLLSRQLVNVRKDDGFAAL-----HLAALNGHAQVVETL------VTEGQAELDIRNNRQQTPF 669          

HSP 4 Score: 56.6102 bits (135), Expect = 7.466e-8
Identity = 27/71 (38.03%), Postives = 39/71 (54.93%), Query Frame = 3
Query: 1707 PSDA-RSNEAELME-LRQKLKEMEDEKICKICHDRRLKVIFECGHMCCDDCSDNISECHLCSEKILHKIKI 1913
            PSD  R    +L+  L  K+ E E+   C IC +R+  V F CGH  C  C++ +  CH+C + IL KI +
Sbjct:  978 PSDPTRLPSGDLLRYLENKVLEFEESHFCGICMERKRDVAFLCGHGACSHCAETLRTCHMCRKTILKKINL 1048          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Zebrafish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 260.381 bits (664), Expect = 1.707e-74
Identity = 192/630 (30.48%), Postives = 305/630 (48.41%), Query Frame = 3
Query:  135 DLSTIIKKQKNHGGWNDLMKECLTGPCKLIN-DDGSDATVMGPSGMIYRLNSELLVPFKSVKKHKI-------------GSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKSEIVENTELKXXXXXXXXXXXXXXLITDER---TMRFLVALKTGNLSEV---LRLVDSVGVNTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKR-DGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLM-KYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSALGV-------------LGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDARSNEAELMELRQKLKEMEDEKICKICHDRRLKVIF-ECGHMC-CDDCSDNISECHLCSEKILHKIKI 1913
            DL  +   Q  HGGW D M E LT    +   D+  D  V  PSG  +  N  +L     V+  ++             G  VQ+  D +  KLLQ  HGEW E M   LGK   V QI+ D D K+      +  +P  +       + + +   +       +   T E        + A   G+L++V   L+  D V VN    G   +  A+  GH D++ LLL+   ++   DKDGD A+H A   +   + ++L + GAD+NA+N ++ TP  IAV KG   +++ L+       S+ DS+ DT LH A++  R + +  LL AGAD+ + N   FNA H AA+ G+   + + L +     +V+ +K+D + A+H+AA+NNH     +L+ +  A+L++QN+  +TALH+AV+R++   V+ LV  +A+LD++DK+G+T LH A++ + T S       M     V             LG  G        IA +L  NGA + I+N KG++PLD+C D SL  + L+   ++     +  +        PS   +NE         L+E      C +C D +   +F  CGH+  C  CS  + +C +C E++  + KI
Sbjct:  257 DLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGEVAAGAEGGSSQFMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKVAPAGSAVTNASGERLSQLLKKLFETQESGDINEELVKAAANGDLAKVEDILKRPD-VDVNGQCAGHTAMQAASQNGHVDVLKLLLKHSVDLEAEDKDGDRAVHHASFGDEGSVIEVLHRGGADLNARNKRRQTPLHIAVNKGHLQVVKTLL-DFGCHPSLQDSEGDTPLHDAISKKRDDMLSVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDVQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDVQDKDGDTPLHEALR-HHTLSQLRQLQDMQDVSKVEPWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLTIRNKKGQSPLDLCPDPSL-CKALAKCHKEKTSGQVGSRS-------PSLNSNNET--------LEE------CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 861          

HSP 2 Score: 56.6102 bits (135), Expect = 8.679e-8
Identity = 22/59 (37.29%), Postives = 40/59 (67.80%), Query Frame = 3
Query: 1731 AELMELRQKLKEMEDEKICKICHDRRLKVIFECGHMCCDDCSDNISECHLCSEKILHKI 1907
            A++ +L+Q+L++++++ +C +C DR   +IF CGH  C  C D +SEC +C + I  +I
Sbjct:  969 ADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRI 1027          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Zebrafish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 258.84 bits (660), Expect = 6.261e-74
Identity = 192/637 (30.14%), Postives = 313/637 (49.14%), Query Frame = 3
Query:  135 DLSTIIKKQKNHGGWNDLMKECLTGPCKLIN-DDGSDATVMGPSGMIYRLNSELLVPFKSVKKHKI-------------GSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKSEIVENTELKXXXXXXXXXXXXXXLITDER---TMRFLVALKTGNLSEV---LRLVDSVGVNTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKR-DGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLM-KYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMK---------------VNQTESG--FGNFLKMTSALGVLGNIG-EGLDK--LEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDARSNEAELMELRQKLKEMEDEKICKICHDRRLKVIF-ECGHMC-CDDCSDNISECHLCSEKILHKIKI 1913
            DL  +   Q  HGGW D M E LT    +   D+  D  V  PSG  +  N  +L     V+  ++             G  VQ+  D +  KLLQ  HGEW E M   LGK   V QI+ D D K+      +  +P  +       + + +   +       +   T E        + A   G+L++V   L+  D V VN    G   +  A+  GH D++ LLL+   ++   DKDGD A+H A   +   + ++L + GAD+NA+N ++ TP  IAV KG   +++ L+       S+ DS+ DT LH A++  R + +  LL AGAD+ + N   FNA H AA+ G+   + + L +     +V+ +K+D + A+H+AA+NNH     +L+ +  A+L++QN+  +TALH+AV+R++   V+ LV  +A+LD++DK+G+T LH A++               V++ E      N ++    L ++  +G +G +K     IA +L  NGA + I+N KG++PLD+C D SL  + L+   ++     +  +        PS   +NE         L+E      C +C D +   +F  CGH+  C  CS  + +C +C E++  + KI
Sbjct:  257 DLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGEVAAGAEGGSSQFMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKVAPAGSAVTNASGERLSQLLKKLFETQESGDINEELVKAAANGDLAKVEDILKRPD-VDVNGQCAGHTAMQAASQNGHVDVLKLLLKHSVDLEAEDKDGDRAVHHASFGDEGSVIEVLHRGGADLNARNKRRQTPLHIAVNKGHLQVVKTLL-DFGCHPSLQDSEGDTPLHDAISKKRDDMLSVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDVQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDVQDKDGDTPLHEALRHHTLSQLRQLQDMQDVSKVEPWEPSKNTVRTEKCLKLIMGLGTQGAEKKSAASIACFLAANGADLTIRNKKGQSPLDLCPDPSL-CKALAKCHKEKTSGQVGSRS-------PSLNSNNET--------LEE------CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 869          

HSP 2 Score: 56.6102 bits (135), Expect = 9.473e-8
Identity = 22/59 (37.29%), Postives = 40/59 (67.80%), Query Frame = 3
Query: 1731 AELMELRQKLKEMEDEKICKICHDRRLKVIFECGHMCCDDCSDNISECHLCSEKILHKI 1907
            A++ +L+Q+L++++++ +C +C DR   +IF CGH  C  C D +SEC +C + I  +I
Sbjct:  977 ADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRI 1035          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Zebrafish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 256.144 bits (653), Expect = 6.138e-73
Identity = 193/644 (29.97%), Postives = 309/644 (47.98%), Query Frame = 3
Query:  135 DLSTIIKKQKNHGGWNDLMKECLTGPCKLIN-DDGSDATVMGPSGMIYRLNSELLVPFKSVKKHKI-------------GSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKSEIVENTELKXXXXXXXXXXXXXXLITDERTMRFLVAL----KTGNLSE----------------VLRLVDSVGVNTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKR-DGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLM-KYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSALGV-------------LGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDARSNEAELMELRQKLKEMEDEKICKICHDRRLKVIF-ECGHMC-CDDCSDNISECHLCSEKILHKIKI 1913
            DL  +   Q  HGGW D M E LT    +   D+  D  V  PSG  +  N  +L     V+  ++             G  VQ+  D +  KLLQ  HGEW E M   LGK   V QI+ D D K+      +  +P  +       + + +       +S     +  ER  + L  L    ++G+++E                +L+  D V VN    G   +  A+  GH D++ LLL+   ++   DKDGD A+H A   +   + ++L + GAD+NA+N ++ TP  IAV KG   +++ L+       S+ DS+ DT LH A++  R + +  LL AGAD+ + N   FNA H AA+ G+   + + L +     +V+ +K+D + A+H+AA+NNH     +L+ +  A+L++QN+  +TALH+AV+R++   V+ LV  +A+LD++DK+G+T LH A++ + T S       M     V             LG  G        IA +L  NGA + I+N KG++PLD+C D SL  + L+   ++     +  +        PS   +NE         L+E      C +C D +   +F  CGH+  C  CS  + +C +C E++  + KI
Sbjct:  257 DLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGEVAAGAEGGSSQFMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKVAPAGSAVTNASGAVLTESPS---VPAERLSQLLKKLFETQESGDINEELVKAAANGDLAKVEDILKRPD-VDVNGQCAGHTAMQAASQNGHVDVLKLLLKHSVDLEAEDKDGDRAVHHASFGDEGSVIEVLHRGGADLNARNKRRQTPLHIAVNKGHLQVVKTLL-DFGCHPSLQDSEGDTPLHDAISKKRDDMLSVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDVQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDVQDKDGDTPLHEALR-HHTLSQLRQLQDMQDVSKVEPWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLTIRNKKGQSPLDLCPDPSL-CKALAKCHKEKTSGQVGSRS-------PSLNSNNET--------LEE------CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 872          

HSP 2 Score: 56.9954 bits (136), Expect = 7.856e-8
Identity = 22/59 (37.29%), Postives = 40/59 (67.80%), Query Frame = 3
Query: 1731 AELMELRQKLKEMEDEKICKICHDRRLKVIFECGHMCCDDCSDNISECHLCSEKILHKI 1907
            A++ +L+Q+L++++++ +C +C DR   +IF CGH  C  C D +SEC +C + I  +I
Sbjct:  980 ADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRI 1038          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Zebrafish
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:ZFIN;Acc:ZDB-GENE-050628-1])

HSP 1 Score: 153.68 bits (387), Expect = 2.181e-38
Identity = 159/618 (25.73%), Postives = 284/618 (45.95%), Query Frame = 3
Query:  159 QKNHGGWNDLMKECLTGPCKLINDDGSDATVMGPSGMIYRLNSELLVPFKSVKKHKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKSE---------IVENTELKXXXXXXXXXXXXXXLITDERTMRFLVALKTGNLSEVLRLVDSVGVNTNLK--GMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEAL-LNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKY-KADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQ------TESGFGNFL--KMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDARSNEAELMELRQ-----------KLKEMEDEKICKICHDRRLKVIFE-CGH-MCCDDCSDNISECHLCSEKILHKIK 1910
            Q+ HGGWN  M E   G   LI D G D  V   + + +  +   L   K+ + H            + +       G   E +   LG+  +V++++ DGD +++   + +  +P  + ++          VEN    S       +         +   R ++    G+ ++V  L+       ++K  G   L +AA++GH ++V +LL+  ++I   D+DGD ALH       F + D  +      + Q+ K +    +A  + ++ I+   +      + + DS  DT LH A+       +E L +    D    N + FN  H AA+ G++   E+ L R   +L + +KED F+A+H+AA+NNH     +L+K  + D+N++N   +T L +AV + +++ V  LV   A+++ +D++G+TA+H ++   Q      +  G G  L  ++ S+ G++GN    L+    IA +L + GA I   N+KGK+PLD+  D+S++T I S  E    KH +       H V  S    + +    LR+            +  +     C IC +  L V+F  C H + C++C+  + +C  C   I  KI+
Sbjct:  220 QEGHGGWNPKMAEIRDG--ALITDRG-DVRVQYSNIIRWTFHPGALT--KARRTHTHTHTHTHTHTHQSYLAQVCLIGVGAELL--ALGQVGKVLKVYADGDLRVAFGGQTWTFNPACLSAQPGEVDANLMTVENASESSSTVISVLEKLLSQSTEQDNPGRLVIEAAHGSAAKVRELLQKHPDKVDIKNQGKTALQVAAHQGHVEVVKVLLQANSSIEAKDEDGDAALHYTA----FGIADSRVITLNKAHYQHLKGLCSLHMAENR-TEHIVFQCVHVCVCVVCVQDSYGDTPLHDAIAKDFRSIIEILTVVPNIDFTQQNNRGFNLLHHAALKGNKLATEMILSR-ARQLADVKKEDGFSALHLAALNNHRDVAEILLKEGRCDINIRNNRNQTPLQLAVTQGHMALVALLVMEGADVNAEDEDGDTAMHTSLSRQQLTTVISSAEGDGAVLYGRLCSS-GLMGNTE--LNVGAAIACFLAQEGADISYANHKGKSPLDLVTDSSVQTLIRSFAE----KHRL-------HAV--SCGTGSSSSSSSLRRVHTTPNTMTNLAVPSVTGPSECLICSELALLVLFSPCQHSVACEECAHRMKKCIRCQVTITKKIR 808          

HSP 2 Score: 60.4622 bits (145), Expect = 5.228e-9
Identity = 29/85 (34.12%), Postives = 48/85 (56.47%), Query Frame = 3
Query: 1671 ITKK---ELLEHPVQPSDARSNEAELME-LRQKLKEMEDEKICKICHDRRLKVIFECGHMCCDDCSDNISECHLCSEKILHKIKI 1913
            ITKK   +  E    PS   S +  L+E L+ + ++ME+   C IC D  ++++F+CGH  C DCS  +  C +C + I  +I++
Sbjct:  803 ITKKIRQDQTEVECSPSSENSEQHHLLEQLQSRYRQMEERITCPICIDNHIRLVFQCGHASCIDCSSALKTCPICRQTIRERIQL 887          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Zebrafish
Match: ripk4 (receptor-interacting serine-threonine kinase 4 [Source:ZFIN;Acc:ZDB-GENE-040426-2042])

HSP 1 Score: 130.183 bits (326), Expect = 7.037e-31
Identity = 82/264 (31.06%), Postives = 138/264 (52.27%), Query Frame = 3
Query:  642 NLSEVLRLVDSVGVNTNLKGMY-PLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAEL-DLKDKNGNTALHVAM 1427
             +SE+L    +  VN   +  Y PL  AA  G E L  LLL++ A+IN  D  G T  H+A H  +  +  +LL +GADV+ +     T   +A  KG   I++LL+    AD+    SD  + LHLA    +      L+  GA+++L +  L+   H+AA +GH     + +K D +  + S+  +   A+H+A+   H   + +L+   AD    N +LRT  H+A +  +   +K L+ + +++ + +D+NG TALH+A+
Sbjct:  496 GVSEILLSRKTTNVNAKDEDQYTPLHFAAQNGDEALTRLLLDRSASINETDAQGRTPTHIACHHGQENVVRVLLSRGADVHVKGKDDWTALHLAAWKGHLGIVKLLVKQAGADVDGQTSDGRSPLHLASQRGQYRVARILVELGANVHLTSDDLYAPLHVAAETGHTSTSRLLVKHDAD--IKSRTANGCTALHLASQKGHLPTVKMLLAEGADPESVNHDLRTPCHLAAQNGHCEVLKELLRSCSDVANAQDRNGLTALHLAV 757          

HSP 2 Score: 101.293 bits (251), Expect = 1.156e-21
Identity = 77/255 (30.20%), Postives = 127/255 (49.80%), Query Frame = 3
Query:  687 TNLKGMYPLLIAANEGHEDLVNLLLEKKA-NINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALL-NAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTE 1445
             N +G  PL  AA +  + +  +LL +K  N+N  D+D  T LH A       L  LLL + A +N  + +  TPT IA   G ++++ +L+ S  AD+ +   D  TALHLA     L  V+ L+  AGAD+        +  HLA+  G  ++  I ++      V+   +D +A +H+AA   H     +L+K+ AD+  +     TALH+A ++ +L  VK L+   A+ +  + +  T  H+A +    E
Sbjct:  478 ANAQGATPLHQAAEKRLKGVSEILLSRKTTNVNAKDEDQYTPLHFAAQNGDEALTRLLLDRSASINETDAQGRTPTHIACHHGQENVVRVLL-SRGADVHVKGKDDWTALHLAAWKGHLGIVKLLVKQAGADVDGQTSDGRSPLHLASQRGQYRVARILVELGAN--VHLTSDDLYAPLHVAAETGHTSTSRLLVKHDADIKSRTANGCTALHLASQKGHLPTVKMLLAEGADPESVNHDLRTPCHLAAQNGHCE 729          

HSP 3 Score: 93.9745 bits (232), Expect = 1.945e-19
Identity = 66/213 (30.99%), Postives = 116/213 (54.46%), Query Frame = 3
Query:  654 VLRLVDSVGVNTNLKG---MYPLLIAANEGHEDLVNLLLEKK-ANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKAD 1280
            V+R++ S G + ++KG      L +AA +GH  +V LL+++  A+++    DG + LHLA    ++++  +L++ GA+V+  ++    P  +A   G      LL+  ++AD+    ++  TALHLA     L +V+ LL  GAD   +N  L    HLAA +GH ++L+  L R    + N+Q  +   A+H+A    H+  + VL++  AD
Sbjct:  564 VVRVLLSRGADVHVKGKDDWTALHLAAWKGHLGIVKLLVKQAGADVDGQTSDGRSPLHLASQRGQYRVARILVELGANVHLTSDDLYAPLHVAAETGHTSTSRLLV-KHDADIKSRTANGCTALHLASQKGHLPTVKMLLAEGADPESVNHDLRTPCHLAAQNGHCEVLKELL-RSCSDVANAQDRNGLTALHLAVSGGHKDAICVLLEGGAD 774          

HSP 4 Score: 80.1073 bits (196), Expect = 5.021e-15
Identity = 66/265 (24.91%), Postives = 122/265 (46.04%), Query Frame = 3
Query:  738 EDLVNLL-LEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNS-----SRL----------------------------ESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMK 1430
            ED+  L+ + +  ++++    G   LH AV     +    LL    + N  N +  TP   A  K  + + E+L++    +++  D D+ T LH A  +     +RL                              V  LL+ GAD+++  K  + A HLAA  GH  I+++ +K+ G   V+ Q  D  + +H+A+         +L++  A+++L + +L   LH+A +  + S  + LV++ A++  +  NG TALH+A +
Sbjct:  428 EDIAKLMKILQPQDVDLLLDGGSNLLHYAVSLANEEAVKFLLLSNCNPNLANAQGATPLHQAAEKRLKGVSEILLSRKTTNVNAKDEDQYTPLHFAAQNGDEALTRLLLDRSASINETDAQGRTPTHIACHHGQENVVRVLLSRGADVHVKGKDDWTALHLAAWKGHLGIVKLLVKQAGAD-VDGQTSDGRSPLHLASQRGQYRVARILVELGANVHLTSDDLYAPLHVAAETGHTSTSRLLVKHDADIKSRTANGCTALHLASQ 691          

HSP 5 Score: 62.3882 bits (150), Expect = 1.660e-9
Identity = 56/226 (24.78%), Postives = 101/226 (44.69%), Query Frame = 3
Query: 1011 LHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKEL 1688
            LH AV+ +  E+V+ LL +  +  L N +     H AA    + + EI L R     VN++ ED++  +H AA N  E    +L+   A +N  + + RT  HIA      + V+ L+   A++ +K K+  TALH+A                   LG+             + + + + GA +D + + G++PL + +    + R+  ++       H+T  +L
Sbjct:  453 LHYAVSLANEEAVKFLLLSNCNPNLANAQGATPLHQAAEKRLKGVSEILLSRKTTN-VNAKDEDQYTPLHFAAQNGDEALTRLLLDRSASINETDAQGRTPTHIACHHGQENVVRVLLSRGADVHVKGKDDWTALHLAA--------------WKGHLGI-------------VKLLVKQAGADVDGQTSDGRSPLHLASQRG-QYRVARILVELGANVHLTSDDL 649          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Xenopus
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:100170182])

HSP 1 Score: 259.61 bits (662), Expect = 3.146e-74
Identity = 191/634 (30.13%), Postives = 305/634 (48.11%), Query Frame = 3
Query:  135 DLSTIIKKQKNHGGWNDLMKECLTGPCKLIN-DDGSDATVMGPSGMIYRLNSELLVPFKSVKK-------------HKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKSEIVENTELKXXXXXXXXXXXXXXLITDER---TMRFLVALKTGNLSEVLRLV--DSVGVNTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKR-DGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLM-KYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAM------------------KVNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDARSNEAELMELRQKLKEMEDEKICKICHDRRLKVIF-ECGHMC-CDDCSDNISECHLCSEKILHKIKI 1913
            +L  +   Q  HGGW D M E LT    +   D+  D  V  PSG  +  N  +L     V+               ++G  VQ+  D E  KLLQ  HGEW E M   LGK   V QI+ D D K+      +  +P  +       + + +   +       +   T E        + A   G++++V  L+    V VN    G   +  A+  GH D++ LLL+   ++   DKDGD A+H A   +   + ++L + GAD+NA+N ++ TP  IAV KG   +++ L+       S+ DS+ DT LH A++  R + +  LL AGAD+ + N   FNA H AA+ G+   + + L +     +V+ +K+D + A+H+AA+NNH     +L+ +  A+L++QN+  +TALH+AV+R++   V+ LV  +A+LD++DK+G+T LH A+                  KV+ T     N L M      LG  G        IA +L  NGA + I+N KG++PLD+C D +L  + L+   ++     +           PS   SN++E +E             C +C D +   +F  CGH+  C  CS  + +C +C E++  + KI
Sbjct:  257 ELEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGDAAQGAEGGTSPFQVGDLVQICYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDNDLKVEVCGTSWTYNPAAVSRVASVGSAISNATGERLSQLLKKLFETQESGDLNEELVKAAANGDVAKVEDLLKRQDVDVNGQCAGHTAMQAASQNGHVDILKLLLKHSVDVEAEDKDGDRAVHHAAFGDEGTVVEVLHRGGADLNARNKRRQTPLHIAVNKGHLQVVKKLL-DFGCHPSLQDSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDIQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDTTWEPSKNTLIMG-----LGTQGAEKKSAASIACFLAANGADLTIRNKKGQSPLDLCPDPNL-CKALAKCHKEKSSGQVGSHS-------PS-MISNDSETLEE------------CMVCSDLKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 863          

HSP 2 Score: 56.225 bits (134), Expect = 1.563e-7
Identity = 22/59 (37.29%), Postives = 40/59 (67.80%), Query Frame = 3
Query: 1731 AELMELRQKLKEMEDEKICKICHDRRLKVIFECGHMCCDDCSDNISECHLCSEKILHKI 1907
            A++ +L+Q+L++++++ +C +C DR   +IF CGH  C  C D +SEC +C + I  +I
Sbjct:  945 ADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRI 1003          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Xenopus
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:100170182])

HSP 1 Score: 256.529 bits (654), Expect = 5.930e-73
Identity = 196/648 (30.25%), Postives = 311/648 (47.99%), Query Frame = 3
Query:  135 DLSTIIKKQKNHGGWNDLMKECLTGPCKLIN-DDGSDATVMGPSGMIYRLNSELLVPFKSVKK-------------HKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKSEIVENTELKXXXXXXXXXXXXXXLITDERTMRFLVAL----KTGNLSE----------VLRLVD-----SVGVNTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKR-DGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLM-KYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAM------------------KVNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDARSNEAELMELRQKLKEMEDEKICKICHDRRLKVIF-ECGHMC-CDDCSDNISECHLCSEKILHKIKI 1913
            +L  +   Q  HGGW D M E LT    +   D+  D  V  PSG  +  N  +L     V+               ++G  VQ+  D E  KLLQ  HGEW E M   LGK   V QI+ D D K+      +  +P  +       + + +      D +    L+  ER  + L  L    ++G+L+E          V ++ D      V VN    G   +  A+  GH D++ LLL+   ++   DKDGD A+H A   +   + ++L + GAD+NA+N ++ TP  IAV KG   +++ L+       S+ DS+ DT LH A++  R + +  LL AGAD+ + N   FNA H AA+ G+   + + L +     +V+ +K+D + A+H+AA+NNH     +L+ +  A+L++QN+  +TALH+AV+R++   V+ LV  +A+LD++DK+G+T LH A+                  KV+ T     N L M      LG  G        IA +L  NGA + I+N KG++PLD+C D +L  + L+   ++     +           PS   SN++E +E             C +C D +   +F  CGH+  C  CS  + +C +C E++  + KI
Sbjct:  257 ELEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGDAAQGAEGGTSPFQVGDLVQICYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDNDLKVEVCGTSWTYNPAAVSRVASVGSAISNATGGKLDYNLSFKLV--ERLSQLLKKLFETQESGDLNEELVKAAANGDVAKVEDLLKRQDVDVNGQCAGHTAMQAASQNGHVDILKLLLKHSVDVEAEDKDGDRAVHHAAFGDEGTVVEVLHRGGADLNARNKRRQTPLHIAVNKGHLQVVKKLL-DFGCHPSLQDSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDIQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDTTWEPSKNTLIMG-----LGTQGAEKKSAASIACFLAANGADLTIRNKKGQSPLDLCPDPNL-CKALAKCHKEKSSGQVGSHS-------PS-MISNDSETLEE------------CMVCSDLKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 875          

HSP 2 Score: 56.6102 bits (135), Expect = 1.448e-7
Identity = 22/59 (37.29%), Postives = 40/59 (67.80%), Query Frame = 3
Query: 1731 AELMELRQKLKEMEDEKICKICHDRRLKVIFECGHMCCDDCSDNISECHLCSEKILHKI 1907
            A++ +L+Q+L++++++ +C +C DR   +IF CGH  C  C D +SEC +C + I  +I
Sbjct:  985 ADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRI 1043          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Xenopus
Match: coa7 (cytochrome c oxidase assembly factor 7 (putative) [Source:Xenbase;Acc:XB-GENE-6258829])

HSP 1 Score: 238.81 bits (608), Expect = 4.868e-67
Identity = 191/678 (28.17%), Postives = 331/678 (48.82%), Query Frame = 3
Query:  135 DLSTIIKKQKNHGGWNDLMKECL--TGPCKLINDDGSDATVMGPSGMIYRLNSELLVPFKSVKKHKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKS-EIVENTELKXXXXXXXXXXXXXXLI-------TD-ERTMRFLVALKTGNLSEVLRLVDSVGVNTNLK--GMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLN-AGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKY-KADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAM------KVNQTESGFG-NFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSD-------ARSNEAELM---------------------------------------ELRQKLKEMEDEK-----------------ICKICHDRRLKVIFECGHMCCDDCSDNISECHLCSEKILHKIKI 1913
            D+  + + Q+ HGGWN  M E +  TG    I + G D  V   S   +  +   L    S     +G  V+++ + +  K LQ  HGEW +DM + LG+  +VI++F DGD ++S   + +  +P  + S +  E+  L + ++     +   S++       TD E     ++    GN ++V  ++       ++K  G   L +A++ G+ ++V +LL+  ANI++ D +GDTALH A + N+  +  +LL KGA+    NN K T   IAV KG  +++++L   N A +++ DS  DT LH A+ +     +E L      D  + N + FN  H +A+ G+   +   L+R   +LV+S+KED F A+H+A +NNH+  + +L+K  + D+NL+N   +T LH+AV + ++S V  LV   A+++ +D++G+T +H+         ++  + G G + L    A G+ GNI   L+    +A +L  +GA I+  N++GK+PLD+  D     RI  LV+  +QK    +  L      P+        + ++ AE +                                       +LRQ   E+ D+K                  C IC D  +K++F+CGH  C +CS +++ C +C + I  +I+I
Sbjct:  285 DVEILREMQEGHGGWNPKMAEFIGQTGTVHRITERG-DVRVQYNSETRWTFHPGALTKQNSFW---VGDVVRVMDNMDAVKKLQVGHGEWTDDMVSALGQIGKVIKVFGDGDMRVSVGGQSWTFNPACLTSYQREEDANLMTTENAKESKNTLVSILEKLLSQKTDCESPTSLVIEAAQGNTAKVREMLQKYPDKVDIKNQGRTALQVASHLGYMEVVKVLLQANANIDLRDDEGDTALHYAAYGNQAGVVRVLLSKGANAELLNNAKCTALYIAVNKGFTEVVQVLCNPNCA-INMQDSFGDTPLHYAITADFRSIIEILTEVPNIDFTVQNNQGFNLLHHSALKGNVLAVSKILER-ARQLVDSKKEDGFTALHLATLNNHQEVVEILIKEGRCDVNLRNNRNQTPLHLAVAQGHISLVHLLVTEGADVNAEDEDGDTPMHIVFVRQHLKSIDSQQEGNGSSLLTKLEASGLPGNI--ELNVGSAMACFLALSGADINYANHRGKSPLDLIADG----RITHLVKNFAQKFRYQRAILPYIHTTPNTMTNLSPCSAASPAECLVCSELAVLVSFFPCQHSIVCEECSRRMKKCIKCQVCIARKLRQGGLEVSDQKKVMEELQNRYRQMEERITCPICIDNHIKLVFQCGHGSCTECSTSLTACPICRQLIRERIQI 950          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Xenopus
Match: coa7 (cytochrome c oxidase assembly factor 7 (putative) [Source:Xenbase;Acc:XB-GENE-6258829])

HSP 1 Score: 227.254 bits (578), Expect = 6.426e-63
Identity = 182/619 (29.40%), Postives = 316/619 (51.05%), Query Frame = 3
Query:  135 DLSTIIKKQKNHGGWNDLMKECL--TGPCKLINDDGSDATVMGPSGMIYRLNSELLVPFKSVKKHKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKS-EIVENTELKXXXXXXXXXXXXXXLI-------TD-ERTMRFLVALKTGNLSEVLRLVDSVGVNTNLK--GMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLN-AGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKY-KADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAM------KVNQTESGFG-NFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDAR---SNEAELMELRQKLKEMEDEKICKICHDRRLKV-IFECGH-MCCDDCSDNISECHLCSEKILHKIK 1910
            D+  + + Q+ HGGWN  M E +  TG    I + G D  V   S   +  +   L    S     +G  V+++ + +  K LQ  HGEW +DM + LG+  +VI++F DGD ++S   + +  +P  + S +  E+  L + ++     +   S++       TD E     ++    GN ++V  ++       ++K  G   L +A++ G+ ++V +LL+  ANI++ D +GDTALH A + N+  +  +LL KGA+    NN K T   IAV KG  +++++L   N A +++ DS  DT LH A+ +     +E L      D  + N + FN  H +A+ G+   +   L+R   +LV+S+KED F A+H+A +NNH+  + +L+K  + D+NL+N   +T LH+AV + ++S V  LV   A+++ +D++G+T +H+         ++  + G G + L    A G+ GNI   L+    +A +L  +GA I+  N++GK+PLD+  D     RI  LV+  +QK    + + L+ P      R   +    +  L         E  C +C +  + V  F C H + C++CS  + +C  C   I  K++
Sbjct:  279 DVEILREMQEGHGGWNPKMAEVMARTGTVHRITERG-DVRVQYNSETRWTFHPGALTKQNSFW---VGDVVRVMDNMDAVKKLQVGHGEWTDDMVSALGQIGKVIKVFGDGDMRVSVGGQSWTFNPACLTSYQREEDANLMTTENAKESKNTLVSILEKLLSQKTDCESPTSLVIEAAQGNTAKVREMLQKYPDKVDIKNQGRTALQVASHLGYMEVVKVLLQANANIDLRDDEGDTALHYAAYGNQAGVVRVLLSKGANAELLNNAKCTALYIAVNKGFTEVVQVLCNPNCA-INMQDSFGDTPLHYAITADFRSIIEILTEVPNIDFTVQNNQGFNLLHHSALKGNVLAVSKILER-ARQLVDSKKEDGFTALHLATLNNHQEVVEILIKEGRCDVNLRNNRNQTPLHLAVAQGHISLVHLLVTEGADVNAEDEDGDTPMHIVFVRQHLKSIDSQQEGNGSSLLTKLEASGLPGNI--ELNVGSAMACFLALSGADINYANHRGKSPLDLIADG----RITHLVKNFAQKF---RYQRLDSPTVSCSLRRVHTTPNTMTNLSPCSAASPAE--CLVCSELAVLVSFFPCQHSIVCEECSRRMKKCIKCQVCIARKLR 880          

HSP 2 Score: 94.3597 bits (233), Expect = 2.944e-19
Identity = 101/465 (21.72%), Postives = 192/465 (41.29%), Query Frame = 3
Query:  639 GNLSEVLRLVDSVGVNTNL---KGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLK-KGADVNAQNNKKI----------------------------------TPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAE-LDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDARSNEAELME-LRQKLKEMEDEKICKICHDRRLKVIFECGHMCCDDCSDNISECHLCSEKILHKIKI 1913
            GN + V+R++ S G N  L        L IA N+G  ++V +L      IN+ D  GDT LH A+  +   + ++L +    D   QNN+                                    T   +A L   Q+++E+LI     D+++ ++   T LHLAV    +  V  L+  GAD+   ++      H+  +  H K ++   + +G  L+   +           + +   C   L    AD+N  N   ++ L +    +    + HLV+N A+    +  +  T      +V+ T +   N    ++A      +   L  L  ++ +  ++                +C + S   R+   ++         +++  E    PS   S++ ++ME L+ + ++ME+   C IC D  +K++F+CGH  C +CS +++ C +C + I  +I+I
Sbjct:  519 GNQAGVVRVLLSKGANAELLNNAKCTALYIAVNKGFTEVVQVLCNPNCAINMQDSFGDTPLHYAITADFRSIIEILTEVPNIDFTVQNNQGFNLLHHSALKGNVLAVSKILERARQLVDSKKEDGFTALHLATLNNHQEVVEILIKEGRCDVNLRNNRNQTPLHLAVAQGHISLVHLLVTEGADVNAEDEDGDTPMHIVFVRQHLKSIDSQQEGNGSSLLTKLEASGLPGNIELNVGSAMACFLALSG--ADINYANHRGKSPLDLIADGR----ITHLVKNFAQKFRYQRLDSPTVSCSLRRVHTTPNTMTNLSPCSAASPAECLVCSELAVL--VSFFPCQHSI--------------VCEECS--RRMKKCIKCQVCIARKLRQDSTEVECSPSLEVSDQKKVMEELQNRYRQMEERITCPICIDNHIKLVFQCGHGSCTECSTSLTACPICRQLIRERIQI 959          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Xenopus
Match: coa7 (cytochrome c oxidase assembly factor 7 (putative) [Source:Xenbase;Acc:XB-GENE-6258829])

HSP 1 Score: 225.713 bits (574), Expect = 1.848e-62
Identity = 182/616 (29.55%), Postives = 313/616 (50.81%), Query Frame = 3
Query:  135 DLSTIIKKQKNHGGWNDLMKECL--TGPCKLINDDGSDATVMGPSGMIYRLNSELLVPFKSVKKHKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKS-EIVENTELKXXXXXXXXXXXXXXLI-------TD-ERTMRFLVALKTGNLSEVLRLVDSVGVNTNLK--GMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLN-AGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKY-KADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAM------KVNQTESGFG-NFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDARSNEAELMELRQKLKEMEDEKICKICHDRRLKV-IFECGH-MCCDDCSDNISECHLCSEKILHKIK 1910
            D+  + + Q+ HGGWN  M E +  TG    I + G D  V   S   +  +   L    S     +G  V+++ + +  K LQ  HGEW +DM + LG+  +VI++F DGD ++S   + +  +P  + S +  E+  L + ++     +   S++       TD E     ++    GN ++V  ++       ++K  G   L +A++ G+ ++V +LL+  ANI++ D +GDTALH A + N+  +  +LL KGA+    NN K T   IAV KG  +++++L   N A +++ DS  DT LH A+ +     +E L      D  + N + FN  H +A+ G+   +   L+R   +LV+S+KED F A+H+A +NNH+  + +L+K  + D+NL+N   +T LH+AV + ++S V  LV   A+++ +D++G+T +H+         ++  + G G + L    A G+ GNI   L+    +A +L  +GA I+  N++GK+PLD+  D     RI  LV+  +QK    + EL    V  S  R +                   C +C +  + V  F C H + C++CS  + +C  C   I  K++
Sbjct:  268 DVEILREMQEGHGGWNPKMAEFIGQTGTVHRITERG-DVRVQYNSETRWTFHPGALTKQNSFW---VGDVVRVMDNMDAVKKLQVGHGEWTDDMVSALGQIGKVIKVFGDGDMRVSVGGQSWTFNPACLTSYQREEDANLMTTENAKESKNTLVSILEKLLSQKTDCESPTSLVIEAAQGNTAKVREMLQKYPDKVDIKNQGRTALQVASHLGYMEVVKVLLQANANIDLRDDEGDTALHYAAYGNQAGVVRVLLSKGANAELLNNAKCTALYIAVNKGFTEVVQVLCNPNCA-INMQDSFGDTPLHYAITADFRSIIEILTEVPNIDFTVQNNQGFNLLHHSALKGNVLAVSKILER-ARQLVDSKKEDGFTALHLATLNNHQEVVEILIKEGRCDVNLRNNRNQTPLHLAVAQGHISLVHLLVTEGADVNAEDEDGDTPMHIVFVRQHLKSIDSQQEGNGSSLLTKLEASGLPGNI--ELNVGSAMACFLALSGADINYANHRGKSPLDLIADG----RITHLVKNFAQKFR-EQVELDSPTVSCSLRRVHTTPNTMTNLSPCSAASPAECLVCSELAVLVSFFPCQHSIVCEECSRRMKKCIKCQVCIARKLR 870          

HSP 2 Score: 94.7449 bits (234), Expect = 1.801e-19
Identity = 99/465 (21.29%), Postives = 193/465 (41.51%), Query Frame = 3
Query:  639 GNLSEVLRLVDSVGVNTNL---KGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLK-KGADVNAQNNKKI----------------------------------TPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVEN-KAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDARSNEAELME-LRQKLKEMEDEKICKICHDRRLKVIFECGHMCCDDCSDNISECHLCSEKILHKIKI 1913
            GN + V+R++ S G N  L        L IA N+G  ++V +L      IN+ D  GDT LH A+  +   + ++L +    D   QNN+                                    T   +A L   Q+++E+LI     D+++ ++   T LHLAV    +  V  L+  GAD+   ++      H+  +  H K ++   + +G  L+   +           + +   C   L    AD+N  N   ++ L +    +    VK+  +  + +++L     + +L    +V+ T +   N    ++A      +   L  L  ++ +  ++                +C + S   R+   ++         +++  E    PS   S++ ++ME L+ + ++ME+   C IC D  +K++F+CGH  C +CS +++ C +C + I  +I+I
Sbjct:  508 GNQAGVVRVLLSKGANAELLNNAKCTALYIAVNKGFTEVVQVLCNPNCAINMQDSFGDTPLHYAITADFRSIIEILTEVPNIDFTVQNNQGFNLLHHSALKGNVLAVSKILERARQLVDSKKEDGFTALHLATLNNHQEVVEILIKEGRCDVNLRNNRNQTPLHLAVAQGHISLVHLLVTEGADVNAEDEDGDTPMHIVFVRQHLKSIDSQQEGNGSSLLTKLEASGLPGNIELNVGSAMACFLALSG--ADINYANHRGKSPLDLIADGRITHLVKNFAQKFREQVELDSPTVSCSLR---RVHTTPNTMTNLSPCSAASPAECLVCSELAVL--VSFFPCQHSI--------------VCEECS--RRMKKCIKCQVCIARKLRQDSTEVECSPSLEVSDQKKVMEELQNRYRQMEERITCPICIDNHIKLVFQCGHGSCTECSTSLTACPICRQLIRERIQI 949          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Mouse
Match: Mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:MGI Symbol;Acc:MGI:2443157])

HSP 1 Score: 262.692 bits (670), Expect = 1.768e-75
Identity = 190/631 (30.11%), Postives = 309/631 (48.97%), Query Frame = 3
Query:  135 DLSTIIKKQKNHGGWNDLMKECLTGPCKLIN-DDGSDATVMGPSGMIYRLNSELLVPFKSVK-------------KHKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKSEIVENTELKXXXXXXXXXXXXXXLITDER---TMRFLVALKTGNLSEVLRLV--DSVGVNTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKR-DGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLM-KYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMK---------------VNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDARSNEAELMELRQKLKEMEDEKICKICHDRRLKVIF-ECGHMC-CDDCSDNISECHLCSEKILHKIKI 1913
            DL  +   Q  HGGW D M E LT    +   D+  D  V  PSG  +  N  +L     V+             + ++G  VQ+  D E  KLLQ  HGEW E M   LGK   V QI+ D D K+      +  +P  +       + + +   +       +   T E        + A   G++++V  L+    V VN    G   +  A+  GH D++ LLL++  ++   DKDGD A+H A   +   + ++L +  AD+NA+N ++ TP  IAV KG   +++ L+       S+ DS+ DT LH A++  R + +  LL AGAD+ + N   FNA H AA+ G+   + + L +     +V+ +K+D + A+H+AA+NNH     +L+ +  A+L++QN+  +TALH+AV+R++   V+ LV   A+LD++DK+G+T LH A++               V + ++ +    K T  +G LG  G        IA +L  NGA + I+N KG++PLD+C D SL  + L+   ++     +  +        PS   SN++E +E             C +C D +   +F  CGH+  C  CS  + +C +C E++  + KI
Sbjct:  257 DLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANIVRSGDAAQGAEGGTSQFQVGDLVQVCYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVSKVAPAGSAISNASGERLSQLLKKLFETQESGDLNEELVKAAANGDVAKVEDLLKRPDVDVNGQCAGHTAMQAASQNGHVDILKLLLKQNVDVEAEDKDGDRAVHHAAFGDEGAVIEVLHRGSADLNARNKRRQTPLHIAVNKGHLQVVKTLL-DFGCHPSLQDSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDIQNVNQQTALHLAVERQHTQIVRLLVRAGAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDAAW-EPSKNTLIMG-LGTQGAEKKSAASIACFLAANGADLSIRNKKGQSPLDLCPDPSL-CKALAKCHKEKVSGQVGSRS-------PS-MISNDSETLEE------------CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 863          

HSP 2 Score: 56.225 bits (134), Expect = 1.451e-7
Identity = 22/59 (37.29%), Postives = 40/59 (67.80%), Query Frame = 3
Query: 1731 AELMELRQKLKEMEDEKICKICHDRRLKVIFECGHMCCDDCSDNISECHLCSEKILHKI 1907
            A++ +L+Q+L++++++ +C +C DR   +IF CGH  C  C D +SEC +C + I  +I
Sbjct:  945 ADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRI 1003          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Mouse
Match: Mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:MGI Symbol;Acc:MGI:2443157])

HSP 1 Score: 262.692 bits (670), Expect = 1.768e-75
Identity = 190/631 (30.11%), Postives = 309/631 (48.97%), Query Frame = 3
Query:  135 DLSTIIKKQKNHGGWNDLMKECLTGPCKLIN-DDGSDATVMGPSGMIYRLNSELLVPFKSVK-------------KHKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKSEIVENTELKXXXXXXXXXXXXXXLITDER---TMRFLVALKTGNLSEVLRLV--DSVGVNTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKR-DGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLM-KYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMK---------------VNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDARSNEAELMELRQKLKEMEDEKICKICHDRRLKVIF-ECGHMC-CDDCSDNISECHLCSEKILHKIKI 1913
            DL  +   Q  HGGW D M E LT    +   D+  D  V  PSG  +  N  +L     V+             + ++G  VQ+  D E  KLLQ  HGEW E M   LGK   V QI+ D D K+      +  +P  +       + + +   +       +   T E        + A   G++++V  L+    V VN    G   +  A+  GH D++ LLL++  ++   DKDGD A+H A   +   + ++L +  AD+NA+N ++ TP  IAV KG   +++ L+       S+ DS+ DT LH A++  R + +  LL AGAD+ + N   FNA H AA+ G+   + + L +     +V+ +K+D + A+H+AA+NNH     +L+ +  A+L++QN+  +TALH+AV+R++   V+ LV   A+LD++DK+G+T LH A++               V + ++ +    K T  +G LG  G        IA +L  NGA + I+N KG++PLD+C D SL  + L+   ++     +  +        PS   SN++E +E             C +C D +   +F  CGH+  C  CS  + +C +C E++  + KI
Sbjct:  257 DLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANIVRSGDAAQGAEGGTSQFQVGDLVQVCYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVSKVAPAGSAISNASGERLSQLLKKLFETQESGDLNEELVKAAANGDVAKVEDLLKRPDVDVNGQCAGHTAMQAASQNGHVDILKLLLKQNVDVEAEDKDGDRAVHHAAFGDEGAVIEVLHRGSADLNARNKRRQTPLHIAVNKGHLQVVKTLL-DFGCHPSLQDSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDIQNVNQQTALHLAVERQHTQIVRLLVRAGAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDAAW-EPSKNTLIMG-LGTQGAEKKSAASIACFLAANGADLSIRNKKGQSPLDLCPDPSL-CKALAKCHKEKVSGQVGSRS-------PS-MISNDSETLEE------------CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 863          

HSP 2 Score: 56.225 bits (134), Expect = 1.451e-7
Identity = 22/59 (37.29%), Postives = 40/59 (67.80%), Query Frame = 3
Query: 1731 AELMELRQKLKEMEDEKICKICHDRRLKVIFECGHMCCDDCSDNISECHLCSEKILHKI 1907
            A++ +L+Q+L++++++ +C +C DR   +IF CGH  C  C D +SEC +C + I  +I
Sbjct:  945 ADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRI 1003          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Mouse
Match: Mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:MGI Symbol;Acc:MGI:2443157])

HSP 1 Score: 209.149 bits (531), Expect = 2.369e-58
Identity = 153/521 (29.37%), Postives = 262/521 (50.29%), Query Frame = 3
Query:  423 GKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKSEIVENTELKXXXXXXXXXXXXXXLITDER---TMRFLVALKTGNLSEVLRLV--DSVGVNTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKR-DGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLM-KYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMK---------------VNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDARSNEAELMELRQKLKEMEDEKICKICHDRRLKVIF-ECGHMC-CDDCSDNISECHLCSEKILHKIKI 1913
            GK   V QI+ D D K+      +  +P  +       + + +   +       +   T E        + A   G++++V  L+    V VN    G   +  A+  GH D++ LLL++  ++   DKDGD A+H A   +   + ++L +  AD+NA+N ++ TP  IAV KG   +++ L+       S+ DS+ DT LH A++  R + +  LL AGAD+ + N   FNA H AA+ G+   + + L +     +V+ +K+D + A+H+AA+NNH     +L+ +  A+L++QN+  +TALH+AV+R++   V+ LV   A+LD++DK+G+T LH A++               V + ++ +    K T  +G LG  G        IA +L  NGA + I+N KG++PLD+C D SL  + L+   ++     +  +        PS   SN++E +E             C +C D +   +F  CGH+  C  CS  + +C +C E++  + KI
Sbjct:    2 GKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVSKVAPAGSAISNASGERLSQLLKKLFETQESGDLNEELVKAAANGDVAKVEDLLKRPDVDVNGQCAGHTAMQAASQNGHVDILKLLLKQNVDVEAEDKDGDRAVHHAAFGDEGAVIEVLHRGSADLNARNKRRQTPLHIAVNKGHLQVVKTLL-DFGCHPSLQDSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDIQNVNQQTALHLAVERQHTQIVRLLVRAGAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDAAW-EPSKNTLIMG-LGTQGAEKKSAASIACFLAANGADLSIRNKKGQSPLDLCPDPSL-CKALAKCHKEKVSGQVGSRS-------PS-MISNDSETLEE------------CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 498          

HSP 2 Score: 55.0694 bits (131), Expect = 2.870e-7
Identity = 22/59 (37.29%), Postives = 40/59 (67.80%), Query Frame = 3
Query: 1731 AELMELRQKLKEMEDEKICKICHDRRLKVIFECGHMCCDDCSDNISECHLCSEKILHKI 1907
            A++ +L+Q+L++++++ +C +C DR   +IF CGH  C  C D +SEC +C + I  +I
Sbjct:  580 ADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRI 638          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Mouse
Match: Mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:MGI Symbol;Acc:MGI:2679684])

HSP 1 Score: 201.06 bits (510), Expect = 4.353e-54
Identity = 151/556 (27.16%), Postives = 274/556 (49.28%), Query Frame = 3
Query:  327 IGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKS---------EIVENTELKXXXXXXXXXXXXXXLITDERTMRFLVALKTGNLSEVLRLVD--SVGVNTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLES--VEALLN-AGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMK-YKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQ-------TESGFGNFLKMTSALGVLGNIG-EGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDAR---SNEAELMELRQKLKEMEDEKICKICHDRRLKVIF-ECGH-MCCDDCSDNISECHLCSEKILHKIK 1910
            +G  V++I D +  K LQ  HGEW +DM   LG+  +V+++F DG+ +++   + +   P  + +         ++ E           + D         E   R +V    GN++  L L+      V+T  +G   L +AA  G  +LV LLL+ +A++++ D +G+T LH     N+ +   +LL  G  V+A+N  + T   +AV +G  +++++L      D+++ D+  DT LH A+++    S  VE L    G D+   N + F   H A++ GH   +   L R   +LV+++KED F A+H+AA+NNH     VL++  + D+N++N +L++ LH+AV++ +L  V  LV+    ++ +D+ G+TALHVA++ +Q          G    L++ S L   G  G   L     +A +L   GA +   N++G++PLD+  +     R+L  ++  +Q+    +++       P   R   S    +  L        +   C +C +  L ++F  C H   C++C+  + +C  C   I  K++
Sbjct:  294 VGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVGGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRTQKSDPEHPGRLVVEAALGNVARALDLLRRHPEQVDTKNQGRTALQVAAYLGQVELVRLLLQARASMDLPDDEGNTVLHYTAMGNQPEATRVLLSAGCAVDARNGTRSTALHVAVQRGFLEVVKILC-ERGCDVNLPDAHADTPLHSAISAGAGASSIVEVLTEVPGIDVTATNSQGFTLLHHASLKGHVLAVRKILAR-ARQLVDAKKEDGFTALHLAALNNHREVAQVLIREGRCDVNVRNRKLQSPLHLAVQQAHLGLVPLLVDAGCSVNTEDEEGDTALHVALQRHQLLPLVADRAGGDPGPLQLLSRLQASGLPGCTELTVGAAVACFLALEGADVSYANHRGRSPLDLATEG----RVLKALQGCAQR--FRERQAGGGGGVPPGPRHVLSTPNTVTNLHVSGTAGPEAAECLVCSELALLILFSPCQHRTVCEECARRMKKCIRCQVVISKKLR 841          

HSP 2 Score: 55.4546 bits (132), Expect = 2.115e-7
Identity = 19/57 (33.33%), Postives = 35/57 (61.40%), Query Frame = 3
Query: 1743 ELRQKLKEMEDEKICKICHDRRLKVIFECGHMCCDDCSDNISECHLCSEKILHKIKI 1913
            EL+ + ++ME+   C IC D  ++++F+CGH  C  C   ++ C +C + I  +I+I
Sbjct:  863 ELQSRYRQMEERITCPICIDSHIRLVFQCGHGACAPCGAALNACPICRQPIRDRIQI 919          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Mouse
Match: Ank2 (ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025])

HSP 1 Score: 121.324 bits (303), Expect = 1.215e-27
Identity = 94/353 (26.63%), Postives = 163/353 (46.18%), Query Frame = 3
Query:  684 NTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDARSNEAELM 1742
            +  L  +  L +AA+ GH  +  LLL+K+AN N    +G T LH+A  +NR K+ +LL+K GA + A     +TP  +A   G  +I+ LL+  N A   + +   +TALH+A  + ++E V  LL  GA +    ++     H+A+  G  +I+++ L+       ++   + +  +H++A         VL++  A  +L   +  T LH+A K   L   K L++ +A  D   KNG T LH+A K NQ +                            IA  L+  GA  +    +G TPL + +       +  L+++ +  H  TK  L    +   + + N A+++
Sbjct:  339 DVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIV-LLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHP--DAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQ----------------------------IASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADIL 660          

HSP 2 Score: 114.775 bits (286), Expect = 1.449e-25
Identity = 95/359 (26.46%), Postives = 170/359 (47.35%), Query Frame = 3
Query:  699 GMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAM---KVNQTE--SGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDARSNEAELMELRQKL 1760
            G+ P+ +AA  GH ++V LLL+  A+ ++ +  G+TALH+A    + ++   LL+ GA V+A+  ++ TP  IA   G  +I++LL+  + A      ++  T LH++    +++    LL AGA   L  KK F   H+AA  G   + ++ L+R      +S  ++ +  +H+AA  N       L+ Y A+ N    +  T LH+A +  +   V  L++  A + +  K+G T+LH+A    KVN  +  +  G      + LG    I         +  +L++ GA+++ K   G TPL                +   Q H      LL+H  +P+   +N    + + ++L
Sbjct:  410 GLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLL-QHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAA--ADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLH---------------QAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRL 750          

HSP 3 Score: 112.849 bits (281), Expect = 4.887e-25
Identity = 91/347 (26.22%), Postives = 152/347 (43.80%), Query Frame = 3
Query:  687 TNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDARSN 1727
            T   G  PL IAA+ G+ ++  LLL + A ++   ++G T LH+A       +  LLL +G  ++A+    +TP   A   G   ++ELL+    A L     +  + LH+A     +E V+ LL   A +  +      A H+AA  GH ++ ++ L +      N++  + F  +H+A   N    + +L+KY A +        T +H+A    +L+ V  L++N A  D+ +  G TALH+A +  Q E                            +   L+ NGA +D +  + +TPL I +    KT I+ L              LL+H   P  A +N
Sbjct:  208 TTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLL-ERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANP--NARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVE----------------------------VVRCLLRNGALVDARAREEQTPLHIASRLG-KTEIVQL--------------LLQHMAHPDAATTN 508          

HSP 4 Score: 112.079 bits (279), Expect = 9.047e-25
Identity = 85/279 (30.47%), Postives = 141/279 (50.54%), Query Frame = 3
Query:  618 FLVALKTGNLSEVLR-LVDSVGVNT-NLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRD------GEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMK 1430
            FL A + GNL +V+  L   + +NT N  G+  L +AA EGH  LV  LL + ++++ A K G+TALH+A    + ++  +L+K+GA++NAQ+    TP  +A  +   D+++ L+  N A+ S    D  T L +A+     ++V  LL          K    A H+AA     K   + L+ D       + +VN   E  F  +H+AA   + +   +L+   A ++       T LH+A KR   + VK L++   ++D K ++G T LH A +
Sbjct:   14 FLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLL-ENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTK----GKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAAR 287          

HSP 5 Score: 104.76 bits (260), Expect = 1.625e-22
Identity = 68/222 (30.63%), Postives = 113/222 (50.90%), Query Frame = 3
Query:  696 KGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHL 1361
            KG  PL +AA  G  D+  LLL+++A  + A K+G T LH+A  +N+ ++   LL  GA+ N    + +TP  +A  +G  D++ LL+    A++ +      T+LHLA    ++   + L   GAD     K  +    +A   G+ K++   LK+     VN++ ++ +  +H AA   H H + VL+++ A  N       TAL IA +  Y+S V  L
Sbjct:  541 KGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLL-DKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGAN--VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 759          

HSP 6 Score: 80.1073 bits (196), Expect = 7.758e-15
Identity = 48/135 (35.56%), Postives = 74/135 (54.81%), Query Frame = 3
Query:  678 GVNTNL---KGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGA 1073
            G  TN    +G+ PL +A+ EGH D+V LLL+K ANI+++ K G T+LHLA  E++  + D+L K GAD +A      TP ++A   G+  ++  L+    A+++    +  T LH A        +  LL  GA
Sbjct:  598 GAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLL-KQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGA 731          

HSP 7 Score: 70.4774 bits (171), Expect = 7.294e-12
Identity = 74/294 (25.17%), Postives = 123/294 (41.84%), Query Frame = 3
Query:  993 SDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKA-----------------------------ELDLKDKNGNTALHVAMKVNQTESGF-----GNFLKMTSALGVLGNIGEGLDKLE--------DIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDARSNEAELMEL 1748
            SD + +   A  +  L+ V   L  G DI   N+   NA HLAA  GH  +++  L R     V+S  +    A+H+A++      + VL+K  A++N Q+    T L++A +  ++  VK+L+EN A                             E D K K    ALH+A + + T+S        +   + S + V      G   L         ++A  L+  GA++D     G TPL + +       +  L++R  Q    T+  L   P+  + ARS   +++EL
Sbjct:    8 SDSNASFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSS--VDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLT--PLHCA-ARSGHDQVVEL 296          

HSP 8 Score: 52.7582 bits (125), Expect = 1.850e-6
Identity = 45/162 (27.78%), Postives = 68/162 (41.98%), Query Frame = 3
Query: 1191 QKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTE-----SGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQ 1661
            QK D  A+   AA   +   +   +K   D+N  N     ALH+A K  ++  V+ L+   + +D   K GNTALH+A    Q E        G  +   S  G         +   D+  YL+ENGA+       G TPL +         +  L+E D++
Sbjct:    6 QKSDSNASFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTK 167          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. UniProt/SwissProt
Match: sp|Q80SY4|MIB1_MOUSE (E3 ubiquitin-protein ligase MIB1 OS=Mus musculus OX=10090 GN=Mib1 PE=1 SV=1)

HSP 1 Score: 262.692 bits (670), Expect = 1.236e-74
Identity = 190/631 (30.11%), Postives = 309/631 (48.97%), Query Frame = 3
Query:  135 DLSTIIKKQKNHGGWNDLMKECLTGPCKLIN-DDGSDATVMGPSGMIYRLNSELLVPFKSVK-------------KHKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKSEIVENTELKXXXXXXXXXXXXXXLITDER---TMRFLVALKTGNLSEVLRLV--DSVGVNTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKR-DGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLM-KYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMK---------------VNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDARSNEAELMELRQKLKEMEDEKICKICHDRRLKVIF-ECGHMC-CDDCSDNISECHLCSEKILHKIKI 1913
            DL  +   Q  HGGW D M E LT    +   D+  D  V  PSG  +  N  +L     V+             + ++G  VQ+  D E  KLLQ  HGEW E M   LGK   V QI+ D D K+      +  +P  +       + + +   +       +   T E        + A   G++++V  L+    V VN    G   +  A+  GH D++ LLL++  ++   DKDGD A+H A   +   + ++L +  AD+NA+N ++ TP  IAV KG   +++ L+       S+ DS+ DT LH A++  R + +  LL AGAD+ + N   FNA H AA+ G+   + + L +     +V+ +K+D + A+H+AA+NNH     +L+ +  A+L++QN+  +TALH+AV+R++   V+ LV   A+LD++DK+G+T LH A++               V + ++ +    K T  +G LG  G        IA +L  NGA + I+N KG++PLD+C D SL  + L+   ++     +  +        PS   SN++E +E             C +C D +   +F  CGH+  C  CS  + +C +C E++  + KI
Sbjct:  257 DLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANIVRSGDAAQGAEGGTSQFQVGDLVQVCYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVSKVAPAGSAISNASGERLSQLLKKLFETQESGDLNEELVKAAANGDVAKVEDLLKRPDVDVNGQCAGHTAMQAASQNGHVDILKLLLKQNVDVEAEDKDGDRAVHHAAFGDEGAVIEVLHRGSADLNARNKRRQTPLHIAVNKGHLQVVKTLL-DFGCHPSLQDSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDIQNVNQQTALHLAVERQHTQIVRLLVRAGAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDAAW-EPSKNTLIMG-LGTQGAEKKSAASIACFLAANGADLSIRNKKGQSPLDLCPDPSL-CKALAKCHKEKVSGQVGSRS-------PS-MISNDSETLEE------------CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 863          

HSP 2 Score: 56.225 bits (134), Expect = 1.015e-6
Identity = 22/59 (37.29%), Postives = 40/59 (67.80%), Query Frame = 3
Query: 1731 AELMELRQKLKEMEDEKICKICHDRRLKVIFECGHMCCDDCSDNISECHLCSEKILHKI 1907
            A++ +L+Q+L++++++ +C +C DR   +IF CGH  C  C D +SEC +C + I  +I
Sbjct:  945 ADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRI 1003          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. UniProt/SwissProt
Match: sp|Q86YT6|MIB1_HUMAN (E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens OX=9606 GN=MIB1 PE=1 SV=1)

HSP 1 Score: 260.766 bits (665), Expect = 6.175e-74
Identity = 189/631 (29.95%), Postives = 309/631 (48.97%), Query Frame = 3
Query:  135 DLSTIIKKQKNHGGWNDLMKECLTGPCKLIN-DDGSDATVMGPSGMIYRLNSELLVPFKSVK-------------KHKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKSEIVENTELKXXXXXXXXXXXXXXLITDER---TMRFLVALKTGNLSEVLRLV--DSVGVNTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKR-DGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLM-KYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMK---------------VNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDARSNEAELMELRQKLKEMEDEKICKICHDRRLKVIF-ECGHMC-CDDCSDNISECHLCSEKILHKIKI 1913
            DL  +   Q  HGGW D M E LT    +   D+  D  V  PSG  +  N  +L     V+             + ++G  VQ+  D E  KLLQ  HGEW E M   LGK   V QI+ D D K+      +  +P  +       + + +   +       +   T E        + A   G++++V  L+    V VN    G   +  A+  GH D++ LLL++  ++   DKDGD A+H A   +   + ++L +  AD+NA+N ++ TP  IAV KG   +++ L+       S+ DS+ DT LH A++  R + +  LL AGAD+ + N   FNA H AA+ G+   + + L +     +V+ +K+D + A+H+AA+NNH     +L+ +  A+L++QN+  +TALH+AV+R++   V+ LV   A+LD++DK+G+T LH A++               V + ++ +    K T  +G LG  G        IA +L  NGA + I+N KG++PLD+C D +L  + L+   ++     +  +        PS   SN++E +E             C +C D +   +F  CGH+  C  CS  + +C +C E++  + KI
Sbjct:  257 DLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANIVRSGDAAQGAEGGTSQFQVGDLVQVCYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVSKVASAGSAISNASGERLSQLLKKLFETQESGDLNEELVKAAANGDVAKVEDLLKRPDVDVNGQCAGHTAMQAASQNGHVDILKLLLKQNVDVEAEDKDGDRAVHHAAFGDEGAVIEVLHRGSADLNARNKRRQTPLHIAVNKGHLQVVKTLL-DFGCHPSLQDSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDIQNVNQQTALHLAVERQHTQIVRLLVRAGAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDAAW-EPSKNTLIMG-LGTQGAEKKSAASIACFLAANGADLSIRNKKGQSPLDLCPDPNL-CKALAKCHKEKVSGQVGSRS-------PS-MISNDSETLEE------------CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 863          

HSP 2 Score: 56.225 bits (134), Expect = 1.051e-6
Identity = 22/59 (37.29%), Postives = 40/59 (67.80%), Query Frame = 3
Query: 1731 AELMELRQKLKEMEDEKICKICHDRRLKVIFECGHMCCDDCSDNISECHLCSEKILHKI 1907
            A++ +L+Q+L++++++ +C +C DR   +IF CGH  C  C D +SEC +C + I  +I
Sbjct:  945 ADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRI 1003          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. UniProt/SwissProt
Match: sp|Q804S5|MIB1_DANRE (E3 ubiquitin-protein ligase mib1 OS=Danio rerio OX=7955 GN=mib1 PE=1 SV=1)

HSP 1 Score: 260.381 bits (664), Expect = 1.288e-73
Identity = 192/630 (30.48%), Postives = 305/630 (48.41%), Query Frame = 3
Query:  135 DLSTIIKKQKNHGGWNDLMKECLTGPCKLIN-DDGSDATVMGPSGMIYRLNSELLVPFKSVKKHKI-------------GSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKSEIVENTELKXXXXXXXXXXXXXXLITDER---TMRFLVALKTGNLSEV---LRLVDSVGVNTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKR-DGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLM-KYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSALGV-------------LGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDARSNEAELMELRQKLKEMEDEKICKICHDRRLKVIF-ECGHMC-CDDCSDNISECHLCSEKILHKIKI 1913
            DL  +   Q  HGGW D M E LT    +   D+  D  V  PSG  +  N  +L     V+  ++             G  VQ+  D +  KLLQ  HGEW E M   LGK   V QI+ D D K+      +  +P  +       + + +   +       +   T E        + A   G+L++V   L+  D V VN    G   +  A+  GH D++ LLL+   ++   DKDGD A+H A   +   + ++L + GAD+NA+N ++ TP  IAV KG   +++ L+       S+ DS+ DT LH A++  R + +  LL AGAD+ + N   FNA H AA+ G+   + + L +     +V+ +K+D + A+H+AA+NNH     +L+ +  A+L++QN+  +TALH+AV+R++   V+ LV  +A+LD++DK+G+T LH A++ + T S       M     V             LG  G        IA +L  NGA + I+N KG++PLD+C D SL  + L+   ++     +  +        PS   +NE         L+E      C +C D +   +F  CGH+  C  CS  + +C +C E++  + KI
Sbjct:  257 DLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGEVAAGAEGGSSQFMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKVAPAGSAVTNASGERLSQLLKKLFETQESGDINEELVKAAANGDLAKVEDILKRPD-VDVNGQCAGHTAMQAASQNGHVDVLKLLLKHSVDLEAEDKDGDRAVHHASFGDEGSVIEVLHRGGADLNARNKRRQTPLHIAVNKGHLQVVKTLL-DFGCHPSLQDSEGDTPLHDAISKKRDDMLSVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDVQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDVQDKDGDTPLHEALR-HHTLSQLRQLQDMQDVSKVEPWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLTIRNKKGQSPLDLCPDPSL-CKALAKCHKEKTSGQVGSRS-------PSLNSNNET--------LEE------CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 861          

HSP 2 Score: 56.6102 bits (135), Expect = 6.552e-7
Identity = 22/59 (37.29%), Postives = 40/59 (67.80%), Query Frame = 3
Query: 1731 AELMELRQKLKEMEDEKICKICHDRRLKVIFECGHMCCDDCSDNISECHLCSEKILHKI 1907
            A++ +L+Q+L++++++ +C +C DR   +IF CGH  C  C D +SEC +C + I  +I
Sbjct:  969 ADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRI 1027          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. UniProt/SwissProt
Match: sp|Q6GNY1|MIB1_XENLA (E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis OX=8355 GN=mib1 PE=2 SV=1)

HSP 1 Score: 258.84 bits (660), Expect = 3.204e-73
Identity = 188/631 (29.79%), Postives = 308/631 (48.81%), Query Frame = 3
Query:  135 DLSTIIKKQKNHGGWNDLMKECLTGPCKLIN-DDGSDATVMGPSGMIYRLNSELLVPFKSVKK-------------HKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKSEIVENTELKXXXXXXXXXXXXXXLITDER---TMRFLVALKTGNLSEVLRLV--DSVGVNTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKR-DGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLM-KYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMK---------------VNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDARSNEAELMELRQKLKEMEDEKICKICHDRRLKVIF-ECGHMC-CDDCSDNISECHLCSEKILHKIKI 1913
            +L  +   Q  HGGW D M E LT    +   D+  D  V  PSG  +  N  +L     V+               ++G  VQ+  D E  KLLQ  HGEW E M   LGK   V QI+ D D K+      +  +P  +       + + +   +       +   T E        + A   G++++V  L+    V VN    G   +  A+  GH D++ LLL+   ++   DKDGD A+H A   +   + ++L + GAD+NA+N ++ TP  IAV KG   +++ L+   +   S+ DS+ DT LH A++  R + +  LL AGAD+ + N   FNA H AA+ G+   + + L +     +V+ +K+D + A+H+AA+NNH     +L+ +  A+L++QN+  +TALH+AV+R++   V+ LV  +A+LD++DK+G+T LH A++               V + ++      K T  +G LG  G        IA +L  NGA + ++N KG++PLD+C D +L  + L+   ++     +           PS   +N++E +E             C +C D +   +F  CGH+  C  CS  + +C LC E++  + KI
Sbjct:  257 ELEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGDAAQGAEGGTSPFQVGDLVQICYDIERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDNDLKVEVCGTSWTYNPAAVSRVASVGSAISNATGERLSQLLKKLFETQESGDLNEELVKAAANGDVAKVDDLLKRQDVDVNGQCAGHTAMQAASQNGHVDILKLLLKHSVDVEAEDKDGDRAVHHAAFGDEGTVIEVLQRGGADLNARNKRRQTPLHIAVNKGHLQVVKKLL-DFSCHPSLQDSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGSANLDIQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDTTTWEPSKNTLIMG-LGTQGAEKKSAASIACFLAANGADLAVRNKKGQSPLDLCPDPNL-CKTLAKCHKEKSSGQVGSHS-------PS-MINNDSETLEE------------CMVCSDLKRDTLFGPCGHIATCSLCSPRVKKCLLCKEQVQSRTKI 864          

HSP 2 Score: 56.225 bits (134), Expect = 8.496e-7
Identity = 22/59 (37.29%), Postives = 40/59 (67.80%), Query Frame = 3
Query: 1731 AELMELRQKLKEMEDEKICKICHDRRLKVIFECGHMCCDDCSDNISECHLCSEKILHKI 1907
            A++ +L+Q+L++++++ +C +C DR   +IF CGH  C  C D +SEC +C + I  +I
Sbjct:  946 ADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRI 1004          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. UniProt/SwissProt
Match: sp|Q9VUX2|MIB_DROME (E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster OX=7227 GN=mib1 PE=1 SV=3)

HSP 1 Score: 254.603 bits (649), Expect = 4.382e-71
Identity = 203/691 (29.38%), Postives = 327/691 (47.32%), Query Frame = 3
Query:   81 GANISSFDIRKKVVIANQDLSTIIKKQKNHGGWNDLMKECLTGPCKLIN-DDGSDATVMGPSGMIYRLNSELLV----PFKSVKKHKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHP----KTIKSEIVENTELKXXXXXXXXXXXXXXL----ITDERTMRFLVALKTGNLSEVLRLVDS----------------VGVNTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFL-KRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKY-KADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVN--------QTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSL-KTRILSLVER----------------------------DSQKHHITKKELLEHPVQPSDARSNEAEL----MELRQKLKEMEDEKI-----CKICHDRRLKVIFE-CGHM-CCDDCSDNISECHLCSEKILHKIKIN 1916
            G     F I  KV + + DL  +   Q  HGGW D M ECL+    ++  D+  D  V   SG  +  N  +L     P  +  + ++G  V++  D E  K+LQ  HGEW + M+  LGK   V Q++ D D K+   N  +  +P    K   S   + +      S +   +  + L    ++ + T  F+ A   G  +     +                  V VN    G   L  A+  GH +++ +LL    ++ I DKDGD A+H A   +   + ++L K GAD+NA+N ++ T   IAV KG  ++++ L+T      S+ DS+ DT LH A++    E +  LL+ GADI L N   FNA H AA+ G+   ++I L K +   +V  +K+D + A+H+AA+NNH     +L+   KA+++ QN+ L+TALH+AV+R+++  VK LV++ A+L++ DK+G+T LH A++ +        Q   GFG  L     +G+             IA +L  NGA + +KN K +TPLD+C D +L KT +    ER                             S   ++    L      P+ + S+   L     E+ Q L E   +       C +C D +   +F+ CGH+ CC+ C+  + +C +C E +  + KI+
Sbjct:  334 GKGPHGFQIGDKVTV-DLDLEIVQSLQHGHGGWTDGMFECLSNAGMVVGIDEDHDIVVAYNSGNRWTFNPAVLTKVSSPTTAPPEFQVGDIVKICSDVESIKILQRGHGEWADAMQLTLGKIGRVQQVYHDNDLKVEVGNTSWTYNPLAVCKVASSTASDGSCAPVIPSSERLSAILKKLFEPNVSGDATEEFVKAAANGFAARCEEYLAGAAQPSTSSASPSSGPDVNVNGVFAGHTALQAASQNGHIEVIQVLLRHAVDVEIEDKDGDRAVHHAAFGDEAAVIEILAKAGADLNARNKRRQTSLHIAVNKGHLNVVKTLLTL-GCHPSLQDSEGDTPLHDAISKEHDEMLSLLLDFGADITLNNNNGFNALHHAALKGNPSAMKILLTKTNRPWIVEEKKDDGYTALHLAALNNHVEIAELLVHMGKANMDRQNVNLQTALHLAVERQHVQIVKLLVQDGADLNIPDKDGDTPLHEALRHHTLSQLKQLQDVEGFGKLL-----MGLRN--ANNKKASASIACFLAANGADLTLKNRKQQTPLDLCPDPNLCKTLVKCYNERKTDDSELPGNVAGTSSSARARAASGSLNQSSSVNMPLSSLAASSTFPAASSSSIFALNGIANEMSQSLHEDPPKSSASLDECLVCSDAKRDTVFKPCGHVSCCETCAPRVKKCLICRETVSSREKID 1015          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. TrEMBL
Match: A0A0P5YTS7 (E3 ubiquitin-protein ligase mib1 OS=Daphnia magna OX=35525 PE=4 SV=1)

HSP 1 Score: 273.863 bits (699), Expect = 1.599e-76
Identity = 207/651 (31.80%), Postives = 322/651 (49.46%), Query Frame = 3
Query:   84 ANISSFDIRKKVVIANQDLSTIIKKQKNHGGWNDLMKECL--TGPCKLINDDGSDATVMGPSGMIYRLNSELL-----VPFKSVK------KHKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKSEIVENTELKXXXXXXXXXXXXXXL----ITDERTMRFLVALKTGN---LSEVLRLVDSVGVNTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKR-DGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKY-KADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMK---------VNQTESGFGNFLKMTSA-----LGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDARSNE---AELMELRQKLKEMEDEKICKICHDRRLKVIF-ECGHM-CCDDCSDNISECHLCSEKILHKIKI 1913
            + +  F I  +V + + DL  +   Q  HGGW D M ECL  TG    I++D  D  V  PSG  +  N  +L      P           +  +G  VQ+  D E  K+LQ  HGEW E M   LGK   V QI+ D D K+      +  +P  + ++I  +  L    + ++  +  + L    +T +     + A   G+   + E+L+ VD+  VN    G   L  A+  GH +++ +LL  KA++ I DKDGD A+H A   +   + ++L + GAD+NA+N ++ T   IAV KG   +++ L+       S+ DS+ DTALH A++  R + +  L++  ADI L N   FNA H AA+ G+   + + L +     +V+ +K+D + A+H+AA+NNH     +L++  +A L+LQN+ L+TALH+AV+R++   V+ LV     L+L DK+G+T LH A++         +   + G G     TS      L  LG  G        IA +L  NGA + IKN KG TPLD+C D +L   +       S     T+ E   H     D  S E     L ++   L +  DE  C +C D +   +F  CGH+ CC  C+  + +C +C + I  + KI
Sbjct:  247 SGLHGFAIGDQVNV-DLDLELVQTLQHGHGGWTDGMFECLGTTGTVVGIDED-HDIVVSYPSGNRWTFNPTILRVVVTSPPPGTSNVDVQLQFAVGDLVQICSDLERIKILQRGHGEWAEAMAPTLGKVGRVQQIYHDNDLKVEVCGTSWTYNPAAV-TKIASDGSLPGASNGENLSALLKKLFETHVTGDVHEELVKAAANGDTQKVEEILKRVDA-DVNGVFAGHTALQAASQNGHLEVIKVLLRYKADVEIEDKDGDRAVHHAAFGDEPSVMEVLAQSGADLNARNKRRQTALHIAVNKGHVGVVKTLLEL-GCHPSLQDSEGDTALHDAISKKRDDMLTLLIDHNADITLTNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVRAGRAQLDLQNVNLQTALHLAVERQHTQIVRLLVRENCSLNLADKDGDTPLHEALRHHTLSQLRQLQDLQDGSGKTSTATSGHNYSLLMGLGTQGANKKSSASIACFLAANGADLTIKNKKGLTPLDLCPDPNLCRALTKCYGEKS-----TRGECGAH----GDTLSQEMGAVALTDMACDLTDTADE--CMVCSDMKRDTLFGPCGHVNCCSACAPRVKKCLVCKDPITTRTKI 881          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. TrEMBL
Match: A0A0P5H436 (E3 ubiquitin-protein ligase mib1 OS=Daphnia magna OX=35525 PE=4 SV=1)

HSP 1 Score: 271.552 bits (693), Expect = 4.395e-76
Identity = 205/651 (31.49%), Postives = 321/651 (49.31%), Query Frame = 3
Query:   84 ANISSFDIRKKVVIANQDLSTIIKKQKNHGGWNDLMKECL--TGPCKLINDDGSDATVMGPSGMIYRLNSELL-----VPFKSVK------KHKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKSEIVENTELKXXXXXXXXXXXXXXL----ITDERTMRFLVALKTGN---LSEVLRLVDSVGVNTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKR-DGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKY-KADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMK---------VNQTESGFGNFLKMTSA-----LGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDARSNE---AELMELRQKLKEMEDEKICKICHDRRLKVIF-ECGHM-CCDDCSDNISECHLCSEKILHKIKI 1913
            + +  F I  +V + + DL  +   Q  HGGW D M ECL  TG    I++D  D  V  PSG  +  N  +L      P           +  +G  VQ+  D E  K+LQ  HGEW E M   LGK   V QI+ D D K+      +  +P  + ++I  +  L    + ++  +  + L    +T +     + A   G+   + E+L+ VD+  VN    G   L  A+  GH +++ +LL  KA++ I DKDGD A+H A   +   + ++L + GAD+NA+N ++ T   IAV KG   +++ L+       S+ DS+ DT LH A++  R + +  L++  ADI L N   FNA H AA+ G+   + + L +     +V+ +K+D + A+H+AA+NNH     +L++  +A L+LQN+ L+TALH+AV+R++   V+ LV     L+L DK+G+T LH A++         +   + G G     TS      L  LG  G        IA +L  NGA + IKN KG TPLD+C D +L   +       S     T+ E   H     D  S E     L ++   L +  DE  C +C D +   +F  CGH+ CC  C+  + +C +C + I  + K+
Sbjct:  247 SGLHGFAIGDQVNV-DLDLELVQTLQHGHGGWTDGMFECLGTTGTVVGIDED-HDIVVSYPSGNRWTFNPTILRVVVTSPPPGTSNVDVQLQFAVGDLVQICSDLERIKILQRGHGEWAEAMAPTLGKVGRVQQIYHDNDLKVEVCGTSWTYNPAAV-TKIASDGSLPGASNGENLSALLKKLFETHVTGDVHEELVKAAANGDTQKVEEILKRVDA-DVNGVFAGHTALQAASQNGHLEVIKVLLRYKADVEIEDKDGDRAVHHAAFGDEPSVMEVLAQSGADLNARNKRRQTALHIAVNKGHVGVVKTLLEL-GCHPSLQDSEGDTPLHDAISKKRDDMLTLLIDHNADITLTNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVRAGRAQLDLQNVNLQTALHLAVERQHTQIVRLLVRENCSLNLADKDGDTPLHEALRHHTLSQLRQLQDLQDGSGKTSTATSGHNYSLLMGLGTQGANKKSSASIACFLAANGADLTIKNKKGLTPLDLCPDPNLCRALTKCYGEKS-----TRGECGAH----GDTLSQEMGAVALTDMACDLTDTADE--CMVCSDMKRDTLFGPCGHVNCCSACAPRVKKCLVCKDPITTRTKV 881          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. TrEMBL
Match: A0A0P5QQ02 (E3 ubiquitin-protein ligase mib1 OS=Daphnia magna OX=35525 PE=4 SV=1)

HSP 1 Score: 271.937 bits (694), Expect = 2.877e-75
Identity = 206/651 (31.64%), Postives = 321/651 (49.31%), Query Frame = 3
Query:   84 ANISSFDIRKKVVIANQDLSTIIKKQKNHGGWNDLMKECL--TGPCKLINDDGSDATVMGPSGMIYRLNSELL-----VPFKSVK------KHKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKSEIVENTELKXXXXXXXXXXXXXXL----ITDERTMRFLVALKTGN---LSEVLRLVDSVGVNTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKR-DGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKY-KADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMK---------VNQTESGFGNFLKMTSA-----LGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDARSNE---AELMELRQKLKEMEDEKICKICHDRRLKVIF-ECGHM-CCDDCSDNISECHLCSEKILHKIKI 1913
            + +  F I  +V + + DL  +   Q  HGGW D M ECL  TG    I++D  D  V  PSG  +  N  +L      P           +  +G  VQ+  D E  K+LQ  HGEW E M   LGK   V QI+ D D K+      +  +P  + ++I  +  L    + ++  +  + L    +T +     + A   G+   + E+L+ VD+  VN    G   L  A+  GH +++ +LL  KA++ I DKDGD A+H A   +   + ++L + GAD+NA+N ++ T   IAV KG   +++ L+       S+ DS+ DT LH A++  R + +  L++  ADI L N   FNA H AA+ G+   + + L +     +V+ +K+D + A+H+AA+NNH     +L++  +A L+LQN+ L+TALH+AV+R++   V+ LV     L+L DK+G+T LH A++         +   + G G     TS      L  LG  G        IA +L  NGA + IKN KG TPLD+C D +L   +       S     T+ E   H     D  S E     L ++   L +  DE  C +C D +   +F  CGH+ CC  C+  + +C +C + I  + KI
Sbjct:  247 SGLHGFAIGDQVNV-DLDLELVQTLQHGHGGWTDGMFECLGTTGTVVGIDED-HDIVVSYPSGNRWTFNPTILRVVVTSPPPGTSNVDVQLQFAVGDLVQICSDLERIKILQRGHGEWAEAMAPTLGKVGRVQQIYHDNDLKVEVCGTSWTYNPAAV-TKIASDGSLPGASNGENLSALLKKLFETHVTGDVHEELVKAAANGDTQKVEEILKRVDA-DVNGVFAGHTALQAASQNGHLEVIKVLLRYKADVEIEDKDGDRAVHHAAFGDEPSVMEVLAQSGADLNARNKRRQTALHIAVNKGHVGVVKTLLEL-GCHPSLQDSEGDTPLHDAISKKRDDMLTLLIDHNADITLTNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVRAGRAQLDLQNVNLQTALHLAVERQHTQIVRLLVRENCSLNLADKDGDTPLHEALRHHTLSQLRQLQDLQDGSGKTSTATSGHNYSLLMGLGTQGANKKSSASIACFLAANGADLTIKNKKGLTPLDLCPDPNLCRALTKCYGEKS-----TRGECGAH----GDTLSQEMGAVALTDMACDLTDTADE--CMVCSDMKRDTLFGPCGHVNCCSACAPRVKKCLVCKDPITTRTKI 881          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. TrEMBL
Match: A0A4Y2LV21 (E3 ubiquitin-protein ligase MIB1 OS=Araneus ventricosus OX=182803 GN=MIB1 PE=4 SV=1)

HSP 1 Score: 268.47 bits (685), Expect = 6.596e-75
Identity = 205/658 (31.16%), Postives = 327/658 (49.70%), Query Frame = 3
Query:   84 ANISSFDIRKKVVIANQDLSTIIKKQKNHGGWNDLMKECL--TGPCKLINDDGSDATVMGPSGMIYRLNSELLVPFKSV--------------KKHKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKSEIVENTELKXXXXXXXXXXXXXXL----ITDERTMRFLVALKTGNLS---EVLRLVDSVGVNTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGS----QDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKR-DGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKY-KADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMK------VNQTES-------GFGNFLKMTSALGVLGNIG-EGLDKLED--IAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDARSNEAELMELRQKLKEMEDEKICKICHDRRLKVIF-ECGHMC-CDDCSDNISECHLCSEKILHKIKIN 1916
            A I  F I   V + + +L  +   Q  HGGW D M ECL  TG    I++D SD  V  PSG  +  N  +L    +               ++  +G  VQ+ +D E  K+LQ  HGEW E M   LGK   V QI+ D D K+      +  +P  + +++  +  +    S +   +  + L    ++ +     + A   G+     E+L+  D+  VN        L  A+  GH +++ +LL   AN+ I DKDGD A+H A   +   + +LL + GAD+NA+N ++ TP  IAV KG     + ILEL         S+ DS+ DT LH A++  R + +  LL+ GADI L N   FNA H AA+ G+   + I L +     +VN +K+D + A+H+AA+NNH     +L++  KA++N QN+ L+T LH+AV+R++   V+ LV  K +L++ DK+G+T LH A++      + Q +        G  N   ++    +L  +G +  DK  +  IA +L+ NGA++ IKN KG+TPLD+C D +L   +    +  + +  IT       P   +  + NE         L+E      C +C D +   +F  CGH+  C  CS  + +C +C E +  + K++
Sbjct:  247 AGIHGFQIGDNVNV-DLELEIVQSLQHRHGGWTDGMFECLGTTGTVVGIDED-SDIVVSYPSGNRWTFNPAVLTKVNTAVSTSSLISSDGGTAQQFTVGDLVQICRDLERIKILQRGHGEWAEAMLPTLGKIGRVQQIYHDNDLKVEVCGTSWTYNPAAV-TKVASDGAIPGTSSGERLSALLKKLFETHVSGDVNEELVKAAANGDAQKCEEILKRSDA-DVNGVFASHTALQAASQNGHIEVIKILLRHNANVEIEDKDGDRAVHHAAFGDEPGVMELLARAGADLNARNKRRQTPLHIAVNKGHIGVVRSILEL-----GCRPSLQDSEGDTPLHDAISKKRDDMLTLLLDHGADICLTNNNGFNALHHAALRGNPSAMRILLSKLPRNWVVNEKKDDGYTALHLAALNNHVEVAELLVQQGKANMNQQNVNLQTPLHLAVERQHTQIVRLLVREKCDLNIPDKDGDTPLHEALRHHTLSQLRQLQDMQEGGKVGISNESTISGTSELLMGLGTQSSDKKSNASIACFLVSNGANLHIKNKKGQTPLDLCPDPNLCKALTKCYKEHANEDSIT-------PSNTTPVQDNET--------LEE------CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLMCKEPVQSRTKVS 874          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. TrEMBL
Match: A0A0C9RRG6 (MIB1 protein OS=Fopius arisanus OX=64838 GN=MIB1 PE=4 SV=1)

HSP 1 Score: 269.626 bits (688), Expect = 1.325e-74
Identity = 200/619 (32.31%), Postives = 314/619 (50.73%), Query Frame = 3
Query:  135 DLSTIIKKQKNHGGWNDLMKECL--TGPCKLINDDGSDATVMGPSGMIYRLNSELL------VPFKSV----KKHKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKSEIVENTELKXXXXXXXXXXXXXXLI-------TDERTMRFLVALKTGNLSEVLRLVDSVGVNTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFL-KRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKY-KADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSALGVLGNIG-EGLDKLED--IAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDARSNEAELMELRQKLKEMEDEKICKICHDRRLKVIFE-CGHM-CCDDCSDNISECHLCSEKILHKIKI 1913
            +L  +   Q  HG W D M ECL  TG    I++D  D  V  PSG  +  N  +L      VP  +     +   +G  VQ+  D E+ KLLQ  HGEW E M   LGK   V QI+ DGD KI   +  +  +P+ I      +  +  + + +   +  + L         +E  ++      +    E L+ +D+  VN    G   L  A++ GH D++ +LL  KA++ I DKDGD A+H A   +   +  L+   GAD+NA+N ++ T   IAV KG   ++  L+       S+ D++ DT LH A++  R + +  LL+  ADI   N   FNA H AA+ G+   + I L K     +V+ +K+D + A+H+AA+NNH     +L +  KADL+LQN+ L+TALH+AV+R++   V+ LV   A +++ DK+G+T LH A++ + T S       +     +L  +G +G DK     IA +L  +GA +++KN KG+TPLD+C D +L  + L+   ++ + H I        P  PS A                  DE  C +C D +  ++F  CGH+ CC+ C+  + +C +C E +  +IKI
Sbjct:  263 ELEIVQSLQHGHGSWTDGMFECLGTTGIVVSIDED-HDIVVSYPSGNRWTFNPAVLSKVQTPVPVATSTSDNQTFAVGDLVQICNDLEKIKLLQRGHGEWAEAMAPTLGKIGRVQQIYHDGDLKIEVCSTSWTYNPQAIIKVASSDGSVPGNSNGERLSALLKKLFETHVSGDVNEELVKSAANGDSAKCEECLKRLDA-DVNGVFAGHTALQAASHNGHLDVIKILLRYKADVEIEDKDGDRAVHHAAFGDESGVMALVAGAGADLNARNKRRQTALHIAVNKGHAGVVRTLLEL-GCHPSLQDAEGDTPLHDAISKKRDDMLALLLDYAADITRTNNTGFNALHHAALRGNPSAMRILLTKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLARVGKADLDLQNVNLQTALHLAVERQHTQIVRLLVREGANVNVADKDGDTPLHEALR-HHTLSQLRQLQDVQDVGRLLMGLGAQGQDKKSSSFIACFLAAHGADLELKNKKGQTPLDLCPDPNL-CKTLTNCHKNKESHDI-------EPATPSAAI-----------------DE--CLVCSDGKRDMLFSPCGHVSCCNACAPRVKKCLICRENVASRIKI 850          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Cavefish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 258.07 bits (658), Expect = 7.187e-74
Identity = 190/630 (30.16%), Postives = 303/630 (48.10%), Query Frame = 3
Query:  135 DLSTIIKKQKNHGGWNDLMKECLTGPCKLIN-DDGSDATVMGPSGMIYRLNSELLVPFKSVKKHKI-------------GSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKSEIVENTELKXXXXXXXXXXXXXXLITDER---TMRFLVALKTGNLSEV---LRLVDSVGVNTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKR-DGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLM-KYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSALGV-------------LGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDARSNEAELMELRQKLKEMEDEKICKICHDRRLKVIF-ECGHMC-CDDCSDNISECHLCSEKILHKIKI 1913
            DL  +   Q  HGGW D M E LT    +   D+  D  V  PSG  +  N  +L      +  ++             G  VQ+  D +  KLLQ  HGEW E M   LGK   V QI+ D D K+      +  +P  +       + + +   +       +   T E        + A   G+L++V   L+  D V VN    G   +  A+  GH D++ LLL+   ++   DKDGD A+H A   +   + ++L + GAD+NA+N ++ TP  IAV KG   +++ L+       S+ DS+ DT LH A++  R + +  LL AGAD+ + N   FNA H AA+ G+   + + L +     +V+ +K+D + A+H+AA+NNH     +L+ +  A L++QN+  +TALH+AV+R++   V+ LV  +A+LD++DK+G+T LH A++ + T S       M     V             LG  G        IA +L  NGA + I+N KG++PLD+C D SL  + L+   ++     +  +        PS   +NE         L+E      C +C D +   +F  CGH+  C  CS  + +C +C +++  + KI
Sbjct:  257 DLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVARSGEVAAGAEGGSSQFMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKVAPAGSAVTNASGERLSQLLKKLFETQESGDINEELVKAAANGDLAKVEDILKRPD-VDVNGQCAGHTAMQAASQNGHVDVLKLLLKHNVDLEAEDKDGDRAVHHAAFGDEGSVIEVLHRGGADLNARNKRRQTPLHIAVNKGHLQVVKTLL-DFGCHPSLQDSEGDTPLHDAISKKRDDMLSVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGSASLDIQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDVQDKDGDTPLHEALR-HHTLSQLRQLQDMQDVSKVEPWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLTIRNKKGQSPLDLCPDPSL-CKALAKCHKEKTSGQVGSRS-------PSLNSNNET--------LEE------CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKDQVQSRTKI 861          

HSP 2 Score: 56.6102 bits (135), Expect = 8.896e-8
Identity = 22/59 (37.29%), Postives = 40/59 (67.80%), Query Frame = 3
Query: 1731 AELMELRQKLKEMEDEKICKICHDRRLKVIFECGHMCCDDCSDNISECHLCSEKILHKI 1907
            A++ +L+Q+L++++++ +C +C DR   +IF CGH  C  C D +SEC +C + I  +I
Sbjct:  945 ADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRI 1003          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Cavefish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 257.684 bits (657), Expect = 1.086e-73
Identity = 190/630 (30.16%), Postives = 303/630 (48.10%), Query Frame = 3
Query:  135 DLSTIIKKQKNHGGWNDLMKECLTGPCKLIN-DDGSDATVMGPSGMIYRLNSELLVPFKSVKKHKI-------------GSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKSEIVENTELKXXXXXXXXXXXXXXLITDER---TMRFLVALKTGNLSEV---LRLVDSVGVNTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKR-DGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLM-KYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSALGV-------------LGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDARSNEAELMELRQKLKEMEDEKICKICHDRRLKVIF-ECGHMC-CDDCSDNISECHLCSEKILHKIKI 1913
            DL  +   Q  HGGW D M E LT    +   D+  D  V  PSG  +  N  +L      +  ++             G  VQ+  D +  KLLQ  HGEW E M   LGK   V QI+ D D K+      +  +P  +       + + +   +       +   T E        + A   G+L++V   L+  D V VN    G   +  A+  GH D++ LLL+   ++   DKDGD A+H A   +   + ++L + GAD+NA+N ++ TP  IAV KG   +++ L+       S+ DS+ DT LH A++  R + +  LL AGAD+ + N   FNA H AA+ G+   + + L +     +V+ +K+D + A+H+AA+NNH     +L+ +  A L++QN+  +TALH+AV+R++   V+ LV  +A+LD++DK+G+T LH A++ + T S       M     V             LG  G        IA +L  NGA + I+N KG++PLD+C D SL  + L+   ++     +  +        PS   +NE         L+E      C +C D +   +F  CGH+  C  CS  + +C +C +++  + KI
Sbjct:  254 DLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVARSGEVAAGAEGGSSQFMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKVAPAGSAVTNASGERLSQLLKKLFETQESGDINEELVKAAANGDLAKVEDILKRPD-VDVNGQCAGHTAMQAASQNGHVDVLKLLLKHNVDLEAEDKDGDRAVHHAAFGDEGSVIEVLHRGGADLNARNKRRQTPLHIAVNKGHLQVVKTLL-DFGCHPSLQDSEGDTPLHDAISKKRDDMLSVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGSASLDIQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDVQDKDGDTPLHEALR-HHTLSQLRQLQDMQDVSKVEPWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLTIRNKKGQSPLDLCPDPSL-CKALAKCHKEKTSGQVGSRS-------PSLNSNNET--------LEE------CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKDQVQSRTKI 858          

HSP 2 Score: 56.6102 bits (135), Expect = 7.476e-8
Identity = 22/59 (37.29%), Postives = 40/59 (67.80%), Query Frame = 3
Query: 1731 AELMELRQKLKEMEDEKICKICHDRRLKVIFECGHMCCDDCSDNISECHLCSEKILHKI 1907
            A++ +L+Q+L++++++ +C +C DR   +IF CGH  C  C D +SEC +C + I  +I
Sbjct:  966 ADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRI 1024          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Cavefish
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:103034310])

HSP 1 Score: 238.81 bits (608), Expect = 5.406e-67
Identity = 179/611 (29.30%), Postives = 299/611 (48.94%), Query Frame = 3
Query:  159 QKNHGGWNDLMKE--CLTGPCKLINDDGSDATVMGPSGMIYRLNSELLVPFKSVKKHKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKSE---------IVENTELKXXXXXXXXXXXXXXLITDERTMRFLVALKTGNLSEVLRLVDSVGVNTNLK--GMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEAL-LNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKY-KADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSAL-------GVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDA---RSNEAELMELRQKLKEMEDEKICKICHDRRLKVIFE-CGH-MCCDDCSDNISECHLCSEKILHKIK 1910
            Q+ HGGWN  M E  C  G    I D G D  V   + + +  +   L     V    +G  V+++ D E  K LQ  HGEW + M + LG+  +V++++ DGD +++   + +  +P  +  +           EN            +         +   R ++    G+ ++V  LV       ++K  G   L +AA++GH ++V +LL+  ++I   D+DGD ALH     N+ ++  LLL KGA+VN  NN   T   IAV KG  D++ +L T ++AD+++ DS  DT LH A+       +E L +    D    N + FN  H AA+ G++   E+ L R   +L + +KED F+A+H+AA+NNH     +L+K  + D N++N   +T L +AV + +++ V  LV   A+++ +D+ G+TA+H A+   Q  +      +  SAL       G+LGN    L+    IA +L + GA I+  N+KGK+PLD+  D++     L L+   S+KH + + + +      S +   R +          +        C IC +  L V+F  C H + C++C+  + +C  C   I  KI+
Sbjct:  332 QEGHGGWNPKMAEYICRIGTVHRITDRG-DVRVQYSNNIRWTFHPGALT---KVNTFAVGELVRVLDDIESVKRLQAGHGEWTDSMASALGQVGKVLKVYADGDLRVAFGGQTWTFNPACLSGQPGEVDANLMTAENPSESGSTVISVLEKLLSQSTEQDNPGRLVIEAAHGSATKVRELVQKHPDKVDIKNQGKTALQVAAHQGHMEVVKVLLQANSSIEAKDEDGDAALHYTAFGNQAEIARLLLSKGANVNLLNNSMCTALHIAVNKGFTDVVRVL-TEHSADVNLQDSYGDTPLHDAIAKDFRSIIEILTVVPNIDFTQQNNRGFNLLHHAALKGNKLATEMILSR-ARQLADVKKEDGFSALHLAALNNHRDVAEILVKEGRCDANIRNNRNQTPLQLAVTQGHVALVALLVSEGADVNAEDEEGDTAMHTALSRQQLTNMLSTSEREASALYCRLSSSGLLGNT--ELNVGAAIACFLAQEGADINYANHKGKSPLDLVTDST----TLQLIRSFSEKHRLQQLQAITCGTSSSSSSLRRVHTTPNTMTNLAMPSAPGPSECLICSELALLVLFSPCQHSVACEECAHRMKKCIKCQVTITKKIR 930          

HSP 2 Score: 95.1301 bits (235), Expect = 1.013e-19
Identity = 115/478 (24.06%), Postives = 202/478 (42.26%), Query Frame = 3
Query:  639 GNLSEVLRLVDSVGVNTNL---KGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLL-LKKGADVNAQNNK-------------KITPTMI---------------------AVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLA--------AISGHEK-ILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAM--KVNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKK---ELLEHPVQPSDARSNEAELME-LRQKLKEMEDEKICKICHDRRLKVIFECGHMCCDDCSDNISECHLCSEKILHKIKI 1913
            GN +E+ RL+ S G N NL        L IA N+G  D+V +L E  A++N+ D  GDT LH A+ ++   + ++L +    D   QNN+             K+   MI                     A L   +D+ E+L+     D +I ++   T L LAV    +  V  L++ GAD+   +++   A H A         +S  E+    ++ +     L+ + + +  AAI          C   L +  AD+N  N + ++ L +      L  ++   E      L+     T+   +   +V+ T +   N L M SA G      E L    ++A+ ++ +     +   +    +  C    +K ++            ITKK   +  E    P+   S +  L+E L+ + ++ME+   C IC D ++K++F+CGH  C DCS  +  C +C + I  +I++
Sbjct:  564 GNQAEIARLLLSKGANVNLLNNSMCTALHIAVNKGFTDVVRVLTEHSADVNLQDSYGDTPLHDAIAKDFRSIIEILTVVPNIDFTQQNNRGFNLLHHAALKGNKLATEMILSRARQLADVKKEDGFSALHLAALNNHRDVAEILVKEGRCDANIRNNRNQTPLQLAVTQGHVALVALLVSEGADVNAEDEEGDTAMHTALSRQQLTNMLSTSEREASALYCRLSSSGLLGNTELNVGAAIA---------CF--LAQEGADINYANHKGKSPLDLVTDSTTLQLIRSFSEKHRLQQLQAITCGTSSSSSSLRRVHTTPNTMTN-LAMPSAPGP----SECL-ICSELALLVLFSPCQHSVACEECAHRMKKC----IKCQVT-----------ITKKIRQDQTEVECSPNSDNSEQHNLLEQLQSRYRQMEERITCPICIDNQIKLVFQCGHASCIDCSAALKTCPICRQTIRERIQL 1009          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Cavefish
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:103034310])

HSP 1 Score: 238.039 bits (606), Expect = 5.880e-67
Identity = 180/610 (29.51%), Postives = 297/610 (48.69%), Query Frame = 3
Query:  159 QKNHGGWNDLMKE--CLTGPCKLINDDGSDATVMGPSGMIYRLNSELLVPFKSVKKHKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKSE---------IVENTELKXXXXXXXXXXXXXXLITDERTMRFLVALKTGNLSEVLRLVDSVGVNTNLK--GMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEAL-LNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKY-KADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSAL-------GVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHI--TKKELLEHPVQPSDARSNEAELMELRQKLKEMEDEKICKICHDRRLKVIFE-CGH-MCCDDCSDNISECHLCSEKILHKIK 1910
            Q+ HGGWN  M E  C  G    I D G D  V   + + +  +   L     V    +G  V+++ D E  K LQ  HGEW + M + LG+  +V++++ DGD +++   + +  +P  +  +           EN            +         +   R ++    G+ ++V  LV       ++K  G   L +AA++GH ++V +LL+  ++I   D+DGD ALH     N+ ++  LLL KGA+VN  NN   T   IAV KG  D++ +L T ++AD+++ DS  DT LH A+       +E L +    D    N + FN  H AA+ G++   E+ L R   +L + +KED F+A+H+AA+NNH     +L+K  + D N++N   +T L +AV + +++ V  LV   A+++ +D+ G+TA+H A+   Q  +      +  SAL       G+LGN    L+    IA +L + GA I+  N+KGK+PLD+  D++     L L+   S+KH    +    L       +  +N A        +        C IC +  L V+F  C H + C++C+  + +C  C   I  KI+
Sbjct:  277 QEGHGGWNPKMAEYICRIGTVHRITDRG-DVRVQYSNNIRWTFHPGALT---KVNTFAVGELVRVLDDIESVKRLQAGHGEWTDSMASALGQVGKVLKVYADGDLRVAFGGQTWTFNPACLSGQPGEVDANLMTAENPSESGSTVISVLEKLLSQSTEQDNPGRLVIEAAHGSATKVRELVQKHPDKVDIKNQGKTALQVAAHQGHMEVVKVLLQANSSIEAKDEDGDAALHYTAFGNQAEIARLLLSKGANVNLLNNSMCTALHIAVNKGFTDVVRVL-TEHSADVNLQDSYGDTPLHDAIAKDFRSIIEILTVVPNIDFTQQNNRGFNLLHHAALKGNKLATEMILSR-ARQLADVKKEDGFSALHLAALNNHRDVAEILVKEGRCDANIRNNRNQTPLQLAVTQGHVALVALLVSEGADVNAEDEEGDTAMHTALSRQQLTNMLSTSEREASALYCRLSSSGLLGNT--ELNVGAAIACFLAQEGADINYANHKGKSPLDLVTDST----TLQLIRSFSEKHRYVVSSSSSLRRVHTTPNTMTNLA--------MPSAPGPSECLICSELALLVLFSPCQHSVACEECAHRMKKCIKCQVTITKKIR 866          

HSP 2 Score: 94.7449 bits (234), Expect = 1.227e-19
Identity = 114/476 (23.95%), Postives = 201/476 (42.23%), Query Frame = 3
Query:  639 GNLSEVLRLVDSVGVNTNL---KGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLL-LKKGADVNAQNNK-------------KITPTMI---------------------AVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLA--------AISGHEK-ILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKK---ELLEHPVQPSDARSNEAELME-LRQKLKEMEDEKICKICHDRRLKVIFECGHMCCDDCSDNISECHLCSEKILHKIKI 1913
            GN +E+ RL+ S G N NL        L IA N+G  D+V +L E  A++N+ D  GDT LH A+ ++   + ++L +    D   QNN+             K+   MI                     A L   +D+ E+L+     D +I ++   T L LAV    +  V  L++ GAD+   +++   A H A         +S  E+    ++ +     L+ + + +  AAI          C   L +  AD+N  N + ++ L +      L  ++   E       K +   ++     +V+ T +   N L M SA G      E L    ++A+ ++ +     +   +    +  C    +K ++            ITKK   +  E    P+   S +  L+E L+ + ++ME+   C IC D ++K++F+CGH  C DCS  +  C +C + I  +I++
Sbjct:  509 GNQAEIARLLLSKGANVNLLNNSMCTALHIAVNKGFTDVVRVLTEHSADVNLQDSYGDTPLHDAIAKDFRSIIEILTVVPNIDFTQQNNRGFNLLHHAALKGNKLATEMILSRARQLADVKKEDGFSALHLAALNNHRDVAEILVKEGRCDANIRNNRNQTPLQLAVTQGHVALVALLVSEGADVNAEDEEGDTAMHTALSRQQLTNMLSTSEREASALYCRLSSSGLLGNTELNVGAAIA---------CF--LAQEGADINYANHKGKSPLDLVTDSTTLQLIRSFSE-------KHRYVVSSSSSLRRVHTTPNTMTN-LAMPSAPGP----SECL-ICSELALLVLFSPCQHSVACEECAHRMKKC----IKCQVT-----------ITKKIRQDQTEVECSPNSDNSEQHNLLEQLQSRYRQMEERITCPICIDNQIKLVFQCGHASCIDCSAALKTCPICRQTIRERIQL 945          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Cavefish
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:103034310])

HSP 1 Score: 238.424 bits (607), Expect = 6.298e-67
Identity = 179/611 (29.30%), Postives = 299/611 (48.94%), Query Frame = 3
Query:  159 QKNHGGWNDLMKE--CLTGPCKLINDDGSDATVMGPSGMIYRLNSELLVPFKSVKKHKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKSE---------IVENTELKXXXXXXXXXXXXXXLITDERTMRFLVALKTGNLSEVLRLVDSVGVNTNLK--GMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEAL-LNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKY-KADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSAL-------GVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDA---RSNEAELMELRQKLKEMEDEKICKICHDRRLKVIFE-CGH-MCCDDCSDNISECHLCSEKILHKIK 1910
            Q+ HGGWN  M E  C  G    I D G D  V   + + +  +   L     V    +G  V+++ D E  K LQ  HGEW + M + LG+  +V++++ DGD +++   + +  +P  +  +           EN            +         +   R ++    G+ ++V  LV       ++K  G   L +AA++GH ++V +LL+  ++I   D+DGD ALH     N+ ++  LLL KGA+VN  NN   T   IAV KG  D++ +L T ++AD+++ DS  DT LH A+       +E L +    D    N + FN  H AA+ G++   E+ L R   +L + +KED F+A+H+AA+NNH     +L+K  + D N++N   +T L +AV + +++ V  LV   A+++ +D+ G+TA+H A+   Q  +      +  SAL       G+LGN    L+    IA +L + GA I+  N+KGK+PLD+  D++     L L+   S+KH + + + +      S +   R +          +        C IC +  L V+F  C H + C++C+  + +C  C   I  KI+
Sbjct:  338 QEGHGGWNPKMAEYICRIGTVHRITDRG-DVRVQYSNNIRWTFHPGALT---KVNTFAVGELVRVLDDIESVKRLQAGHGEWTDSMASALGQVGKVLKVYADGDLRVAFGGQTWTFNPACLSGQPGEVDANLMTAENPSESGSTVISVLEKLLSQSTEQDNPGRLVIEAAHGSATKVRELVQKHPDKVDIKNQGKTALQVAAHQGHMEVVKVLLQANSSIEAKDEDGDAALHYTAFGNQAEIARLLLSKGANVNLLNNSMCTALHIAVNKGFTDVVRVL-TEHSADVNLQDSYGDTPLHDAIAKDFRSIIEILTVVPNIDFTQQNNRGFNLLHHAALKGNKLATEMILSR-ARQLADVKKEDGFSALHLAALNNHRDVAEILVKEGRCDANIRNNRNQTPLQLAVTQGHVALVALLVSEGADVNAEDEEGDTAMHTALSRQQLTNMLSTSEREASALYCRLSSSGLLGNT--ELNVGAAIACFLAQEGADINYANHKGKSPLDLVTDST----TLQLIRSFSEKHRLQQLQAITCGTSSSSSSLRRVHTTPNTMTNLAMPSAPGPSECLICSELALLVLFSPCQHSVACEECAHRMKKCIKCQVTITKKIR 936          

HSP 2 Score: 94.7449 bits (234), Expect = 1.118e-19
Identity = 115/478 (24.06%), Postives = 202/478 (42.26%), Query Frame = 3
Query:  639 GNLSEVLRLVDSVGVNTNL---KGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLL-LKKGADVNAQNNK-------------KITPTMI---------------------AVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLA--------AISGHEK-ILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAM--KVNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKK---ELLEHPVQPSDARSNEAELME-LRQKLKEMEDEKICKICHDRRLKVIFECGHMCCDDCSDNISECHLCSEKILHKIKI 1913
            GN +E+ RL+ S G N NL        L IA N+G  D+V +L E  A++N+ D  GDT LH A+ ++   + ++L +    D   QNN+             K+   MI                     A L   +D+ E+L+     D +I ++   T L LAV    +  V  L++ GAD+   +++   A H A         +S  E+    ++ +     L+ + + +  AAI          C   L +  AD+N  N + ++ L +      L  ++   E      L+     T+   +   +V+ T +   N L M SA G      E L    ++A+ ++ +     +   +    +  C    +K ++            ITKK   +  E    P+   S +  L+E L+ + ++ME+   C IC D ++K++F+CGH  C DCS  +  C +C + I  +I++
Sbjct:  570 GNQAEIARLLLSKGANVNLLNNSMCTALHIAVNKGFTDVVRVLTEHSADVNLQDSYGDTPLHDAIAKDFRSIIEILTVVPNIDFTQQNNRGFNLLHHAALKGNKLATEMILSRARQLADVKKEDGFSALHLAALNNHRDVAEILVKEGRCDANIRNNRNQTPLQLAVTQGHVALVALLVSEGADVNAEDEEGDTAMHTALSRQQLTNMLSTSEREASALYCRLSSSGLLGNTELNVGAAIA---------CF--LAQEGADINYANHKGKSPLDLVTDSTTLQLIRSFSEKHRLQQLQAITCGTSSSSSSLRRVHTTPNTMTN-LAMPSAPGP----SECL-ICSELALLVLFSPCQHSVACEECAHRMKKC----IKCQVT-----------ITKKIRQDQTEVECSPNSDNSEQHNLLEQLQSRYRQMEERITCPICIDNQIKLVFQCGHASCIDCSAALKTCPICRQTIRERIQL 1015          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008505.1 (pep scaffold:Pmarinus_7.0:GL477211:28706:49738:-1 gene:ENSPMAG00000007672.1 transcript:ENSPMAT00000008505.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 156.377 bits (394), Expect = 3.324e-40
Identity = 138/521 (26.49%), Postives = 242/521 (46.45%), Query Frame = 3
Query:  135 DLSTIIKKQKNHGGWNDLMKECLTGPCKLIN-DDGSDATVMGPSGMIYRLNSELLVPFKSVK-------KHKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKSEIVENTELKXXXXXXXXXXXXXXLI----TDERTMRFLVALKTGNLSEVLRLVD--SVGVNTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGA-DIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKY-KADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMK----------VNQTESGFGNFLKMTSALGV-----LGNIGEG-LDKLEDIAIYLIENGASIDIKNNKGKTPLD 1601
            D  T++  Q++HGG++  M      P K+    D  D  V+  +G  Y  N + L+  K  +       +      + LI       L+ +    W + ++  LG+   V+++   GD +++    I+  +P  + +   ++ +L     D + D     +I    TD    + +     GN+  V +LV      +N   +G   L +AA++GH D+   LL+  A+  I D  G+TALH A H N   +  LL+   A VN++N+   T   +A  KG  ++   L   +  D++  DS +++ +H A+  +  E +EAL +    D+   N+  F    LAA  G +  ++  L +   KLV+ QK D FA +H+AA N     + +L+K  ++ +N +    +TAL +A  R ++  V  LV    +LD++D+ GNTALH+ +K          + Q +S        T  L +      G  G G +   E +A +L++ GA++   N +GK P D
Sbjct:  250 DGQTLMVLQQDHGGFSVAMALIAARPGKVAGLIDNGDVLVVYSNGGKYIYNPKCLIKVKMAQCISHLQLRQSFWIVIALIFSPSCIALINDDSINWMKMVKPTLGRVGRVVKVLPSGDLRVALGGHIWNFNPACVSTADPKSLDLAETSEDSAADILKERVILVWDTDLNKKQLISEAAQGNVGNVQKLVQLFPGQINAQQEGRTALHVAAHQGHIDVARALLKAGASTEIGDDKGNTALHYAAHGNEAAMAGLLVSHRARVNSRNHAGRTALHLAARKGYGEVARTL-CEHACDVNTQDSTKNSPIHDAIAENYEEVIEALTSVKTLDLERQNESGFTPLQLAAFKGSKLAVQRILAKS-PKLVDEQKSDGFAPLHLAAYNGRLDVVHILIKQGRSAVNARTCGGQTALMLAAGRGHVDVVFLLVREACKLDVEDEGGNTALHLVLKEADLFSTDCHLLQDDSTIVQIHYATRVLRINRLRDSGLFGAGSIYAGEALACFLVKEGANLRQTNARGKAPFD 768          

HSP 2 Score: 56.225 bits (134), Expect = 2.114e-8
Identity = 86/390 (22.05%), Postives = 156/390 (40.00%), Query Frame = 3
Query:  327 IGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEI-FIVHPKTI----KSEIVENTELKXXXXXXXXXXXXXXLIT----DERTMRFLVALKTGNLSEVLRLVDSVGVNTNLKG----MYPLLIA---------ANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKA-DLNLQNIELRTALHIAV-KRKYLSFVKHLVENKAELDLKDKNGNTALHVA 1424
            +G  V+   D +   +LQ  HG +   M  I  +  +V  +  +GD  + ++N   +I +PK +     ++ + + +L+             S I     D      +V    G +  V++++ S  +   L G      P  ++         A    +   ++L E+   +   D +    +  A   N   +  L+      +NAQ   + T   +A  +G  D+   L+ +  A   IGD   +TALH A + +       L++  A +   N     A HLAA  G+ ++     +   +  VN+Q   K + IH A   N+E  +  L   K  DL  QN    T L +A  K   L+  + L ++   +D +  +G   LH+A
Sbjct:  241 LGDTVRCGVDGQTLMVLQQDHGGFSVAMALIAARPGKVAGLIDNGDVLVVYSNGGKYIYNPKCLIKVKMAQCISHLQLRQSFWIVIALIFSPSCIALINDDSINWMKMVKPTLGRVGRVVKVLPSGDLRVALGGHIWNFNPACVSTADPKSLDLAETSEDSAADILKERVILVWDTDLNKKQLISEAAQGNVGNVQKLVQLFPGQINAQQEGR-TALHVAAHQGHIDVARALLKA-GASTEIGDDKGNTALHYAAHGNEAAMAGLLVSHRARVNSRNHAGRTALHLAARKGYGEVARTLCEHACD--VNTQDSTKNSPIHDAIAENYEEVIEALTSVKTLDLERQNESGFTPLQLAAFKGSKLAVQRILAKSPKLVDEQKSDGFAPLHLA 626          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007446.1 (pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 119.783 bits (299), Expect = 4.583e-28
Identity = 97/350 (27.71%), Postives = 166/350 (47.43%), Query Frame = 3
Query:  711 LLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGF-----GNFLKMTSALGVLG-NIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDARSNEAELM 1742
            L +AA+ GH     +LL+K AN N+   +G T LH+A  +NR ++ +LLLK GA + A     +TP  ++   G+ +I+ L++    A  +  +   +TALH+A  + + E V +LL  GA +    ++     H+AA  G  +I+++ L+       ++   + +  +H+AA   HE    +L+++ A L +   +  T LH+A K   +     L++  A  D   KNG T LHVA   +  +        G     T+  G    +I    D+LE IA  L+E GA  +    +G  PL +            L+ R +  +H TK  L    +   + + N AE++
Sbjct:   76 LHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIV-LILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASP--DAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLE-IATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEIL 421          

HSP 2 Score: 108.997 bits (271), Expect = 1.009e-24
Identity = 73/248 (29.44%), Postives = 120/248 (48.39%), Query Frame = 3
Query:  699 GMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQT 1442
            G  PL +AA EGHED+  +LLE  A++ +  K G T LH+A    + ++  LLL++ A  +A     +TP  +A    +Q +  LL+    A       +  T LH+A    +LE    LL  GA+   + ++     HL A  GH  +  + L R  +  VN   +   + +H+AA  +  +   +L+K+ A +N       T L +A     +  V  L+++ A+++ K KNG T LH A +   T
Sbjct:  237 GYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKV-ALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYAD--VNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHT 481          

HSP 3 Score: 105.145 bits (261), Expect = 1.526e-23
Identity = 83/304 (27.30%), Postives = 139/304 (45.72%), Query Frame = 3
Query:  699 GMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICN 1610
            G+ PL  AA  GHE +V +LLE+ A I    K+G + LH+A   +  +   +L++  A V+      +T   +A   G     ++L+    A+ ++   +  T LH+A   +R+  +E LL  GA I  + +      H++A  G+  I+ I L+  G    N+       A+HMAA       +  L++  A ++ +  E +T LHIA +   L  V+ L+++ A  D    NG T LHVA +                            +  ED+   L+E+GAS+ +   KG TPL + +
Sbjct:    6 GLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLL-DKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQ--GGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAR----------------------------EGHEDVTAILLEHGASLAVTTKKGFTPLHVAS 278          

HSP 4 Score: 95.1301 bits (235), Expect = 1.892e-20
Identity = 81/317 (25.55%), Postives = 155/317 (48.90%), Query Frame = 3
Query:  699 GMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTE------SGFGNFLKMT-SALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDI-CNDNSLK 1625
            G+ P+ ++A  G+ ++V +LL+  A+ N  +  G+TALH+A    + ++   LL+ GA V+A+  ++ TP  IA   G  +I++LL+  + A      S+  T LH+A      +    LL  GA + +  KK F   H+A+  G  ++  + L+R      ++  ++    +H+A+  +++    +L+   A  +       T LHIA K+  L     L+E  AE +   + G   LH+  +    +      + + +    T S L  L ++    DK+ ++A  L+++GA ++     G TPL + C+  ++K
Sbjct:  138 GLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLL-QHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASP--DAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPL-HLAAQEDKV-NVAEILVKHGAHVNATTKLGYTPLIVACHYGNIK 449          

HSP 5 Score: 91.2781 bits (225), Expect = 3.542e-19
Identity = 84/350 (24.00%), Postives = 155/350 (44.29%), Query Frame = 3
Query:  594 ITDERTMRFLVALKTGNLSEVLRLVDSVGVN--TNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAM---KVNQTE--SGFGNFLKMTSALGV--------LGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPL 1598
            +T+       V+   GNL+ VL L+        TN++G   L +AA  G  ++V  LL   A ++   ++  T LH+A    + ++  LLL+  A  +A  +   TP  +A  +G +D+  +L+  + A L++      T LH+A    ++E    LL   A      K      H+A+   ++K+  + L +      ++  ++ +  +H+AA  +       L++Y A+ N    +    LH+  +  +      L+   A+++   K+G + LH+A    KVN  E     G  +  T+ LG          GNI         +  +L+++GA ++ K   G TPL
Sbjct:  134 VTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILL-EHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASP--HATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNI--------KMVNFLLQHGADVNSKTKNGYTPL 472          

HSP 6 Score: 90.8929 bits (224), Expect = 3.927e-19
Identity = 64/231 (27.71%), Postives = 117/231 (50.65%), Query Frame = 3
Query:  669 DSVGVNTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHL 1361
            D+ G N    G+ PL +A++  ++ +  LLL++ A+ +   K+G T LH+A  +++ ++   LL+ GA+ NA   + + P  +   +G  D+  LL+ +  AD++       + LHLA    ++   E L+  GA +    K  +    +A   G+ K++   L+   +  VNS+ ++ +  +H AA   H H + +L+K  A  N   +   TAL IA +  Y+S V  L
Sbjct:  297 DAAGKN----GLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLL-ARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGAD--VNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTL 520          

HSP 7 Score: 77.7962 bits (190), Expect = 5.368e-15
Identity = 64/240 (26.67%), Postives = 108/240 (45.00%), Query Frame = 3
Query: 1113 HLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQ-----------------TESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKE------------------LLEHPVQPSDARSN 1727
            H AA SGHE+++EI L++    L  ++ ++  + +HMA   +H  C+ VLM+Y+A ++   ++  TALH+A    +    K L++  A  +++  NG T LH+A K N+                 TESG    L        +GN+        +I + L++ GAS +  N +G+T L +         + SL+   +Q     ++E                  LL+H   P  A SN
Sbjct:   11 HCAARSGHEQVVEILLEQGAPIL--AKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESG----LTPMHVSAFMGNL--------NIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSN 236          

HSP 8 Score: 48.521 bits (114), Expect = 5.461e-6
Identity = 30/81 (37.04%), Postives = 46/81 (56.79%), Query Frame = 3
Query:  642 NLSEVLRLVDSVGVNTNLK-GMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVN 881
            N++E+L +     VN   K G  PL++A + G+  +VN LL+  A++N   K+G T LH A  +    + +LLLK GA  N
Sbjct:  416 NVAEIL-VKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPN 495          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.087 bits (292), Expect = 2.439e-27
Identity = 82/268 (30.60%), Postives = 134/268 (50.00%), Query Frame = 3
Query:  648 SEVLRLVDSVGVNTNLK---GMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQT 1442
            +E+++L+   G + N     G  PL  A+ EGH D+ +LLLE  A+I+   K G T LH+A    R ++  LLL+K A  + +    +TP  +A     Q +  LL+    +  S   +   T LH+A   ++LE  + LL  GA+  +L ++     HLAA  GH  ++ + L R     ++   +    A+H+AA  +  +   +L K+KAD+N       T LH+A     +  V  L+ N+A ++ K +NG T LH A +   T
Sbjct:  489 AEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGY-TPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHAS--ISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHT 753          

HSP 2 Score: 114.39 bits (285), Expect = 1.446e-26
Identity = 85/302 (28.15%), Postives = 142/302 (47.02%), Query Frame = 3
Query:  702 MYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDIC 1607
            + PL +AA+ GH  +  LLL++    N    +G T LH+A  +NR K+ +LLLK GA ++      +TP  +A   G  ++++LL+  N A  +  +   +T LH+A  + +LE V+ LL +GA + +  ++     H+A+  G  +I+++ L+R  +   N+        ++ A+   H     +L++  AD++    +  T LHIA K   L     L+E  A  D K KNG T LHVA   +                             + +A+ L++ GAS       G TPL I 
Sbjct:  345 LTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLL-QNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDP--NAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDH----------------------------QKVALLLLDKGASPHSTAKNGYTPLHIA 615          

HSP 3 Score: 107.457 bits (267), Expect = 2.125e-24
Identity = 87/344 (25.29%), Postives = 149/344 (43.31%), Query Frame = 3
Query:  687 TNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEK-------------------------------LVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTES-----GFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICN 1610
            T   G  PL IAA+ G+ ++  LLL   A ++   ++G T LH+A       +  LLL +GA ++ +    +TP   A   G + ++E+L+   +A +     +  + LH+A     L  V+ LL   A +  +        H+AA  GH ++ ++ L R GE                                 +++  E     IH+A+   H + + +L++  A  N  N+   T LH+A +   L  VK L+++ A + +K +   T LH+A ++ + E        G+     +A G         +   D+A  L+ENGA I     KG TPL I +
Sbjct:  208 TTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLL-ERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIAS 550          

HSP 4 Score: 101.679 bits (252), Expect = 1.476e-22
Identity = 82/279 (29.39%), Postives = 141/279 (50.54%), Query Frame = 3
Query:  618 FLVALKTGNLSEVL-RLVDSVGVNT-NLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRD------GEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMK 1430
            FL A + GNL  ++  L   + +NT N  G+  L +A+ EGH D+V  LL+++A I+ A K G+TALH+A    +  +  +L++ GA++NAQ+    TP  +A  +   +I++ L+  N A+ S+   D  T L +A+     + V  LL +        K    A H+AA         + L+ +       + ++N   E  F  +H+AA   + +   +L+   A ++       T LH+A KR   + VK L++  A++D K ++G T LH A +
Sbjct:   14 FLRAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLL-DNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTK----GKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAAR 287          

HSP 5 Score: 100.908 bits (250), Expect = 2.575e-22
Identity = 65/221 (29.41%), Postives = 115/221 (52.04%), Query Frame = 3
Query:  699 GMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHL 1361
            G+ PL +A +  H+ +  LLL+K A+ +   K+G T LH+A  +N+ ++  +LL+ GA+ N    + + P  +A  +G  D++ LL+   +A +S+      TA+HLA    ++   E L    AD+    K  +   H+A+  G+ K++   L+     LVN++  + +  +H AA   H H +  L++++A  N       TAL IA +  Y+S V  L
Sbjct:  575 GLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLL-GRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRN--RALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVVDTL 792          

HSP 6 Score: 74.3294 bits (181), Expect = 4.638e-14
Identity = 50/140 (35.71%), Postives = 77/140 (55.00%), Query Frame = 3
Query:  651 EVLRLVDSVGVNTNL---KGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALL 1061
            EV +++  +G  TN+   +G+ PL +AA EGH D+V LLL + A+I++A K G TA+HLA  E++  + ++L K  ADVN       TP  +A   G+  ++  L+  N A ++    +  T LH A        V ALL
Sbjct:  622 EVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLL-RNRALVNAKTRNGYTPLHQAAQQGHTHVVNALL 760          

HSP 7 Score: 66.6254 bits (161), Expect = 1.254e-11
Identity = 45/146 (30.82%), Postives = 78/146 (53.42%), Query Frame = 3
Query:  993 SDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMK 1430
            SD  T+   A  +  LE +   L  G DI   N+   NA HLA+  GH  ++   LKR+ E  +++  +    A+H+AA+      + VL+++ A++N Q+    T L++A +  +L  VK L++N A   +  ++G T L VA++
Sbjct:    8 SDAATSFLRAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAE--IDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQ 151          

HSP 8 Score: 51.9878 bits (123), Expect = 3.973e-7
Identity = 46/161 (28.57%), Postives = 73/161 (45.34%), Query Frame = 3
Query: 1194 KEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTE-----SGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQ 1661
            K D   +   AA N +   L   +K   D+N  N     ALH+A K  ++  V  L++ +AE+D   K GNTALH+A    QT+       FG  +   S  G         +   +I  +L++NGA+  +    G TPL +      +  +  L+E D++
Sbjct:    7 KSDAATSFLRAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTK 167          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 113.62 bits (283), Expect = 2.687e-26
Identity = 83/270 (30.74%), Postives = 133/270 (49.26%), Query Frame = 3
Query:  648 SEVLRLVDSVGVNTNLK---GMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKK--GADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQT 1442
            +E+++L+   G + N     G  PL  A+ EGH D+ +LLLE  A+I+   K G T LH+A    R ++  LLL+K   AD        +TP  +A     Q +  LL+    +  S   +   T LH+A   ++LE  + LL  GA+  +L ++     HLAA  GH  ++ + L R     ++   +    A+H+AA  +  +   +L K+KAD+N       T LH+A     +  V  L+ N+A ++ K +NG T LH A +   T
Sbjct:  482 AEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGY-TPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHAS--ISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHT 748          

HSP 2 Score: 108.227 bits (269), Expect = 1.199e-24
Identity = 84/304 (27.63%), Postives = 142/304 (46.71%), Query Frame = 3
Query:  702 MYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLK--DKNGNTALHVAMKVNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDIC 1607
            + PL +AA+ GH  +  LLL++    N    +G T LH+A  +NR K+ +LLLK GA ++      +TP  +A   G  ++++LL+  N A  +  +   +T LH+A  + +LE V+ LL +GA + +  ++     H+A+  G  +I+++ L+R  +   N+        ++ A+   H     +L++  AD++    +  T LHIA K   L     L+E  A  D K   +NG T LHVA   +                             + +A+ L++ GAS       G TPL I 
Sbjct:  338 LTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLL-QNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDP--NAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDH----------------------------QKVALLLLDKGASPHSTAKNGYTPLHIA 610          

HSP 3 Score: 108.227 bits (269), Expect = 1.379e-24
Identity = 87/344 (25.29%), Postives = 150/344 (43.60%), Query Frame = 3
Query:  687 TNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEK-------------------------------LVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTES-----GFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICN 1610
            T+  G  PL IAA+ G+ ++  LLL   A ++   ++G T LH+A       +  LLL +GA ++ +    +TP   A   G + ++E+L+   +A +     +  + LH+A     L  V+ LL   A +  +        H+AA  GH ++ ++ L R GE                                 +++  E     IH+A+   H + + +L++  A  N  N+   T LH+A +   L  VK L+++ A + +K +   T LH+A ++ + E        G+     +A G         +   D+A  L+ENGA I     KG TPL I +
Sbjct:  201 TSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLL-ERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIAS 543          

HSP 4 Score: 103.605 bits (257), Expect = 3.218e-23
Identity = 93/349 (26.65%), Postives = 160/349 (45.85%), Query Frame = 3
Query:  618 FLVALKTGNLSEVL-RLVDSVGVNT-NLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDS 1658
            FL A + GNL  ++  L   + +NT N  G+  L +A+ EGH D+V  LL+++A I+ A K G+TALH+A    +  +  +L++ GA++NAQ+    TP                                  L++A   + LE V+ LL+ GA+  +  +  F    +A   GHE+++ + L+ D      ++ + +  A+H+AA  +  +   +L++++ + ++ +    T LHIA     ++    L+   A +D   +NG T LHVA K      G  N +K+                       L++ GA ID K   G TPL     +  +  I  L+ERD+
Sbjct:   15 FLRAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTP----------------------------------LYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESD------TKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAK-----RGNNNMVKL-----------------------LLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDA 295          

HSP 5 Score: 100.908 bits (250), Expect = 2.491e-22
Identity = 64/218 (29.36%), Postives = 114/218 (52.29%), Query Frame = 3
Query:  699 GMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFV 1352
            G+ PL +A +  H+ +  LLL+K A+ +   K+G T LH+A  +N+ ++  +LL+ GA+ N    + + P  +A  +G  D++ LL+   +A +S+      TA+HLA    ++   E L    AD+    K  +   H+A+  G+ K++   L+     LVN++  + +  +H AA   H H +  L++++A  N       TAL IA +  Y+S V
Sbjct:  570 GLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLL-GRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRN--RALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVV 784          

HSP 6 Score: 74.7146 bits (182), Expect = 3.579e-14
Identity = 50/140 (35.71%), Postives = 77/140 (55.00%), Query Frame = 3
Query:  651 EVLRLVDSVGVNTNL---KGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALL 1061
            EV +++  +G  TN+   +G+ PL +AA EGH D+V LLL + A+I++A K G TA+HLA  E++  + ++L K  ADVN       TP  +A   G+  ++  L+  N A ++    +  T LH A        V ALL
Sbjct:  617 EVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLL-RNRALVNAKTRNGYTPLHQAAQQGHTHVVNALL 755          

HSP 7 Score: 66.2402 bits (160), Expect = 1.510e-11
Identity = 45/146 (30.82%), Postives = 78/146 (53.42%), Query Frame = 3
Query:  993 SDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMK 1430
            SD  T+   A  +  LE +   L  G DI   N+   NA HLA+  GH  ++   LKR+ E  +++  +    A+H+AA+      + VL+++ A++N Q+    T L++A +  +L  VK L++N A   +  ++G T L VA++
Sbjct:    9 SDAATSFLRAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAE--IDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQ 152          

HSP 8 Score: 51.6026 bits (122), Expect = 5.210e-7
Identity = 40/138 (28.99%), Postives = 65/138 (47.10%), Query Frame = 3
Query: 1263 MKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTE-----SGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQ 1661
            +K   D+N  N     ALH+A K  ++  V  L++ +AE+D   K GNTALH+A    QT+       FG  +   S  G         +   +I  +L++NGA+  +    G TPL +      +  +  L+E D++
Sbjct:   31 LKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTK 168          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Sea Lamprey
Match: ankdd1a (ankyrin repeat and death domain containing 1A [Source:ZFIN;Acc:ZDB-GENE-070615-8])

HSP 1 Score: 110.538 bits (275), Expect = 7.940e-26
Identity = 95/319 (29.78%), Postives = 148/319 (46.39%), Query Frame = 3
Query:  618 FLVALKTGNLSEVLRLVDSVGVNT-NLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQN-----------------------------------NKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYL--LNKKLFN---AYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESG 1451
            F  A K  ++ E+ +L+  V V+  N++    L  AA  G ED V LLLE+KAN++  DK G   L +A      ++   L+  G  V++QN                                   N + TP ++A   G   +LELL+    A   + D +++TA+HLA  S  + S+E LL  G    L  +N +  N   A HLAA  GH + + + L  +    +N+   +   A+HMAA + HE    +L+    D+N  + +  + LH+AV+  Y   V  LVE +A ++L D    TALH+A +    ES 
Sbjct:    7 FHEAAKRNDVDEMEKLLKKVKVDAKNMRDQTALHFAAGSGQEDAVKLLLERKANVDKGDKYGMNPLLIAAWFGHLEVLKRLVNGGGRVSSQNKNGLNILHCAAQRGHVETVKYTLESLEDLGIEGKTNAEKTPYLLAAEYGQLAVLELLMDYKCAQ-DVSDGEKNTAIHLAAKSGHMLSLEHLLEKGPGRTLDFVNSQNANGNTALHLAAEGGHLECVRMLLDCEAICDINALNNESMNALHMAAKHGHEQIAKLLIDETIDINAISTKQASPLHLAVQNNYPIIVTFLVEAEANINLVDCRNQTALHIAAETGFQESA 324          

HSP 2 Score: 70.8626 bits (172), Expect = 3.897e-13
Identity = 63/225 (28.00%), Postives = 114/225 (50.67%), Query Frame = 3
Query:  660 RLVDSVGVNTNLKGMYPLLIAANEGHEDLVNLLLEKKA--NINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRD----GEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTAL 1316
            R +D V  + N  G   L +AA  GH + V +LL+ +A  +IN  + +   ALH+A      ++  LL+ +  D+NA + K+ +P  +AV      I+  L+ +  A++++ D    TALH+A  +   ES + LL AG D+ LL+K+  +   +AA +    ++++ +K D      K+ N+++E+          NN E  L  +  ++ D   +   LR+ L
Sbjct:  195 RTLDFVN-SQNANGNTALHLAAEGGHLECVRMLLDCEAICDINALNNESMNALHMAAKHGHEQIAKLLIDETIDINAISTKQASPLHLAVQNNYPIIVTFLVEAE-ANINLVDCRNQTALHIAAETGFQESADLLLAAGTDLTLLDKQKKSCLEVAARANQVNLVDMIIKADRYFTRRKVRNAKQEEG---------NNEESVLGAVT-FRPDRRAETQHLRSVL 407          

HSP 3 Score: 67.3958 bits (163), Expect = 5.439e-12
Identity = 79/300 (26.33%), Postives = 132/300 (44.00%), Query Frame = 3
Query:  810 LHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDL-----KDKNGNTALHVAMKVNQTESGFGNFLKMTSALGVLGNIG----EGLDKL--------EDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDS 1658
             H A   N     + LLKK   V+A+N +  T    A   G +D ++LL+    A++  GD      L +A     LE ++ L+N G  +   NK   N  H AA  GH + ++  L+   +  +  +   +     +AA       L +LM YK   ++ + E  TA+H+A K  ++  ++HL+E      L     ++ NGNTALH+A      E G    ++M      + +I     E ++ L        E IA  LI+    I+  + K  +PL +   N+    +  LVE ++
Sbjct:    7 FHEAAKRNDVDEMEKLLKK-VKVDAKNMRDQTALHFAAGSGQEDAVKLLL-ERKANVDKGDKYGMNPLLIAAWFGHLEVLKRLVNGGGRVSSQNKNGLNILHCAAQRGHVETVKYTLESLEDLGIEGKTNAEKTPYLLAAEYGQLAVLELLMDYKCAQDVSDGEKNTAIHLAAKSGHMLSLEHLLEKGPGRTLDFVNSQNANGNTALHLA-----AEGGHLECVRMLLDCEAICDINALNNESMNALHMAAKHGHEQIAKLLIDETIDINAISTKQASPLHLAVQNNYPIIVTFLVEAEA 299          

HSP 4 Score: 56.9954 bits (136), Expect = 1.019e-8
Identity = 46/166 (27.71%), Postives = 84/166 (50.60%), Query Frame = 3
Query:  624 VALKTGNLSEVLRLVDSVGV----NTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNA 1109
            +A + G+L  V  L+D   +      N + M  L +AA  GHE +  LL+++  +IN       + LHLAV  N   +   L++  A++N  + +  T   IA   G Q+  +LL+ +   DL++ D  + + L +A  ++++  V+ ++   AD Y   +K+ NA
Sbjct:  213 LAAEGGHLECVRMLLDCEAICDINALNNESMNALHMAAKHGHEQIAKLLIDETIDINAISTKQASPLHLAVQNNYPIIVTFLVEAEANINLVDCRNQTALHIAAETGFQESADLLLAAGT-DLTLLDKQKKSCLEVAARANQVNLVDMIIK--ADRYFTRRKVRNA 375          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Yeast
Match: AVO2 (Component of a complex containing the Tor2p kinase and other proteins; complex may have a role in regulation of cell growth [Source:SGD;Acc:S000004672])

HSP 1 Score: 61.6178 bits (148), Expect = 1.548e-10
Identity = 50/162 (30.86%), Postives = 87/162 (53.70%), Query Frame = 3
Query:  918 AVLKGSQDILELLITSNNADLSIGDSDRD-TALHLAVNSSRLESVEALLNAGADIYLLNK--KLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKD 1394
            A+++G+  I++ L+  N   L+  DS+   ++LH A    R      L+  G D + L K  K     HLA + GHE+ L + L++   + +N + E+  A IH+A MN++  CL +L+   ADL + +    T LH+ ++   +S +K L+ N+ E+ L D
Sbjct:   12 AIIEGNLLIVKRLLRRNPDLLTNIDSENGWSSLHYASYHGRYLICVYLIQLGHDKHELIKTFKGNTCVHLALMKGHEQTLHLLLQQ-FPRFINHRGENGRAPIHIACMNDYYQCLSLLIGVGADLWVMDTNGDTPLHVCLEYGSISCMKMLL-NEGEVSLDD 171          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Yeast
Match: AKR2 (Ankyrin repeat-containing protein; member of a family of putative palmitoyltransferases containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain; possibly involved in constitutive endocytosis of Ste3p; AKR2 has a paralog, AKR1, that arose from the whole genome duplication [Source:SGD;Acc:S000005560])

HSP 1 Score: 57.7658 bits (138), Expect = 4.493e-9
Identity = 57/210 (27.14%), Postives = 96/210 (45.71%), Query Frame = 3
Query:  618 FLVALKTGNLSEVLRLVDSVGVNTN------LKGMYPLLIAANEGHEDLVNLLLEKKANIN-IADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLIT-----SNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKIL-EIFLKRDGEKLVNSQKEDKF 1208
            F+ A K G+L  V  +V+S  V+ N      L G++    A       +   LL + AN N  A   G TALH A       + DLLLK GAD   ++ + +     +V   +  ++  ++      ++N D+   D++  T L  A       +VE LL  G+ +   + + FNA H A + G ++++ ++ L        N+QK+D F
Sbjct:   54 FIEAAKDGDLKVVKDVVESGAVDINNDRIDELSGLH---WACINNRFSVAKFLLLRGANPNQAAGPGGATALHWAARYGNIYIVDLLLKHGADPTLKDEQGLNIMHFSVYSSNILLVVYVLYFVVNNNDNVDIDSKDNNNRTPLLWAAYQGDFLTVELLLKFGSTVAWTDNRGFNALHCALVGGDQRVICDLILSGANFYERNNQKQDCF 260          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Yeast
Match: AKR1 (Palmitoyl transferase involved in protein palmitoylation; acts as a negative regulator of pheromone response pathway; required for endocytosis of pheromone receptors; involved in cell shape control; contains ankyrin repeats; AKR1 has a paralog, AKR2, that arose from the whole genome duplication; any of several human homologs encoding DHHC-type zinc fingers (ZDHHC) can complement temperature sensitivity of yeast akr1 null mutant [Source:SGD;Acc:S000002672])

HSP 1 Score: 56.225 bits (134), Expect = 1.105e-8
Identity = 57/227 (25.11%), Postives = 94/227 (41.41%), Query Frame = 3
Query:  786 ADKDGD-----TALHLAVHENRFKLCDLLLKKGADVNAQNNK-KITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTES 1448
             + DGD     T LH A   NR  + D L+ +GADVNA+      TP   A   G   I++ L+  + AD ++ D      LHL+VNSS             +I L+   LFN          + +L+I          + +      ++  AA       +  L+K+ A + + + E  T LH    +     +K+L+++ A+   K   G     +A ++N   S
Sbjct:  100 VNNDGDSTEHITGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLL-KHGADPTMTDDQGFNLLHLSVNSS-------------NIMLVLYVLFNVV-------SKGLLDI----------DCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGKDCFAIAQEMNTVYS 295          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Yeast
Match: HOS4 (Subunit of the Set3 complex; complex is a meiotic-specific repressor of sporulation specific genes that contains deacetylase activity; potential Cdc28p substrate [Source:SGD;Acc:S000001374])

HSP 1 Score: 48.521 bits (114), Expect = 3.478e-6
Identity = 35/106 (33.02%), Postives = 60/106 (56.60%), Query Frame = 3
Query:  678 GVNTNLKGMYPLLIAANEGHEDLVNLLLEKKA-NINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKI--TPTMIAVLKGSQDILELLITSNNADLSI 986
            G+  +  G   L IA ++G  D+V  ++E+   +IN  D  G+TALH A  +   ++ +LL++ GADVN ++ +    TP + A   G  D+++ L+  N AD +I
Sbjct:  323 GIYRDSGGRTRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLL-KNGADPTI 427          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Nematostella
Match: EDO39113 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB41])

HSP 1 Score: 75.485 bits (184), Expect = 8.389e-16
Identity = 50/161 (31.06%), Postives = 80/161 (49.69%), Query Frame = 3
Query:  699 GMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALH------LAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLK 1163
            G  PL  A    H D+V +LL+  A++++    G  ++        A   N  + C +LL+ GADVN  N    T    A  +G   ++ELL+     D+++ D D  T+LH+A        ++ LL  GA+I   +   F A+HLAA  G E++L+  L+
Sbjct:   29 GFSPLHYATTTNHVDIVQMLLDAGADVDVR---GSPSIQRIPPIICAAKFNAIESCRVLLRAGADVNITNCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDNDGFTAFHLAAREGEEEVLQTLLR 186          

HSP 2 Score: 68.9366 bits (167), Expect = 1.759e-13
Identity = 54/188 (28.72%), Postives = 91/188 (48.40%), Query Frame = 3
Query:  720 AANEGHEDLVNLLLEKK-ANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNN---KKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGA-DIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMK 1268
            A  +G +D V  LL     N+N  D DG + LH A   N   +  +LL  GADV+ + +   ++I P + A    + +   +L+ +  AD++I +    TALH A      + VE LL  G  D+ ++++    + H+AA+ G   I++  L       + ++  D F A H+AA    E  L  L++
Sbjct:    2 ACRDGRKDCVRKLLRGNLTNLNTLDADGFSPLHYATTTNHVDIVQMLLDAGADVDVRGSPSIQRIPPIICAAKFNAIESCRVLLRA-GADVNITNCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGAN--ITAKDNDGFTAFHLAAREGEEEVLQTLLR 186          

HSP 3 Score: 61.6178 bits (148), Expect = 5.058e-11
Identity = 44/152 (28.95%), Postives = 77/152 (50.66%), Query Frame = 3
Query:  636 TGNLSEVLRLVDSVGVNTNLKG------MYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGA-DVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAG 1070
            T N  ++++++   G + +++G      + P++ AA     +   +LL   A++NI +  G TALH A      K+ +LLL+ G  DVN  +    T   +A + GS  I++ L+    A+++  D+D  TA HLA      E ++ LL  G
Sbjct:   38 TTNHVDIVQMLLDAGADVDVRGSPSIQRIPPIICAAKFNAIESCRVLLRAGADVNITNCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCG-ANITAKDNDGFTAFHLAAREGEEEVLQTLLRTG 188          

HSP 4 Score: 50.0618 bits (118), Expect = 4.949e-7
Identity = 44/174 (25.29%), Postives = 76/174 (43.68%), Query Frame = 3
Query:  918 AVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADI------------YLLNKKLFN------------------------AYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVK 1331
            A   G +D +  L+  N  +L+  D+D  + LH A  ++ ++ V+ LL+AGAD+             ++    FN                        A H A   GH K++E+ L RDG+  VN    D   ++H+AAM      +  L+   A++  ++ +  TA H+A +
Sbjct:    2 ACRDGRKDCVRKLLRGNLTNLNTLDADGFSPLHYATTTNHVDIVQMLLDAGADVDVRGSPSIQRIPPIICAAKFNAIESCRVLLRAGADVNITNCYGQTALHHATRRGHSKMVELLL-RDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDNDGFTAFHLAAR 174          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Nematostella
Match: EDO49485 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG84])

HSP 1 Score: 73.559 bits (179), Expect = 8.830e-15
Identity = 64/211 (30.33%), Postives = 104/211 (49.29%), Query Frame = 3
Query:  810 LHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHE-KILEIFLKRDGEKLVNSQKEDK--FAAIHMAAMNNHEHCLPVLMKYKAD--LNLQN-IELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVA 1424
            LHLA      + C  LL  G DVNA++N   TP   A   G+ + LELL+ S   D +  D      LH A   +    V +L+ AG+++   + K     H AA S  + K +E  L+  G    N+ K DK  ++A+H A+ N H+  + +L+   A+  LN  +     T LH+A    +   ++ L+++  +L+++D  G T L +A
Sbjct:    4 LHLACLGGFTECCKKLLFYGVDVNAKDNNDRTPLHCAACSGNVNCLELLM-SQAGDFNCIDKLGRNPLHYAAGHTNFRCVMSLVTAGSNVNKPDTKACTPLHYAAASDLDAKCVEHLLRNRG----NASKRDKQGYSAVHYASANGHKLAIEMLLDVSANDLLNRSSGSPCVTPLHLAAFHGHKPALEVLIKSFNDLEVRDDRGRTPLDLA 209          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Nematostella
Match: EDO38725 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC11])

HSP 1 Score: 68.5514 bits (166), Expect = 4.428e-13
Identity = 49/174 (28.16%), Postives = 87/174 (50.00%), Query Frame = 3
Query:  708 PLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAA 1229
            PL +A  +G  ++  LL+EK A ++  +  G+T LH+A     F     LL KG  ++ ++    TP + AV  G  +   LL+          D ++ + LHLA  + R   VEAL  AG      +++  +A H+AA+SG  K++   L+   +  +N++  +++  +  AA
Sbjct:   39 PLHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPFLSAVAAGRTENAMLLLEK--------DENQKSPLHLACAAGRALHVEALTRAGLSTNERDEEGQSALHMAALSGFRKVVTQLLRYGAD--INARDSNRWTPLMCAA 202          

HSP 2 Score: 50.8322 bits (120), Expect = 4.002e-7
Identity = 53/226 (23.45%), Postives = 100/226 (44.25%), Query Frame = 3
Query:  777 INIADKDGDTALHLAVHENRFKLCDLLLKKGA--DVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTES 1448
            +N  D  G +ALH A   NR +    L++ G+  D++       TP  +A  KGS ++  LL+    A L   +   +T LH+A      ++++ LL+ G  I   +      +  A  +G  +   + L++D         E++ + +H+A        +  L +     N ++ E ++ALH+A    +   V  L+   A+++ +D N  T L  A K    ++
Sbjct:    1 LNKMDDTGFSALHHATRYNRVEAMAELIRNGSIEDLS-------TPLHVACKKGSMEVGRLLV-EKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPFLSAVAAGRTENAMLLLEKD---------ENQKSPLHLACAAGRALHVEALTRAGLSTNERDEEGQSALHMAALSGFRKVVTQLLRYGADINARDSNRWTPLMCAAKTGSVKT 209          

HSP 3 Score: 49.6766 bits (117), Expect = 1.150e-6
Identity = 37/114 (32.46%), Postives = 57/114 (50.00%), Query Frame = 3
Query:  618 FLVALKTGNLSEVLRLVDSVGVNTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGS-QDILELL 956
            FL A+  G     + L++    + N K   PL +A   G    V  L     + N  D++G +ALH+A      K+   LL+ GAD+NA+++ + TP M A   GS +  +ELL
Sbjct:  106 FLSAVAAGRTENAMLLLEK---DENQKS--PLHLACAAGRALHVEALTRAGLSTNERDEEGQSALHMAALSGFRKVVTQLLRYGADINARDSNRWTPLMCAAKTGSVKTCMELL 214          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Nematostella
Match: EDO38702 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC57])

HSP 1 Score: 70.0922 bits (170), Expect = 1.243e-12
Identity = 64/241 (26.56%), Postives = 104/241 (43.15%), Query Frame = 3
Query:  744 LVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSS-------RLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTE 1445
            ++  ++  +A I   DKD DT L +A  +N       LL+ GAD+ A++         A  +G  + LE  +       +I D   D  L+  V  S       R+ S + LL+ GA I   N +     H AA  G  + +   LKRD   ++N +       +H+AA++ H   +  L+     ++ +N  L T L  A  R  +     L++  A +D  DK   T LH+A +    E
Sbjct:  162 IICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPVWTICD---DVCLNGLVGGSNKLILVLRISS-QLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRD-PAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVE 397          

HSP 2 Score: 63.1586 bits (152), Expect = 1.815e-10
Identity = 62/248 (25.00%), Postives = 101/248 (40.73%), Query Frame = 3
Query:  708 PLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHEN--------------RFKLCD-----------------------LLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKY 1340
            PL+IAA + H D V  LL+  A+I   D +   ++  A  E                + +CD                       LLL  GA ++++N++ ITP   A   G    +  L+  + A ++  D   +T LHLA        V+ LL  G  I   N  L+     AA  G  ++  I L  D    V+   + K   +H+A+   H   + +L+  KA++ L +   R  L IA++  +
Sbjct:  183 PLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPVWTICDDVCLNGLVGGSNKLILVLRISSQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAP--VDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESSH 428          

HSP 3 Score: 60.4622 bits (145), Expect = 1.141e-9
Identity = 63/303 (20.79%), Postives = 134/303 (44.22%), Query Frame = 3
Query:  804 TALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITS-------NNADLSIGDSDRD--TALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTES---------GFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDS 1658
            T LH+A       +   L++ GAD+ + + +++TP   A ++G+  + +LL  +       +     + D DR+  TALHLAV     +  +  L  GA++  + +     +H   +   E I  + +K    K ++  K +K     +    +    +  +++++A +  ++ +  T L IA ++ ++  V+ L+++ A++  KD N   ++  A      E+                     G++G   + +  L   +  L++NGA ID KN++  TP+           + +L++RD 
Sbjct:    6 TPLHVACSHGCIPVAKCLVEAGADLRSLDEEQMTPLHFACMEGNLGVAKLLFVAAELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFHKTIVVARECIF-VMIKVSKLKYLSFCKSEKIKREILLYFFDVVIIICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPVWTICDDVCLNGLVGGSNKLILVLRISSQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDP 307          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Nematostella
Match: EDO43690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXV8])

HSP 1 Score: 67.3958 bits (163), Expect = 3.216e-12
Identity = 61/228 (26.75%), Postives = 115/228 (50.44%), Query Frame = 3
Query:  618 FLVALKTGNLSEVLRLV-DSVGVN-TNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQN 1295
            FL A+ +G++ EV +L+     +N  N+ G+  L  A  + + DLV +L++K A++++ D +G T+LH A      ++   L++ GADV A NN+   P  +A  +  +D+L   I +   D+   D  R     + +N ++    +  +N   D     K   +A H+A+  G+ K++ + L+   E  +N++  D +  +H AA    +    +L +  AD N +N
Sbjct:   53 FLSAVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIENQGIDV---DDARAVEEKIMLNDAQSWLNKNCINESKD-----KTEASALHVASSKGYLKVIGLLLQLGVE--INAKDADNWTPLHAAAHWGQKDACELLSENGADFNARN 270          

HSP 2 Score: 63.1586 bits (152), Expect = 7.663e-11
Identity = 45/155 (29.03%), Postives = 70/155 (45.16%), Query Frame = 3
Query: 1260 LMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDARS 1724
            L+   AD+N QN++  TALH A   +    VK LV+  A +D++D  G T+LH A      E                            IA YLIENGA +   NN+G+ PLD+  +  ++  +   +E  +Q   +     +E  +  +DA+S
Sbjct:   68 LLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVE----------------------------IAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIE--NQGIDVDDARAVEEKIMLNDAQS 192          

HSP 3 Score: 50.8322 bits (120), Expect = 6.712e-7
Identity = 49/198 (24.75%), Postives = 97/198 (48.99%), Query Frame = 3
Query:  855 LLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTES 1448
            LL KGAD+N QN   +T    A +  + D++++L+    A + + D++  T+LH A +   +E  + L+  GAD+  +N +      LA     E +L   ++  G  + +++  ++   ++ A    +++C+    K K +         +ALH+A  + YL  +  L++   E++ KD +  T LH A    Q ++
Sbjct:   68 LLAKGADINYQNVDGLTALHQACIDENFDLVKVLV-DKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIENQGIDVDDARAVEEKIMLNDAQSWLNKNCINE-SKDKTEA--------SALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDA 255          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Medaka
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:101158637])

HSP 1 Score: 259.996 bits (663), Expect = 1.605e-74
Identity = 189/630 (30.00%), Postives = 304/630 (48.25%), Query Frame = 3
Query:  135 DLSTIIKKQKNHGGWNDLMKECLTGPCKLIN-DDGSDATVMGPSGMIYRLNSELLVPFKSVK-------------KHKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKSEIVENTELKXXXXXXXXXXXXXXLITDER---TMRFLVALKTGNLSEV---LRLVDSVGVNTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKR-DGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLM-KYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSALGV-------------LGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDARSNEAELMELRQKLKEMEDEKICKICHDRRLKVIF-ECGHMC-CDDCSDNISECHLCSEKILHKIKI 1913
            DL  +   Q  HGGW D M E LT    +   D+  D  V  PSG  +  N  +L     V+             +  +G  VQ+  D +  KLLQ  HGEW E M   LGK   V QI+ D D K+      +  +P  +       + + +   +       +   T E        + A   G+L++V   L+  D V VN    G   +  A+  GH D++ LLL+   ++   DKDGD A+H A   +   + ++L + GAD+NA+N ++ TP  IAV KG   +++ L+       S+ DS+ DT LH A++  R + +  LL AGAD+ + N   FNA H AA+ G+   + + L +     +V+ +K+D + A+H+AA+NNH     +L+ +  A L++QN+  +TALH+AV+R++   V+ LV  +A+LD++DK+G+T LH A++ + T S       M     V             LG  G        IA +L  NGA + I+N KG++PLD+C D +L  + L+   ++     +  +        PS           L   ++ +E+   C +C D +   +F  CGH+  C  CS  + +C +C E++  + KI
Sbjct:  258 DLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGEVAAGAEGGSSQFHVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKIAPSGSAVSNASGERLSQLLKKLFETQESGDINEELVKAAANGDLAKVEDILKRPD-VDVNGQCAGHTAMQAASQNGHVDVLKLLLKHNVDLEAEDKDGDRAVHHAAFGDEGSVIEVLQRGGADLNARNKRRQTPLHIAVNKGHLQVVKTLL-DFGCHPSLQDSEGDTPLHDAISKKRDDMLSVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNASLDIQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDVQDKDGDTPLHEALR-HHTLSQLRQLQDMQDVSKVEPWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLTIRNKKGQSPLDLCPDPNL-CKALAKCHKEKSSGQVGTRS-------PS-----------LNSNMESLEE---CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 862          

HSP 2 Score: 56.6102 bits (135), Expect = 7.353e-8
Identity = 22/59 (37.29%), Postives = 40/59 (67.80%), Query Frame = 3
Query: 1731 AELMELRQKLKEMEDEKICKICHDRRLKVIFECGHMCCDDCSDNISECHLCSEKILHKI 1907
            A++ +L+Q+L++++++ +C +C DR   +IF CGH  C  C D +SEC +C + I  +I
Sbjct:  959 ADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRI 1017          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Medaka
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:101158637])

HSP 1 Score: 260.381 bits (664), Expect = 2.136e-74
Identity = 189/630 (30.00%), Postives = 304/630 (48.25%), Query Frame = 3
Query:  135 DLSTIIKKQKNHGGWNDLMKECLTGPCKLIN-DDGSDATVMGPSGMIYRLNSELLVPFKSVK-------------KHKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKSEIVENTELKXXXXXXXXXXXXXXLITDER---TMRFLVALKTGNLSEV---LRLVDSVGVNTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKR-DGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLM-KYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSALGV-------------LGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDARSNEAELMELRQKLKEMEDEKICKICHDRRLKVIF-ECGHMC-CDDCSDNISECHLCSEKILHKIKI 1913
            DL  +   Q  HGGW D M E LT    +   D+  D  V  PSG  +  N  +L     V+             +  +G  VQ+  D +  KLLQ  HGEW E M   LGK   V QI+ D D K+      +  +P  +       + + +   +       +   T E        + A   G+L++V   L+  D V VN    G   +  A+  GH D++ LLL+   ++   DKDGD A+H A   +   + ++L + GAD+NA+N ++ TP  IAV KG   +++ L+       S+ DS+ DT LH A++  R + +  LL AGAD+ + N   FNA H AA+ G+   + + L +     +V+ +K+D + A+H+AA+NNH     +L+ +  A L++QN+  +TALH+AV+R++   V+ LV  +A+LD++DK+G+T LH A++ + T S       M     V             LG  G        IA +L  NGA + I+N KG++PLD+C D +L  + L+   ++     +  +        PS           L   ++ +E+   C +C D +   +F  CGH+  C  CS  + +C +C E++  + KI
Sbjct:  258 DLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGEVAAGAEGGSSQFHVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKIAPSGSAVSNASGERLSQLLKKLFETQESGDINEELVKAAANGDLAKVEDILKRPD-VDVNGQCAGHTAMQAASQNGHVDVLKLLLKHNVDLEAEDKDGDRAVHHAAFGDEGSVIEVLQRGGADLNARNKRRQTPLHIAVNKGHLQVVKTLL-DFGCHPSLQDSEGDTPLHDAISKKRDDMLSVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNASLDIQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDVQDKDGDTPLHEALR-HHTLSQLRQLQDMQDVSKVEPWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLTIRNKKGQSPLDLCPDPNL-CKALAKCHKEKSSGQVGTRS-------PS-----------LNSNMESLEE---CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 862          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Medaka
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:101175479])

HSP 1 Score: 238.81 bits (608), Expect = 2.146e-67
Identity = 188/623 (30.18%), Postives = 308/623 (49.44%), Query Frame = 3
Query:  159 QKNHGGWNDLMKE--CLTGPCKLINDDGSDATVMGPSGMIYRLNSELLVPFKSVKKHKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKSEIV---------ENTELKXXXXXXXXXXXXXXLITDERTMRFLVALKTGNLSEVLRLVDSVGVNTNLK--GMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGA-DIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKY-KADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQ--------------TESGFGNFLKMT-----SALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDA---RSNEAELMELRQKLKEMEDEKICKICHDRRLKVIF-ECGH-MCCDDCSDNISECHLCSEKILHKIK 1910
            Q+ HGGWN  M E  C  G    I D G D  V   + + +  +   L     V    +G  V+++ + E  K LQ  HGEW + M  +LG+  +V++++ DGD +++   + +  +P  + ++ V         EN            +         +   R ++    G+  +V  LV       ++K  G   L +AA++GH ++V  LL+   ++ + D+DGDTALH A   N+ ++  LLL KGA+VN  NN   T   IAV KG  D++ +L T ++AD+++ DS  DT LH A+       +E L+   + D    N + FN  H AA+ G++   E  L R   +LV+ +K+D F+A+H+AA+NNH     VL+K  + D+N++N   +TAL +AV + +   V+ LV+  A+++++D++G+TA+HVA+   Q              TE         T     S+ G+LGN GE L     IA +L + GA I+  N+KGK+PLD+  D+      L L++  S+KH + + + +      S A   R +          L        C IC +  L V+F  C H + C++C+  + +C  C   I  KI+
Sbjct:  268 QEGHGGWNPKMAEYICRIGTVHRITDRG-DVRVQYSNNIRWTFHPGALT---KVNTFGVGELVRVLDEVETVKRLQAGHGEWTDSMTPVLGQVGKVLKVYADGDLRVAFGGQTWTFNPACLSAQPVDVDANLMTTENPNESGSTVISVLEKLLSQSTEQDNPCRLVIEAAHGSAVKVRELVQKHPDKVDIKNQGKTALQVAAHQGHMEVVKALLQANCSVEVKDEDGDTALHYAAFGNQAEIARLLLSKGANVNLLNNSMCTALHIAVNKGFTDVVRVL-TEHSADVNLQDSYGDTPLHDAIAKDFRSIIEMLVVVPSIDFTQQNHRGFNLLHHAALKGNKLATEKILAR-ARQLVDVKKDDGFSALHLAALNNHRDVAEVLVKEGRCDINVRNNRNQTALQLAVTQGHTELVQLLVDEGADVNMEDEDGDTAMHVALLRPQLANVMLSPAVGTGATEDNSEGCSPTTLHGRLSSSGLLGN-GE-LSVGTAIACFLAQEGADINYANHKGKSPLDLLADSG----ALQLIKSFSEKHRLQRLQAITCGQGLSSASLRRVHTTPNTMTNLVLPTPPGPSECLICSELALLVLFCPCQHSVACEECAHRMKKCIKCQVTITKKIR 878          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Medaka
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:101175479])

HSP 1 Score: 239.58 bits (610), Expect = 2.672e-67
Identity = 188/623 (30.18%), Postives = 308/623 (49.44%), Query Frame = 3
Query:  159 QKNHGGWNDLMKE--CLTGPCKLINDDGSDATVMGPSGMIYRLNSELLVPFKSVKKHKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKSEIV---------ENTELKXXXXXXXXXXXXXXLITDERTMRFLVALKTGNLSEVLRLVDSVGVNTNLK--GMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGA-DIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKY-KADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQ--------------TESGFGNFLKMT-----SALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDA---RSNEAELMELRQKLKEMEDEKICKICHDRRLKVIF-ECGH-MCCDDCSDNISECHLCSEKILHKIK 1910
            Q+ HGGWN  M E  C  G    I D G D  V   + + +  +   L     V    +G  V+++ + E  K LQ  HGEW + M  +LG+  +V++++ DGD +++   + +  +P  + ++ V         EN            +         +   R ++    G+  +V  LV       ++K  G   L +AA++GH ++V  LL+   ++ + D+DGDTALH A   N+ ++  LLL KGA+VN  NN   T   IAV KG  D++ +L T ++AD+++ DS  DT LH A+       +E L+   + D    N + FN  H AA+ G++   E  L R   +LV+ +K+D F+A+H+AA+NNH     VL+K  + D+N++N   +TAL +AV + +   V+ LV+  A+++++D++G+TA+HVA+   Q              TE         T     S+ G+LGN GE L     IA +L + GA I+  N+KGK+PLD+  D+      L L++  S+KH + + + +      S A   R +          L        C IC +  L V+F  C H + C++C+  + +C  C   I  KI+
Sbjct:  337 QEGHGGWNPKMAEYICRIGTVHRITDRG-DVRVQYSNNIRWTFHPGALT---KVNTFGVGELVRVLDEVETVKRLQAGHGEWTDSMTPVLGQVGKVLKVYADGDLRVAFGGQTWTFNPACLSAQPVDVDANLMTTENPNESGSTVISVLEKLLSQSTEQDNPCRLVIEAAHGSAVKVRELVQKHPDKVDIKNQGKTALQVAAHQGHMEVVKALLQANCSVEVKDEDGDTALHYAAFGNQAEIARLLLSKGANVNLLNNSMCTALHIAVNKGFTDVVRVL-TEHSADVNLQDSYGDTPLHDAIAKDFRSIIEMLVVVPSIDFTQQNHRGFNLLHHAALKGNKLATEKILAR-ARQLVDVKKDDGFSALHLAALNNHRDVAEVLVKEGRCDINVRNNRNQTALQLAVTQGHTELVQLLVDEGADVNMEDEDGDTAMHVALLRPQLANVMLSPAVGTGATEDNSEGCSPTTLHGRLSSSGLLGN-GE-LSVGTAIACFLAQEGADINYANHKGKSPLDLLADSG----ALQLIKSFSEKHRLQRLQAITCGQGLSSASLRRVHTTPNTMTNLVLPTPPGPSECLICSELALLVLFCPCQHSVACEECAHRMKKCIKCQVTITKKIR 947          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Medaka
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:101175479])

HSP 1 Score: 239.58 bits (610), Expect = 3.421e-67
Identity = 188/623 (30.18%), Postives = 308/623 (49.44%), Query Frame = 3
Query:  159 QKNHGGWNDLMKE--CLTGPCKLINDDGSDATVMGPSGMIYRLNSELLVPFKSVKKHKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKSEIV---------ENTELKXXXXXXXXXXXXXXLITDERTMRFLVALKTGNLSEVLRLVDSVGVNTNLK--GMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGA-DIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKY-KADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQ--------------TESGFGNFLKMT-----SALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDA---RSNEAELMELRQKLKEMEDEKICKICHDRRLKVIF-ECGH-MCCDDCSDNISECHLCSEKILHKIK 1910
            Q+ HGGWN  M E  C  G    I D G D  V   + + +  +   L     V    +G  V+++ + E  K LQ  HGEW + M  +LG+  +V++++ DGD +++   + +  +P  + ++ V         EN            +         +   R ++    G+  +V  LV       ++K  G   L +AA++GH ++V  LL+   ++ + D+DGDTALH A   N+ ++  LLL KGA+VN  NN   T   IAV KG  D++ +L T ++AD+++ DS  DT LH A+       +E L+   + D    N + FN  H AA+ G++   E  L R   +LV+ +K+D F+A+H+AA+NNH     VL+K  + D+N++N   +TAL +AV + +   V+ LV+  A+++++D++G+TA+HVA+   Q              TE         T     S+ G+LGN GE L     IA +L + GA I+  N+KGK+PLD+  D+      L L++  S+KH + + + +      S A   R +          L        C IC +  L V+F  C H + C++C+  + +C  C   I  KI+
Sbjct:  393 QEGHGGWNPKMAEYICRIGTVHRITDRG-DVRVQYSNNIRWTFHPGALT---KVNTFGVGELVRVLDEVETVKRLQAGHGEWTDSMTPVLGQVGKVLKVYADGDLRVAFGGQTWTFNPACLSAQPVDVDANLMTTENPNESGSTVISVLEKLLSQSTEQDNPCRLVIEAAHGSAVKVRELVQKHPDKVDIKNQGKTALQVAAHQGHMEVVKALLQANCSVEVKDEDGDTALHYAAFGNQAEIARLLLSKGANVNLLNNSMCTALHIAVNKGFTDVVRVL-TEHSADVNLQDSYGDTPLHDAIAKDFRSIIEMLVVVPSIDFTQQNHRGFNLLHHAALKGNKLATEKILAR-ARQLVDVKKDDGFSALHLAALNNHRDVAEVLVKEGRCDINVRNNRNQTALQLAVTQGHTELVQLLVDEGADVNMEDEDGDTAMHVALLRPQLANVMLSPAVGTGATEDNSEGCSPTTLHGRLSSSGLLGN-GE-LSVGTAIACFLAQEGADINYANHKGKSPLDLLADSG----ALQLIKSFSEKHRLQRLQAITCGQGLSSASLRRVHTTPNTMTNLVLPTPPGPSECLICSELALLVLFCPCQHSVACEECAHRMKKCIKCQVTITKKIR 1003          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Planmine SMEST
Match: SMESG000031930.1 (SMESG000031930.1)

HSP 1 Score: 1206.82 bits (3121), Expect = 0.000e+0
Identity = 613/613 (100.00%), Postives = 613/613 (100.00%), Query Frame = 3
Query:   78 MGANISSFDIRKKVVIANQDLSTIIKKQKNHGGWNDLMKECLTGPCKLINDDGSDATVMGPSGMIYRLNSELLVPFKSVKKHKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKSEIVENTELKXXXXXXXXXXXXXXLITDERTMRFLVALKTGNLSEVLRLVDSVGVNTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDARSNEAELMELRQKLKEMEDEKICKICHDRRLKVIFECGHMCCDDCSDNISECHLCSEKILHKIKIN 1916
            MGANISSFDIRKKVVIANQDLSTIIKKQKNHGGWNDLMKECLTGPCKLINDDGSDATVMGPSGMIYRLNSELLVPFKSVKKHKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKSEIVENTELKSDDSDDSDDSNDRSLITDERTMRFLVALKTGNLSEVLRLVDSVGVNTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDARSNEAELMELRQKLKEMEDEKICKICHDRRLKVIFECGHMCCDDCSDNISECHLCSEKILHKIKIN
Sbjct:    1 MGANISSFDIRKKVVIANQDLSTIIKKQKNHGGWNDLMKECLTGPCKLINDDGSDATVMGPSGMIYRLNSELLVPFKSVKKHKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKSEIVENTELKSDDSDDSDDSNDRSLITDERTMRFLVALKTGNLSEVLRLVDSVGVNTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDARSNEAELMELRQKLKEMEDEKICKICHDRRLKVIFECGHMCCDDCSDNISECHLCSEKILHKIKIN 613          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Planmine SMEST
Match: SMESG000017281.1 (SMESG000017281.1)

HSP 1 Score: 553.132 bits (1424), Expect = 0.000e+0
Identity = 309/641 (48.21%), Postives = 411/641 (64.12%), Query Frame = 3
Query:  117 VVIANQDLSTIIKKQKNHGGWNDLMKECLTGPCKLIN---DDGSDATVMGPSGMIYRLNSELLVPF--KSVKKHKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKSEIVENTELKXXXXXXXXXXXXXXLITD--------------------ERTMRFLVALKTGNLSEVLRLVDSVGVNTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTES--GFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHI--------TKKELLEHPV-------QPSDARSNEAELMELRQKLKEMEDEKICKICHDRRLKVIFECGHMCCDDCSDNISECHLCSEKILHKIKI 1913
             VI + D+    + Q+NHGGW   M     G C  I      G     +   G++Y  N  LL       +K    G  V+LI D+ + KLLQ  HGEW   M   LGK+ +V  +F DGD ++   N+   ++P+ +++   ++       S     S   +L +D                    E  M+   A+K G L+ V  L +SVGVN  LKG+YPL+IA NEGH D+V LL+EK+AN+N  DKDGDTALHLAV +N+ K+CDLL+ KGADVNAQNN KITP M+A   GS +I  LL TS NADLSIGDSD DTALHLAV  SR+ SVE LL+AGADI  LNKKLFN +HLAA+ GH KILE+FLKR+G K+V+SQKEDKFAAIH+ A+NNHE CL VL+ YKAD+N++N  L+TALHIAV +K+L+ VK LVEN AE++L+D +G+T LH+AMKV Q E+    G    M S +G+LG++ EG D  +DIAIYL+++GA +D+KN KG TP+++CND+ LK RILSL   +S K  +        TK E  E P+        P + +S + EL ELRQ++++MEDEK C IC+DR + V F CGH+ CD C++N+ ECH+C E I +KI++
Sbjct:  240 TVILSDDIQKTKQLQQNHGGWVSRM-SVFAGKCGKIEAILPTGDVKVNVNGLGLVY--NPLLLTKSDKSDLKMFAPGDKVRLINDKSKVKLLQKNHGEWVSSMEFFLGKKGKVKSLFADGDLRVKIMNQNLTLNPECVEATDSDSDSDPDIFSMMEHLSKLMNLDSDQSDQEDKGKDSDDGKTDGNQEEVMKLFFAVKNGELNNVRNLCESVGVNARLKGIYPLMIAVNEGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKARILSLNIPNSTKQDLIEKEPNPGTKAERFEAPIAPIRQLSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRL 877          

HSP 2 Score: 163.696 bits (413), Expect = 6.320e-42
Identity = 80/151 (52.98%), Postives = 103/151 (68.21%), Query Frame = 3
Query:   78 MGANISSFDIRKKVVIANQDLSTIIKKQKNHGGWNDLMKECLTGPCKLINDDGSDATVMGPSGMIYRLNSELLVPFKSVKKHK--IGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKSE 524
            MGA++S       VVIA +DL TII+ Q  HGGWND M ECL GPCKL+   GSDA V GPSG +YRLNSELL  + S    +   G  V+LIQDE++F+ LQ  HGEW  +M++I+GK+V+VI  F DGD KI +N   F+++PK I S+
Sbjct:    1 MGASLSGLKAGDDVVIAIKDLETIIQMQMAHGGWNDSMNECLIGPCKLVQGIGSDAIVRGPSGNVYRLNSELLSKYGSDTSQESISGYVVELIQDEKQFRQLQVGHGEWNNNMKDIIGKKVQVIHKFLDGDVKIKYNGSTFVINPKAIASK 151          

HSP 3 Score: 64.6994 bits (156), Expect = 1.898e-10
Identity = 47/161 (29.19%), Postives = 77/161 (47.83%), Query Frame = 3
Query:   54 FNTEYYY*MGANISSFDIRKKVVIANQDLSTIIKKQKNHGGWNDLMKECLTGPCKLINDDGSDATVMGPSGMIYRLNSELLV------PFKSV-KKHKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTI 515
             N+E     G++ S   I   VV   QD     + Q  HG WN+ MK+ +    ++I+        +  +G  + +N + +       P   V  K KIG  V LI + +  K LQ  HG W + +    GKEVE+++IF+DGD  +S     ++++P+ I
Sbjct:   68 LNSELLSKYGSDTSQESISGYVVELIQDEKQFRQLQVGHGEWNNNMKDIIGKKVQVIHKFLDGDVKIKYNGSTFVINPKAIASKNEKPPVSEVCHKFKIGEKVVLIGNVDTMKKLQENHGGWSDLLMLYAGKEVEIVEIFEDGDMYVSKFGMEWMINPECI 228          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Planmine SMEST
Match: SMESG000017279.1 (SMESG000017279.1)

HSP 1 Score: 480.715 bits (1236), Expect = 1.053e-158
Identity = 281/644 (43.63%), Postives = 394/644 (61.18%), Query Frame = 3
Query:  135 DLSTIIKKQKNHGGWNDLMKECLTGPCKL----------INDD------------GSDATVMGPSGMIYRLNSELLVPFKSVKKHKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKS-----EIVENTELKXXXXXXXXXXXXXXLITDE----RTMRFLVALKTGNLSEVLRLVDSVGVNTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTES--GFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHITK------------KELLEHPVQPSDA------RSNEAELMELRQKLKEMEDEKICKICHDRRLKVIFECGHMCCDDCSDNISECHLCSEKILHKIKI 1913
            D+  I + Q+NHGGW + M+ C    CK+          +N D              +     P+    +      +    VK    G  V+LI ++ + K LQ  HGEW   M+ +LGK  +V  +  +GD K+    +   ++P+ +++     E   + +   +        +D S  +DE    RT  F  ALK GNL+EV +LVDSVG +T L+G+YPL+IA NEGH D++ LL+EK+ANIN  +++GDTALH+AV +++FK+CDLL+ KGADVNAQNN KITP M+A   GS DI  LL TS NADLSIG+S+ DTALHLAV +   ESV  LL+AGADI  +N K FNA+HL A  G+E+ILE+FLKR+G K+VNSQK+DKFAA+H+A  NNHE CL VL+KYKAD+N++N  L+TALHIAV +KYL+ +K LVE  AE+D+ D NG+TALH+A++++  ++    G  L ++       +  EG DK ED+AIYL++  A  DIKN   +TP+D C D SLK ++     R   K   TK              L+ HP    D       ++ + EL ELRQ++++MEDE+ C IC DR+  V F CGH+ CD C++N+ ECH+C E I +KI++
Sbjct:  250 DIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARAQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLLEGVYPLMIAVNEGHIDVIKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNVLLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTALHIAVRIHSMDTVKKRGKLLGISGIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNKNDRTPMDFC-DPSLKEKLSVANARRMSKEIETKILQAQGSTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDERTCIICFDRQNNVTFGCGHVACDVCANNLYECHICRENIGNKIRL 892          

HSP 2 Score: 162.54 bits (410), Expect = 2.097e-41
Identity = 76/144 (52.78%), Postives = 102/144 (70.83%), Query Frame = 3
Query:  114 KVVIANQDLSTIIKKQKNHGGWNDLMKECLTGPCKLINDDGSDATVMGPSGMIYRLNSELLVPFKSVKKHKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKSEIVENTEL 545
            +VVI  +D+ TI  KQ+ HGGWN  M ECLTGPC+L+   GS A V GPSG +YRLNSELL+ + + + HKIGSFV LI++ EEFK LQ  +GEW +DM NILGK+VE+IQ F+DG+ KI +    F ++ K I ++  + T +
Sbjct:   13 QVVIGTKDMETIKIKQREHGGWNANMNECLTGPCQLVQSLGSCAIVKGPSGNVYRLNSELLIQYDTRQDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAILTDNCKKTSM 156          

HSP 3 Score: 61.2326 bits (147), Expect = 2.374e-9
Identity = 100/442 (22.62%), Postives = 183/442 (41.40%), Query Frame = 3
Query:  159 QKNHGGWNDLMKECLTGPCKLINDDGSDATVMGPSGMIYRLNSELLVP-----FKSVKKHKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKSEIVENTELKXXXXXXXXXXXXXXLITDERTMRFLVALKTGNLSEVLRLVDSVGVNTNLKGMYPLLIAANEGHEDLVN---LLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSI-GDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHL--AAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENK-AELDLKDKNGNTALHVAMKVNQTES 1448
            QK+HGGW +LM   +    +++         +   GM + +N + +       FKS K  K G  VQ+  D ++ K LQ  HG W   M    GK  +V  I   GD K++ +    + +P  +     E  +                  T  R  R     ++  L ++   V S G    L      +    +GH + VN    +L K   +   D +GD  L + +   +  L    + +  D + ++   I  TM+        + +++  S+++D S   D+DR      A+    L  V  L+++     LL       Y L  A   GH  ++++ +++     +N+++E+   A+H+A   +      +L+   AD+N QN    T + +A     +   + L  ++ A+L + +   +TALH+A+K    ES
Sbjct:  181 QKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCIGKRNENKFKSEKLRK-GDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLTK--CEGNQANP---------------TAARAQR----RRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGD--LKVKIMGQKLNLNPECV-EATDSDCESEPDIQ-TMV------NQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLLE----GVYPLMIAVNEGHIDVIKLLIEKRAN--INAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAES 584          

HSP 4 Score: 55.4546 bits (132), Expect = 1.446e-7
Identity = 38/127 (29.92%), Postives = 62/127 (48.82%), Query Frame = 3
Query:  159 QKNHGGWNDLMKECLTGPCKLINDDGSDATVMGPSGMIYRLNSELLVPFKSVKKHKIGSF--------VQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTI 515
            Q  +G W+D M   L    ++I         +   G  +R+NS+ ++   + KK  +           V LI++ E  K LQ  HG W E M   +G+EVE+++I KDGD  +S     ++++PK I
Sbjct:  101 QVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAILT-DNCKKTSMEMEETFEEGEKVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCI 226          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Planmine SMEST
Match: SMESG000030607.1 (SMESG000030607.1)

HSP 1 Score: 187.963 bits (476), Expect = 1.276e-49
Identity = 128/361 (35.46%), Postives = 205/361 (56.79%), Query Frame = 3
Query:  618 FLVALKTGNLSEVLRLVD--SVGVNTNLKGMYPLLIAANEGHEDLVNLLLE---KKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKR-DGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKY-KADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSALGVLGNIGEGLDK--LEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHI 1673
            F+ A   G+L +VL L+   SV VN+       L  A+  GH ++V  L++    + +IN+ D DGD A+H A   +   +  +L   GAD+N++N +  TP  IAV KG  ++L+ L+   +A  +  D D DT LH ++     +   AL+ A +DI + N   FN+ H AA+ G+     I L+    + +V+ +K+D + A+H+AA+NNH     +L+K   ADLN+QNI L+T LH+AV+R++ + VK LV++ A++ + DK+G+T LH A++ + T S       +     +L  +  G +K     IA YL+ NG+ I IKN KG+TPLD+C D +L  R L     +SQ  ++
Sbjct:  539 FVKAAANGDLDKVLELLKKRSVDVNSMFARHSALHAASQNGHVEIVQALIKYGGDQLDINLKDPDGDAAVHHAALGDHKIIIQILKNAGADINSRNRRNQTPLHIAVNKGHLEVLKALLELKSALQTNQDYDGDTPLHDSITRRHDKLTLALVQANSDITVCNNAGFNSLHHAALRGNPNATRIILENLPRQWIVDEKKDDGYTALHLAALNNHADVAELLIKVGSADLNVQNINLQTPLHLAVERQHSNMVKLLVDSGADISIPDKDGDTPLHEALR-HHTLSQLRQMQDLQDMGKLLMGLSLGGEKRSAAHIACYLVSNGSDIHIKNKKGQTPLDLCPDQNL-IRALKRCHENSQPPNV 897          

HSP 2 Score: 53.1434 bits (126), Expect = 6.809e-7
Identity = 21/65 (32.31%), Postives = 37/65 (56.92%), Query Frame = 3
Query: 1713 DARSNEAELMELRQKLKEMEDEKICKICHDRRLKVIFECGHMCCDDCSDNISECHLCSEKILHKI 1907
            D    + +  +L Q+ +++++  +C +C DR  K++F CGH  C  C D +  C +C E I +KI
Sbjct: 1226 DQSKKDKDYKKLEQQYQDIKEMTMCPVCMDRVRKMVFMCGHCSCQLCGDKLETCPICRETITNKI 1290          
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Planmine SMEST
Match: SMESG000030607.1 (SMESG000030607.1)

HSP 1 Score: 184.882 bits (468), Expect = 1.342e-48
Identity = 149/500 (29.80%), Postives = 239/500 (47.80%), Query Frame = 3
Query:  330 GSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKSEIVENTELKXXXXXXXXXXXXXXLITDERTMRF--------------LVALKTGNLSEVLRLV-------------------------------DSVGVNTNLKGMYPLLIAANEGHEDLVNLLLE---KKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKR-DGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKY-KADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTESGFGNFLKMTSALGVLGNIGEGLDK--LEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHI 1673
            G +V++  D E  K +Q   G W E M   +G   +++Q      +++     +      + +S  V N+ L +               T  RTM                + A  TG LS VLR +                                SV VN+       L  A+  GH ++V  L++    + +IN+ D DGD A+H A   +   +  +L   GAD+N++N +  TP  IAV KG  ++L+ L+       S+ D D DT LH ++     +   AL+ A +DI + N   FN+ H AA+ G+     I L+    + +V+ +K+D + A+H+AA+NNH     +L+K   ADLN+QNI L+T LH+AV+R++ + VK LV++ A++ + DK+G+T LH A++ + T S       +     +L  +  G +K     IA YL+ NG+ I IKN KG+TPLD+C D +L  R L     +SQ  ++
Sbjct:  405 GCWVKISSDLELIKTVQCGLGMWNESMAVCVGTVGKIVQSLGHDLWRV-----VLSRTSGSSESTFVLNSALLARIRSPMSSPEVSVSATQPRTMLLSQRSTGSTSQPIEAVEAASTGTLSHVLRSIFEAHTTGDAKELFVKAAANGDLDKVLELLKKRSVDVNSMFARHSALHAASQNGHVEIVQALIKYGGDQLDINLKDPDGDAAVHHAALGDHKIIIQILKNAGADINSRNRRNQTPLHIAVNKGHLEVLKALLELK-CLASLQDYDGDTPLHDSITRRHDKLTLALVQANSDITVCNNAGFNSLHHAALRGNPNATRIILENLPRQWIVDEKKDDGYTALHLAALNNHADVAELLIKVGSADLNVQNINLQTPLHLAVERQHSNMVKLLVDSGADISIPDKDGDTPLHEALR-HHTLSQLRQMQDLQDMGKLLMGLSLGGEKRSAAHIACYLVSNGSDIHIKNKKGQTPLDLCPDQNL-IRALKRCHENSQPPNV 896          

HSP 2 Score: 53.1434 bits (126), Expect = 7.414e-7
Identity = 21/65 (32.31%), Postives = 37/65 (56.92%), Query Frame = 3
Query: 1713 DARSNEAELMELRQKLKEMEDEKICKICHDRRLKVIFECGHMCCDDCSDNISECHLCSEKILHKI 1907
            D    + +  +L Q+ +++++  +C +C DR  K++F CGH  C  C D +  C +C E I +KI
Sbjct: 1225 DQSKKDKDYKKLEQQYQDIKEMTMCPVCMDRVRKMVFMCGHCSCQLCGDKLETCPICRETITNKI 1289          
The following BLAST results are available for this feature:
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MIB11.286e-7429.95mindbomb E3 ubiquitin protein ligase 1 [Source:HGN... [more]
MIB24.543e-5826.92mindbomb E3 ubiquitin protein ligase 2 [Source:HGN... [more]
MIB25.365e-5827.01mindbomb E3 ubiquitin protein ligase 2 [Source:HGN... [more]
MIB25.958e-5826.92mindbomb E3 ubiquitin protein ligase 2 [Source:HGN... [more]
MIB27.543e-5826.92mindbomb E3 ubiquitin protein ligase 2 [Source:HGN... [more]
back to top
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-443.118e-2927.60AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-443.118e-2927.60AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-443.242e-2927.60AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-443.242e-2927.60AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-443.512e-2927.60AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mib12.144e-7229.38gene:FBgn0263601 transcript:FBtr0333578[more]
mib14.372e-7229.38gene:FBgn0263601 transcript:FBtr0075520[more]
mib24.329e-4630.21gene:FBgn0086442 transcript:FBtr0336840[more]
mib24.329e-4630.21gene:FBgn0086442 transcript:FBtr0081142[more]
mib24.329e-4630.21gene:FBgn0086442 transcript:FBtr0336841[more]
back to top
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mib11.707e-7430.48mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib16.261e-7430.14mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib16.138e-7329.97mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib22.181e-3825.73mindbomb E3 ubiquitin protein ligase 2 [Source:ZFI... [more]
ripk47.037e-3131.06receptor-interacting serine-threonine kinase 4 [So... [more]
back to top
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mib13.146e-7430.13mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib15.930e-7330.25mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
coa74.868e-6728.17cytochrome c oxidase assembly factor 7 (putative) ... [more]
coa76.426e-6329.40cytochrome c oxidase assembly factor 7 (putative) ... [more]
coa71.848e-6229.55cytochrome c oxidase assembly factor 7 (putative) ... [more]
back to top
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mib11.768e-7530.11mindbomb E3 ubiquitin protein ligase 1 [Source:MGI... [more]
Mib11.768e-7530.11mindbomb E3 ubiquitin protein ligase 1 [Source:MGI... [more]
Mib12.369e-5829.37mindbomb E3 ubiquitin protein ligase 1 [Source:MGI... [more]
Mib24.353e-5427.16mindbomb E3 ubiquitin protein ligase 2 [Source:MGI... [more]
Ank21.215e-2726.63ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025][more]
back to top
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q80SY4|MIB1_MOUSE1.236e-7430.11E3 ubiquitin-protein ligase MIB1 OS=Mus musculus O... [more]
sp|Q86YT6|MIB1_HUMAN6.175e-7429.95E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens O... [more]
sp|Q804S5|MIB1_DANRE1.288e-7330.48E3 ubiquitin-protein ligase mib1 OS=Danio rerio OX... [more]
sp|Q6GNY1|MIB1_XENLA3.204e-7329.79E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis... [more]
sp|Q9VUX2|MIB_DROME4.382e-7129.38E3 ubiquitin-protein ligase mind-bomb OS=Drosophil... [more]
back to top
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0P5YTS71.599e-7631.80E3 ubiquitin-protein ligase mib1 OS=Daphnia magna ... [more]
A0A0P5H4364.395e-7631.49E3 ubiquitin-protein ligase mib1 OS=Daphnia magna ... [more]
A0A0P5QQ022.877e-7531.64E3 ubiquitin-protein ligase mib1 OS=Daphnia magna ... [more]
A0A4Y2LV216.596e-7531.16E3 ubiquitin-protein ligase MIB1 OS=Araneus ventri... [more]
A0A0C9RRG61.325e-7432.31MIB1 protein OS=Fopius arisanus OX=64838 GN=MIB1 P... [more]
back to top
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mib17.187e-7430.16mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib11.086e-7330.16mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib25.406e-6729.30mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
mib25.880e-6729.51mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
mib26.298e-6729.30mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
back to top
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008505.13.324e-4026.49pep scaffold:Pmarinus_7.0:GL477211:28706:49738:-1 ... [more]
ENSPMAT00000007446.14.583e-2827.71pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1... [more]
ENSPMAT00000000093.12.439e-2730.60pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
ENSPMAT00000000095.12.687e-2630.74pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
ankdd1a7.940e-2629.78ankyrin repeat and death domain containing 1A [Sou... [more]
back to top
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
AVO21.548e-1030.86Component of a complex containing the Tor2p kinase... [more]
AKR24.493e-927.14Ankyrin repeat-containing protein; member of a fam... [more]
AKR11.105e-825.11Palmitoyl transferase involved in protein palmitoy... [more]
HOS43.478e-633.02Subunit of the Set3 complex; complex is a meiotic-... [more]
back to top
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO391138.389e-1631.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494858.830e-1530.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387254.428e-1328.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387021.243e-1226.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436903.216e-1226.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mib11.605e-7430.00mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib12.136e-7430.00mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib22.146e-6730.18mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
mib22.672e-6730.18mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
mib23.421e-6730.18mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
back to top
BLAST of E3 ubiquitin-protein ligase mind-bomb vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000031930.10.000e+0100.00SMESG000031930.1[more]
SMESG000017281.16.320e-4248.21SMESG000017281.1[more]
SMESG000017279.11.053e-15843.63SMESG000017279.1[more]
SMESG000030607.11.276e-4935.46SMESG000030607.1[more]
SMESG000030607.11.342e-4829.80SMESG000030607.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035592 ID=SMED30035592|Name=E3 ubiquitin-protein ligase mind-bomb|organism=Schmidtea mediterranea sexual|type=transcript|length=2034bp
CGAAAATAAAGTGCTATAAATATGAGATTGTTTTATTGTTTGATTTAAAA
TCTTTTAATACAGAATATTATTATTAAATGGGGGCTAATATTTCTAGTTT
CGACATAAGAAAGAAAGTGGTAATCGCAAATCAAGATTTATCAACAATTA
TAAAGAAACAGAAAAATCATGGGGGGTGGAATGATTTAATGAAGGAGTGC
CTCACTGGACCATGCAAACTAATAAACGATGATGGCTCAGATGCAACGGT
GATGGGTCCTTCCGGTATGATTTACAGATTAAATTCGGAATTATTGGTCC
CATTTAAATCTGTTAAAAAACATAAAATTGGATCATTTGTACAACTTATT
CAAGATGAAGAGGAATTTAAGCTACTACAAAATACACATGGAGAATGGAA
AGAAGATATGAGAAATATTTTGGGCAAGGAAGTGGAAGTCATCCAAATAT
TTAAAGATGGTGACTATAAAATTAGCCACAACAATGAGATCTTTATAGTC
CATCCTAAAACTATTAAGAGCGAAATTGTGGAAAATACAGAATTAAAATC
TGACGATTCCGACGATTCCGACGATTCCAATGATAGAAGCCTTATTACAG
ATGAGAGGACCATGAGATTTTTAGTTGCCCTTAAAACAGGAAATTTAAGC
GAAGTGTTAAGATTAGTAGATTCGGTTGGAGTGAATACGAACCTAAAAGG
CATGTATCCTTTGTTGATTGCAGCTAATGAAGGTCATGAAGATTTGGTGA
ATTTATTATTAGAAAAGAAGGCAAATATCAACATAGCAGATAAGGATGGT
GATACCGCTCTCCATTTAGCTGTCCATGAAAACCGATTTAAATTATGCGA
CCTGCTTCTAAAGAAAGGTGCAGACGTGAATGCTCAAAATAATAAGAAAA
TCACTCCTACCATGATAGCAGTATTGAAAGGGTCCCAAGATATTCTGGAA
CTTCTGATTACTTCCAATAATGCTGATCTTAGTATCGGAGATTCTGACAG
AGATACCGCTCTTCATTTAGCGGTTAATAGCTCACGTTTGGAATCTGTGG
AAGCATTGCTGAATGCCGGGGCTGACATTTATTTGTTGAATAAAAAATTA
TTTAACGCATATCACCTTGCAGCAATAAGCGGTCATGAAAAAATTCTTGA
AATATTTTTGAAAAGAGATGGCGAAAAACTTGTAAATTCCCAAAAAGAGG
ATAAGTTTGCTGCCATACATATGGCAGCTATGAATAACCATGAACATTGT
TTGCCAGTGCTAATGAAATACAAGGCCGACCTAAACCTTCAAAACATCGA
ATTGCGAACTGCATTGCATATAGCTGTAAAGAGGAAATATTTGTCATTTG
TAAAACATTTGGTGGAAAATAAAGCAGAATTAGATTTGAAGGATAAAAAT
GGTAATACAGCTCTCCATGTAGCAATGAAGGTCAATCAAACGGAATCAGG
ATTCGGTAATTTTTTAAAGATGACAAGCGCGTTGGGAGTTTTAGGAAATA
TCGGTGAAGGATTAGACAAACTGGAAGATATTGCGATTTATTTGATAGAA
AATGGAGCGAGCATTGATATAAAGAACAACAAAGGTAAAACGCCTTTGGA
TATATGCAATGATAATTCGTTGAAAACAAGAATATTAAGTTTGGTTGAAC
GCGATTCCCAAAAGCATCATATAACAAAGAAAGAACTGCTTGAGCATCCG
GTCCAGCCATCTGATGCACGATCAAATGAGGCAGAACTTATGGAGTTGCG
GCAGAAACTAAAGGAAATGGAAGACGAAAAAATTTGTAAAATTTGTCATG
ACCGACGGCTTAAGGTGATATTTGAATGTGGCCATATGTGTTGTGATGAT
TGCTCTGATAATATCTCAGAATGTCACCTGTGCTCGGAAAAGATCCTTCA
CAAGATTAAAATAAATTAGTGATGCCATATCTATAAACAGACTTTTATAT
TTATCTATTAGCTAACAAACTTTTATTCTAACAATCCTTTGGTGTTTTTA
TTAACTTTGATTATCATTTTACTTTTTAAAAAAA
back to top

protein sequence of SMED30035592-orf-1

>SMED30035592-orf-1 ID=SMED30035592-orf-1|Name=SMED30035592-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=614bp
MGANISSFDIRKKVVIANQDLSTIIKKQKNHGGWNDLMKECLTGPCKLIN
DDGSDATVMGPSGMIYRLNSELLVPFKSVKKHKIGSFVQLIQDEEEFKLL
QNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKSEI
VENTELKSDDSDDSDDSNDRSLITDERTMRFLVALKTGNLSEVLRLVDSV
GVNTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVH
ENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNAD
LSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAI
SGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKA
DLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAM
KVNQTESGFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKN
NKGKTPLDICNDNSLKTRILSLVERDSQKHHITKKELLEHPVQPSDARSN
EAELMELRQKLKEMEDEKICKICHDRRLKVIFECGHMCCDDCSDNISECH
LCSEKILHKIKIN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR040847SH3_15
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
IPR013083Znf_RING/FYVE/PHD
IPR001841Znf_RING
IPR007921CHAP_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0004842ubiquitin-protein transferase activity
GO:0016874ligase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0016567protein ubiquitination
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 547..567
NoneNo IPR availablePANTHERPTHR24202FAMILY NOT NAMEDcoord: 73..603
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 408..437
e-value: 0.0026
score: 27.0
coord: 375..404
e-value: 0.034
score: 23.3
coord: 307..336
e-value: 8.3E-4
score: 28.6
coord: 273..303
e-value: 46.0
score: 12.9
coord: 240..269
e-value: 1.3E-5
score: 34.6
coord: 441..498
e-value: 8.1
score: 15.4
coord: 207..236
e-value: 1.0E-4
score: 31.6
coord: 340..369
e-value: 9.6
score: 15.1
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 307..339
score: 12.075
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 207..239
score: 12.796
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 375..407
score: 8.79
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 408..440
score: 10.686
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 240..272
score: 14.666
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 380..454
e-value: 5.4E-10
score: 39.7
coord: 273..335
e-value: 2.9E-8
score: 34.2
coord: 184..271
e-value: 7.0E-14
score: 52.2
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 207..507
score: 67.301
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 367..542
e-value: 9.1E-31
score: 108.6
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 155..292
e-value: 2.4E-30
score: 107.9
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 293..366
e-value: 3.4E-14
score: 54.8
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 192..454
IPR040847Mind bomb, SH3 repeat domainPFAMPF18346SH3_15coord: 83..144
e-value: 6.3E-6
score: 26.4
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 545..613
e-value: 1.3E-11
score: 45.7
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 570..603
score: 9.214